########################################
# Program: pepdigest
# Rundate: Tue 17 Nov 2020 13:36:15
# Commandline: pepdigest
#    [-seqall] ami/ECD_10028.fasta
#    -menu 2
#    -mono
#    -allpartials
#    -outfile digest_db/ECD_10028.db
# Report_format: seqtable
# Report_file: digest_db/ECD_10028.db
########################################

#=======================================
#
# Sequence: ECD_10028     from: 1   to: 64
# HitCount: 3
#
# Complete digestion with Lys-C yields 3 fragments
#
#=======================================

  Start     End Mol_Weight Cterm  Nterm  Sequence
     33      64   3538.861 K      .      MQSRNSSQVIVRACITVSGFFISAQQVRALSR
      3      32   3298.678 K      M      RGGAYYRFRLVGHFDVSSGTPTIAGREVCK
      1       2    277.146 .      R      MK

#---------------------------------------
#---------------------------------------
#=======================================
#
# Sequence: ECD_10028     from: 1   to: 64
# HitCount: 2
#
# 
# 
# Partial digest with Lys-C yields 2 extras.
# All partials shown:
#
#=======================================

  Start     End Mol_Weight Cterm  Nterm  Sequence
      1      64   7078.664 .      .      MKRGGAYYRFRLVGHFDVSSGTPTIAGREVCKMQSRNSSQVIVRACITVSGFFISAQQVRALSR
      1      32   3557.814 .      M      MKRGGAYYRFRLVGHFDVSSGTPTIAGREVCK

#---------------------------------------
#---------------------------------------