CDS SAVERM_1 1811 1380 hypothetical protein 7.24 16158 W no similarity 6 BAC67710.1 Non-secretory protein CDS SAVERM_2 2466 2699 putative secreted protein PF04851: Type III restriction enzyme, res subunit 7.42 8016 W similar to unknown proteins 5 BAC67711.1 Non-secretory protein CDS SAVERM_3 2765 3310 putative endonuclease VII PF02945: Recombination endonuclease VII 7.07 20448 W DNA recombination 3.3 BAC67712.1 Non-secretory protein CDS SAVERM_4 3939 3433 hypothetical protein 9.17 18255 W no similarity 6 BAC67713.1 Non-secretory protein CDS SAVERM_5 3994 4932 hypothetical protein 5.64 35287 W no similarity 6 BAC67714.1 Non-secretory protein CDS SAVERM_6 4936 7563 ttrA1 putative helicase PF03457: Helicase associated domain 6.6 96115 W DNA modification & repair 3.2 BAC67715.1 Non-secretory protein CDS SAVERM_7 7554 9626 putative IS4 family transposase PF00589: Phage integrase family 9.18 77303 W transposon & IS 4.5 BAC67716.1 Non-secretory protein CDS SAVERM_8 10635 9886 hypothetical protein 8.89 27394 W no similarity 6 BAC67717.1 Non-secretory protein CDS SAVERM_9 10805 10632 hypothetical protein PF00589: Phage integrase family 11.58 6595 W no similarity 6 BAC67718.1 Non-secretory protein CDS SAVERM_10 13497 11101 hypothetical protein 5.88 87115 W no similarity 6 BAC67719.1 Non-secretory protein CDS SAVERM_11 15523 13376 hypothetical protein 5.72 78108 W no similarity 6 BAC67720.1 Non-secretory protein CDS SAVERM_12 17701 15815 hypothetical protein PF13576: Pentapeptide repeats (9 copies) 8.23 68372 W similar to unknown proteins 5 BAC67721.1 Non-secretory protein CDS SAVERM_13 17828 18922 hypothetical protein PF03457: Helicase associated domain 5.13 41006 W similar to unknown proteins 5 BAC67722.1 Non-secretory protein CDS SAVERM_14 19446 20279 putative membrane protein 9.67 29546 W miscellaneous 4.7 BAC67723.1 Non-secretory protein CDS SAVERM_15 21562 22080 hypothetical protein 4.59 18948 W similar to unknown proteins 5 BAC67724.1 Non-secretory protein CDS SAVERM_16 22243 22770 hypothetical protein 5.64 19314 W similar to unknown proteins 5 BAC67725.1 Non-secretory protein CDS SAVERM_17 23457 23621 hypothetical protein 9 6003 W no similarity 6 BAC67726.1 Non-secretory protein CDS SAVERM_18 23675 24559 putative IS5 family IS1648-like transposase IS5 family (23622..25034). Inverted repeat sequence (16/18 bp). Target sequence (CTAG). 12.29 33752 W transposon & IS 4.5 BAC67727.1 Non-secretory protein CDS SAVERM_19 24983 24570 hypothetical protein 4.27 15359 W no similarity 6 BAC67728.1 Non-secretory protein CDS SAVERM_20 25690 25166 hypothetical protein 4.05 18596 W no similarity 6 BAC67729.1 Non-secretory protein CDS SAVERM_21 29451 25699 rhsA putative Rhs protein PF05593: RHS Repeat 5.83 138303 W miscellaneous 4.7 BAC67730.1 Non-secretory protein CDS SAVERM_22 30080 29508 hypothetical protein 8.96 19913 W no similarity 6 BAC67731.1 Non-secretory protein CDS SAVERM_23 30394 30107 hypothetical protein 4.59 9898 W no similarity 6 BAC67732.1 Non-secretory protein CDS SAVERM_24 31323 30394 hypothetical protein 8.12 33537 W no similarity 6 BAC67733.1 Non-secretory protein CDS SAVERM_25 32559 32197 hypothetical protein 7.09 13869 W similar to unknown proteins 5 BAC67734.1 Non-secretory protein CDS SAVERM_26 33124 32552 sig1 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 5.41 21431 W RNA initiation 3.5.1 BAC67735.1 Non-secretory protein CDS SAVERM_27 33411 33121 hypothetical protein 8.24 10401 W no similarity 6 BAC67736.1 Non-secretory protein CDS SAVERM_28 34056 35792 putative two-component system sensor kinase PF03457: Helicase associated domain 7.04 62605 W sensors 1.3 BAC67737.1 Non-secretory protein CDS SAVERM_29 37315 37656 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 8.92 12204 W regulation 3.5.2 BAC67738.1 Non-secretory protein CDS SAVERM_30 37653 38609 hypothetical protein 10.56 34281 W no similarity 6 BAC67739.1 Non-secretory protein CDS SAVERM_31 38623 39624 putative prepilin peptidase-like protein PF01569: PAP2 superfamily 10.17 34877 W protein modification 3.8 BAC67740.1 Non-secretory protein CDS SAVERM_32 41010 41612 hypothetical protein 5.94 21851 W no similarity 6 BAC67741.1 Signal peptide CDS SAVERM_33 41967 41665 hypothetical protein PF14040: Deoxyribonuclease NucA/NucB 5.1 10762 W no similarity 6 BAC67742.1 Non-secretory protein CDS SAVERM_34 42010 44046 putative secreted protein Tat substrate 6.26 72255 W similar to unknown proteins 5 BAC67743.1 Non-secretory protein CDS SAVERM_35 44958 44107 putative SMI1/KNR4 family protein, secreted 4.92 30944 W no similarity 6 BAC67744.1 Signal peptide CDS SAVERM_36 45432 45160 putative secreted protein 7.35 9408 W no similarity 6 BAC67745.1 Signal peptide CDS SAVERM_37 47141 45819 hypothetical protein PF10282: Lactonase, 7-bladed beta-propeller 10.3 45636 W similar to unknown proteins 5 BAC67746.1 Non-secretory protein CDS SAVERM_38 48180 47239 putative hydrolase PF00561: alpha/beta hydrolase fold 6.68 33810 W miscellaneous 4.7 BAC67747.1 Non-secretory protein CDS SAVERM_39 49166 49456 putative terminal protein Tpg homolog probably pseudogene 11.56 10437 W DNA packaging & segregation 3.4 BAC67748.1 Non-secretory protein CDS SAVERM_40 50434 49694 hypothetical protein 10.49 25739 W no similarity 6 BAC67749.1 Non-secretory protein CDS SAVERM_41 50901 50521 putative secreted protein 7.94 13438 W no similarity 6 BAC67750.1 Signal peptide CDS SAVERM_42 51232 52623 putative transcriptional regulator PF01381: Helix-turn-helix 7.29 48906 W similar to unknown proteins 5 BAC67751.1 Non-secretory protein CDS SAVERM_43 53113 53505 putative IS5 family IS4811-like transposase PF13340: Putative transposase of IS4/5 family (DUF4096); IS5 family, partial 12.03 14602 W transposon & IS 4.5 BAC67752.1 Non-secretory protein CDS SAVERM_44 54215 55330 putative unsaturated glucuronyl hydrolase PF07470: Glycosyl Hydrolase Family 88 8.43 40812 W miscellaneous 4.7 BAC67753.1 Non-secretory protein CDS SAVERM_45 56061 55687 putative IS5 family ISJp4-like transposase IS5 family (55644..56560). Inverted repeat sequence (12/14 bp). Translation will be controlled by frameshift with SAV46. PF13586: Transposase DDE domain 12.07 14358 W transposon & IS 4.5 BAC67754.1 Non-secretory protein CDS SAVERM_46 56441 56052 putative IS5 family IS1421-like transposase IS5 family (55644..56560). Inverted repeat sequence (12/14 bp). PF13340: Putative transposase of IS4/5 family (DUF4096) 11.76 14462 W transposon & IS 4.5 BAC67755.1 Non-secretory protein CDS SAVERM_47 56620 57810 putative IS605 family IS1136A-like transposase IS200/IS605 family (56610..57918). Inverted repeat sequence (12/15 bp). Target sequence (AT). PF01385: Probable transposase 11.34 44595 W transposon & IS 4.5 BAC67756.1 Non-secretory protein CDS SAVERM_48 58824 58168 hypothetical protein 5.72 24158 W no similarity 6 BAC67757.1 Non-secretory protein CDS SAVERM_49 58919 59212 hypothetical protein 8.81 11359 W no similarity 6 BAC67758.1 Non-secretory protein CDS SAVERM_50 61488 59260 putative FUSC family protein PF13515: Fusaric acid resistance protein-like 11.21 77889 W similar to unknown proteins 5 BAC67759.1 Non-secretory protein CDS SAVERM_51 62751 62242 putative acetyltransferase PF13673: Acetyltransferase (GNAT) domain 7.87 18472 W miscellaneous 4.7 BAC67760.1 Non-secretory protein CDS SAVERM_52 63342 62965 hypothetical protein 4.66 12383 W no similarity 6 BAC67761.1 Non-secretory protein CDS SAVERM_53 63529 64401 putative XRE-family transcriptional regulator PF13560: Helix-turn-helix domain 9.2 32895 Y regulation 3.5.2 BAC67762.1 Non-secretory protein CDS SAVERM_54 64588 64481 hypothetical protein 12.8 3633 Y no similarity 6 BAC67763.1 Non-secretory protein CDS SAVERM_55 65045 64632 hypothetical protein 7.89 14309 Y no similarity 6 BAC67764.1 Non-secretory protein CDS SAVERM_56 65398 65216 hypothetical protein 12.21 6946 Y no similarity 6 BAC67765.1 Non-secretory protein CDS SAVERM_57 66591 65536 putative cell shape-determining protein, secreted PF01833: IPT/TIG domain 9.44 33161 Y similar to unknown proteins 5 BAC67766.1 Signal peptide CDS SAVERM_58 67546 66803 putative cell surface protein PF01833: IPT/TIG domain 3.79 23451 Y similar to unknown proteins 5 BAC67767.1 Non-secretory protein CDS SAVERM_59 69136 69402 putative secreted protein 3.98 8897 A no similarity 6 BAC67768.1 Signal peptide CDS SAVERM_60 70617 70102 hypothetical protein 4.25 18035 A no similarity 6 BAC67769.1 Non-secretory protein CDS SAVERM_61 71920 70718 putative IS605 family IS1136A0-like transposase IS200/IS605 family. PF01385: Probable transposase 11.27 44896 A transposon & IS 4.5 BAC67770.1 Non-secretory protein CDS SAVERM_62 72189 72680 putative transmembrane transport protein PF11188: Protein of unknown function (DUF2975) 8.54 17120 A transport / binding proteins & lipoproteins 1.2 BAC67771.1 Signal peptide CDS SAVERM_63 72680 72901 putative transcriptional regulatory protein PF13443: Cro/C1-type HTH DNA-binding domain 8.22 7748 A regulation 3.5.2 BAC67772.1 Non-secretory protein CDS SAVERM_64 73063 73698 hypothetical protein 9.2 22562 A no similarity 6 BAC67773.1 Non-secretory protein CDS SAVERM_65 74098 74520 hypothetical protein 4.2 14872 A similar to unknown proteins 5 BAC67774.1 Non-secretory protein CDS SAVERM_66 74899 74429 putative IS605 family IS1136A0-like transposase IS200/IS605 family, truncated. PF01385: Probable transposase 11.92 17794 A miscellaneous 4.7 BAC67775.1 Non-secretory protein CDS SAVERM_67 75600 76676 putative AraC-family transcriptional regulator PF12833: Helix-turn-helix domain 9.63 38384 A regulation 3.5.2 BAC67776.1 Non-secretory protein CDS SAVERM_68 77069 78430 hypothetical protein 5.14 49115 A no similarity 6 BAC67777.1 Non-secretory protein CDS SAVERM_69 78733 78972 hypothetical protein 5.01 8839 A no similarity 6 BAC67778.1 Non-secretory protein CDS SAVERM_70 79262 79005 hypothetical protein 11.08 8945 A no similarity 6 BAC67779.1 Non-secretory protein CDS SAVERM_71 79425 79850 putavie cyclase/dehydrase PF03364: Polyketide cyclase / dehydrase and lipid transport 4.5 15590 A miscellaneous 4.7 BAC67780.1 Non-secretory protein CDS SAVERM_72 82215 80560 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.54 58292 A sensors 1.3 BAC67781.1 Non-secretory protein CDS SAVERM_73 82954 82208 putative two-component system response regulator PF00072: Response regulator receiver domain 5.07 27236 A regulation 3.5.2 BAC67782.1 Non-secretory protein CDS SAVERM_74 83059 84600 hypothetical protein PF09852: Predicted membrane protein (DUF2079) 10.5 54596 A similar to unknown proteins 5 BAC67783.1 Non-secretory protein CDS SAVERM_75 85042 85431 putative endoribonuclease L-PSP PF01042: Endoribonuclease L-PSP 5.62 13645 A similar to unknown proteins 5 BAC67784.1 Non-secretory protein CDS SAVERM_76 86073 87080 ams avermitilol synthase (sesquiterpene synthase) PF03936: Terpene synthase family, metal binding domain 6.28 36480 A antibiotic production 4.3 BAC67785.1 Non-secretory protein CDS SAVERM_77 87629 87168 putative rRNA methyltransferase truncated methyltransferase; SAV77 and SAV80 will be split by insertion of ISSav12 11.62 17018 A RNA modification 3.6 BAC67786.1 Non-secretory protein CDS SAVERM_78 88276 87716 putative IS982 family ISCef3-like transposase IS607 family (87687..89851) Inverted repeat sequence (16/17 bp) Target sequence (CTAG). PF01609: Transposase DDE domain 9.99 20549 A transposon & IS 4.5 BAC67787.1 Non-secretory protein CDS SAVERM_79 89640 88693 putative ISL3 family ISPpu12-like transposase IS607 family (87687..89851) Inverted repeat sequence (16/17 bp) Target sequence (CTAG). PF13411: MerR HTH family regulatory protein 4.63 35580 A transposon & IS 4.5 BAC67788.1 Non-secretory protein CDS SAVERM_80 90179 89844 putative rRNA methyltransferase mycinamicin resistance protein homolog 6.91 11734 A RNA modification 3.6 BAC67789.1 Non-secretory protein CDS SAVERM_81 91192 90422 putative oligosaccharide deacetylase, secreted PF01522: Polysaccharide deacetylase 9.43 27098 A miscellaneous 4.7 BAC67790.1 Signal peptide CDS SAVERM_82 92317 91736 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 8.89 20551 A regulation 3.5.2 BAC67791.1 Non-secretory protein CDS SAVERM_83 92523 92741 hypothetical protein PF16571: FBP C-terminal treble-clef zinc-finger 8.29 6863 A similar to unknown proteins 5 BAC67792.1 Non-secretory protein CDS SAVERM_84 94183 92939 hypothetical protein PF05139: Erythromycin esterase 6.84 45201 A similar to unknown proteins 5 BAC67793.1 Non-secretory protein CDS SAVERM_85 94242 95009 putative MerR-family transcriptional regulator PF13411: MerR HTH family regulatory protein 11.1 27250 A regulation 3.5.2 BAC67794.1 Non-secretory protein CDS SAVERM_86 96105 95110 putative erythropoiesis-stimulating protein PF00196: Bacterial regulatory proteins, luxR family 6.19 35853 A regulation 3.5.2 BAC67795.1 Non-secretory protein CDS SAVERM_87 96235 96567 hypothetical protein 9.32 12247 A no similarity 6 BAC67796.1 Non-secretory protein CDS SAVERM_88 100050 99274 hypothetical protein 11.3 27542 A similar to unknown proteins 5 BAC67797.1 Non-secretory protein CDS SAVERM_89 100866 100279 putative secreted protein PF03752: Short repeats of unknown function 4.4 20692 A similar to unknown proteins 5 BAC67798.1 Signal peptide CDS SAVERM_90 100955 101362 putative hydrolase PF12697: Alpha/beta hydrolase family 11.04 14294 A miscellaneous 4.7 BAC67799.1 Non-secretory protein CDS SAVERM_91 101447 101893 hypothetical protein PF13391: HNH endonuclease 10.06 15931 A similar to unknown proteins 5 BAC67800.1 Non-secretory protein CDS SAVERM_92 102549 103163 putative class F sortase Tat substrate, PF04203: Sortase family 11.43 20926 A transport / binding proteins & lipoproteins 1.2 BAC67801.1 Signal peptide CDS SAVERM_93 103255 103746 sig2 putative RNA polymerase ECF-subfamily sigma factor similar to SCO3736, PF04542: Sigma-70 region 2 10.63 18892 A RNA initiation 3.5.1 BAC67802.1 Non-secretory protein CDS SAVERM_94 103709 104197 hypothetical protein 8.52 15962 A similar to unknown proteins 5 BAC67803.1 Non-secretory protein CDS SAVERM_95 104696 106234 putative secreted protein 6.59 54170 A similar to unknown proteins 5 BAC67804.1 Signal peptide CDS SAVERM_96 106628 107440 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 8.91 27938 A similar to unknown proteins 5 BAC67805.1 Non-secretory protein CDS SAVERM_97 108027 107491 putative secreted protein 6.5 18095 A similar to unknown proteins 5 BAC67806.1 Non-secretory protein CDS SAVERM_98 110238 108349 putative glycosyl hydrolase PF00723: Glycosyl hydrolases family 15 5.52 70740 A similar to unknown proteins 5 BAC67807.1 Non-secretory protein CDS SAVERM_99 110830 113364 putative integral membrane protein PF03176: MMPL family 11.21 86510 A miscellaneous 4.7 BAC67808.1 Non-secretory protein CDS SAVERM_100 113361 114866 pks11-1 putative polyketide synthase (type-II KS) pks11, PF00109: Beta-ketoacyl synthase, N-terminal domain 7.23 52192 A antibiotic production 4.3 BAC67809.1 Non-secretory protein CDS SAVERM_101 114860 118594 pks11-2 putative polyketide synthase (type-II AT + aminotransferase) pks11, PF00698: Acyl transferase domain, PF00155: Aminotransferase class I and II 6.53 130117 A antibiotic production 4.3 BAC67810.1 Non-secretory protein CDS SAVERM_102 119221 118868 hypothetical protein 6.97 13651 A similar to unknown proteins 5 BAC67811.1 Non-secretory protein CDS SAVERM_103 119461 120039 putative IS256 family IS1245-like transposase IS256 family (119399..121219). Inverted repeat sequence (22/25 bp). Target sequence (CG). PF00872: Transposase, Mutator family 9.09 21522 A transposon & IS 4.5 BAC67812.1 Non-secretory protein CDS SAVERM_104 120102 120611 putative IS256 family IS1245-like transposase IS256 family, partial. PF00872: Transposase, Mutator family 9.11 18893 A transposon & IS 4.5 BAC67813.1 Non-secretory protein CDS SAVERM_105 122162 121935 hypothetical protein 8.66 8597 A no similarity 6 BAC67814.1 Non-secretory protein CDS SAVERM_106 123637 124200 putative secreted protein 9.75 20503 A no similarity 6 BAC67815.1 Signal peptide CDS SAVERM_107 124557 124883 hypothetical protein PF00723: Glycosyl hydrolases family 15 6.23 12355 A similar to unknown proteins 5 BAC67816.1 Non-secretory protein CDS SAVERM_108 124945 125364 hypothetical protein 5.12 14522 A similar to unknown proteins 5 BAC67817.1 Non-secretory protein CDS SAVERM_109 125995 127230 cyp1 cytochrome P450 hydroxylase CYP154A2, PF00067: Cytochrome P450 5.41 44902 A metabolism of coenzymes & prosthetic groups 2.5 BAC67818.1 Non-secretory protein CDS SAVERM_110 127243 128214 putative IS5 family IS1373-like transposase IS5 family ISL2 group. PF13359: DDE superfamily endonuclease 11.91 34375 A transposon & IS 4.5 BAC67819.1 Non-secretory protein CDS SAVERM_111 128743 128414 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 9.04 11566 A regulation 3.5.2 BAC67820.1 Non-secretory protein CDS SAVERM_112 129497 132031 hypothetical protein PF07228: Stage II sporulation protein E (SpoIIE) 6.7 87879 A similar to unknown proteins 5 BAC67821.1 Non-secretory protein CDS SAVERM_113 132082 132333 hypothetical protein 11.58 9375 A no similarity 6 BAC67822.1 Non-secretory protein CDS SAVERM_114 132479 133000 putative IS701 family ISSus1-like transposase IS701 family (131931..133947). Inverted repeat sequence (21/27 bp). Target sequence (GC). PF13546: DDE superfamily endonuclease 11.24 19396 A transposon & IS 4.5 BAC67823.1 Non-secretory protein CDS SAVERM_115 132949 133668 putative IS6 family ISRH1-like transposase IS701 family (131931..133947). Inverted repeat sequence (21/27 bp). Target sequence (GC). PF13610: DDE domain 11.71 27948 A transposon & IS 4.5 BAC67824.1 Non-secretory protein CDS SAVERM_116 133696 134031 hypothetical protein 12.16 12286 A no similarity 6 BAC67825.1 Non-secretory protein CDS SAVERM_117 134166 134822 hypothetical protein 9.65 24131 A no similarity 6 BAC67826.1 Non-secretory protein CDS SAVERM_118 136682 137041 putative IS5 family IS1647-like transposase IS5 family (136639..137502) Inverted repeat sequence (18/24 bp). PF13340: Putative transposase of IS4/5 family (DUF4096) 11.63 13547 A transposon & IS 4.5 BAC67827.1 Non-secretory protein CDS SAVERM_119 136846 137490 putative IS5 family IS1647-like transposase IS5 family (136639..137502) Inverted repeat sequence (18/24 bp). Translation will be controlled by frameshift with SAV118. PF13586: Transposase DDE domain 12.27 18897 A transposon & IS 4.5 BAC67828.1 Non-secretory protein CDS SAVERM_120 137556 138740 putative IS701 family ISRhosp2-like transposase IS701 family (137505..138900) Inverted repeat sequence (15/15 bp). Target sequence (TA). PF13546: DDE superfamily endonuclease 8.16 44986 A transposon & IS 4.5 BAC67829.1 Non-secretory protein CDS SAVERM_121 138932 139393 hypothetical protein 6.79 17010 A similar to unknown proteins 5 BAC67830.1 Non-secretory protein CDS SAVERM_122 140565 139360 putative IS110 family IS900-like transposase IS110 family (140688..139335) Inverted repeat sequence (12/15). Target sequence (GG). PF01548: Transposase 10.18 43501 A transposon & IS 4.5 BAC67831.1 Non-secretory protein CDS SAVERM_123 140787 141911 putative O-methyltransferase PF01135: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 4.83 40668 A miscellaneous 4.7 BAC67832.1 Non-secretory protein CDS SAVERM_124 142821 141787 putative membrane protein PF01435: Peptidase family M48 11.71 36384 A miscellaneous 4.7 BAC67833.1 Non-secretory protein CDS SAVERM_125 142975 143661 putative membrane protein PF09335: SNARE associated Golgi protein 11.21 23518 A miscellaneous 4.7 BAC67834.1 Non-secretory protein CDS SAVERM_126 143658 144263 putative integral membrane protein PF01569: PAP2 superfamily 8.5 21050 A miscellaneous 4.7 BAC67835.1 Non-secretory protein CDS SAVERM_127 144260 144988 hypothetical protein PF01569: PAP2 superfamily 8.75 25341 A similar to unknown proteins 5 BAC67836.1 Non-secretory protein CDS SAVERM_128 144942 145604 putative two-component system response regulator PF00486: Transcriptional regulatory protein, C terminal 9.81 23757 A regulation 3.5.2 BAC67837.1 Non-secretory protein CDS SAVERM_129 145601 146962 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.7 48544 A sensors 1.3 BAC67838.1 Signal peptide CDS SAVERM_130 147743 146943 putative integral membrane protein PF03988: Repeat of Unknown Function (DUF347) 9.88 28158 A miscellaneous 4.7 BAC67839.1 Non-secretory protein CDS SAVERM_131 148823 147993 putative integral membrane protein PF03988: Repeat of Unknown Function (DUF347) 6.8 29532 A miscellaneous 4.7 BAC67840.1 Non-secretory protein CDS SAVERM_132 148993 149274 hypothetical protein 12.42 10220 A similar to unknown proteins 5 BAC67841.1 Non-secretory protein CDS SAVERM_133 149373 150071 putative transporter PF01758: Sodium Bile acid symporter family 10.44 23374 A transport / binding proteins & lipoproteins 1.2 BAC67842.1 Non-secretory protein CDS SAVERM_134 151414 150032 putative two-component system sensor kinase PF00672: HAMP domain 5.92 48495 A sensors 1.3 BAC67843.1 Signal peptide CDS SAVERM_135 151606 152274 hypothetical protein 9.07 22530 A transport / binding proteins & lipoproteins 1.2 BAC67844.1 Signal peptide CDS SAVERM_136 152278 153018 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.03 26006 A transport / binding proteins & lipoproteins 1.2 BAC67845.1 Non-secretory protein CDS SAVERM_137 153005 153718 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.88 24181 A transport / binding proteins & lipoproteins 1.2 BAC67846.1 Non-secretory protein CDS SAVERM_138 153715 156363 putative ABC transporter permease protein PF02687: FtsX-like permease family 11.22 90865 A transport / binding proteins & lipoproteins 1.2 BAC67847.1 Non-secretory protein CDS SAVERM_139 156360 157139 putative two-component system response regulator PF00072: Response regulator receiver domain 6.8 28476 A regulation 3.5.2 BAC67848.1 Non-secretory protein CDS SAVERM_140 158928 157954 putative hydroxylase PF13460: NADH(P)-binding 5.39 35772 A miscellaneous 4.7 BAC67849.1 Non-secretory protein CDS SAVERM_141 160031 158997 ephA1 putative epoxide hydrolase PF00561: alpha/beta hydrolase fold 4.68 37322 A specific pathways 2.1.1 BAC67850.1 Non-secretory protein CDS SAVERM_142 160754 160053 putative dehydrogenase PF00106: short chain dehydrogenase 5.06 24621 A miscellaneous 4.7 BAC67851.1 Non-secretory protein CDS SAVERM_143 161961 161392 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.36 20398 A regulation 3.5.2 BAC67852.1 Non-secretory protein CDS SAVERM_144 163493 162195 hypothetical protein PF12051: Protein of unknown function (DUF3533) 9.2 44794 A similar to unknown proteins 5 BAC67853.1 Non-secretory protein CDS SAVERM_145 165950 163767 putative membrane transport protein PF03176: MMPL family 6.87 77740 A miscellaneous 4.7 BAC67854.1 Non-secretory protein CDS SAVERM_146 166102 166851 putative TetR-family transcriptional regulator PF13305: WHG domain 6.53 27324 A regulation 3.5.2 BAC67855.1 Non-secretory protein CDS SAVERM_147 167014 167367 hypothetical protein 4.7 12998 A similar to unknown proteins 5 BAC67856.1 Non-secretory protein CDS SAVERM_148 168923 167757 putative gluconolactonase Tat substrate, PF03022: Major royal jelly protein 6.9 42040 A miscellaneous 4.7 BAC67857.1 Signal peptide CDS SAVERM_149 169735 169217 hypothetical protein PF07366: SnoaL-like polyketide cyclase 6.96 18784 A similar to unknown proteins 5 BAC67858.1 Non-secretory protein CDS SAVERM_150 170613 169801 putative dehydrogenase PF00106: short chain dehydrogenase 10.05 28964 A miscellaneous 4.7 BAC67859.1 Non-secretory protein CDS SAVERM_151 172043 171402 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.7 23080 A regulation 3.5.2 BAC67860.1 Non-secretory protein CDS SAVERM_152 172191 173102 putative NAD(P)-dependent oxidoreductase PF00106: short chain dehydrogenase 11.26 32042 A miscellaneous 4.7 BAC67861.1 Non-secretory protein CDS SAVERM_153 173107 174243 hypothetical protein 7.06 42025 A similar to unknown proteins 5 BAC67862.1 Non-secretory protein CDS SAVERM_154 174240 175163 putative hydrolase PF00561: alpha/beta hydrolase fold 10.63 34064 A miscellaneous 4.7 BAC67863.1 Non-secretory protein CDS SAVERM_155 175255 176166 hypothetical protein PF10118: Predicted metal-dependent hydrolase 6.74 34819 A similar to unknown proteins 5 BAC67864.1 Non-secretory protein CDS SAVERM_156 176190 177290 putative iron-sulfur oxidoreductase PF00111: 2Fe-2S iron-sulfur cluster binding domain 8.11 39355 A miscellaneous 4.7 BAC67865.1 Non-secretory protein CDS SAVERM_157 179952 177538 hypothetical protein 9.82 88358 A no similarity 6 BAC67866.1 Non-secretory protein CDS SAVERM_158 180287 179949 putative XRE-family transcriptional regulator PF13443: Cro/C1-type HTH DNA-binding domain 10.1 12449 A similar to unknown proteins 5 BAC67867.1 Non-secretory protein CDS SAVERM_159 181426 180284 int1 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 8.88 43828 A DNA recombination 3.3 BAC67868.1 Non-secretory protein CDS SAVERM_160 181802 182389 hypothetical protein 8.21 20781 A no similarity 6 BAC67869.1 Non-secretory protein CDS SAVERM_161 182430 182948 hypothetical protein 6.97 18533 A no similarity 6 BAC67870.1 Non-secretory protein CDS SAVERM_162 182945 183952 hypothetical protein 5.02 37124 A no similarity 6 BAC67871.1 Non-secretory protein CDS SAVERM_163 184316 184795 putative secreted protein 7.78 17241 A no similarity 6 BAC67872.1 Signal peptide CDS SAVERM_164 185368 185138 hypothetical protein 12 8145 A no similarity 6 BAC67873.1 Non-secretory protein CDS SAVERM_165 185890 186507 hypothetical protein 7.08 23221 A similar to unknown proteins 5 BAC67874.1 Non-secretory protein CDS SAVERM_166 186549 186905 hypothetical protein 3.9 12772 A no similarity 6 BAC67875.1 Non-secretory protein CDS SAVERM_167 187026 187742 hypothetical protein 10.43 26284 A no similarity 6 BAC67876.1 Non-secretory protein CDS SAVERM_168 188180 189094 hypothetical protein PF13814: Replication-relaxation 10.62 34061 A similar to unknown proteins 5 BAC67877.1 Non-secretory protein CDS SAVERM_169 189866 188910 hypothetical protein PF00583: Acetyltransferase (GNAT) family 10.45 33667 A similar to unknown proteins 5 BAC67878.1 Non-secretory protein CDS SAVERM_170 191453 190026 hypothetical protein 6.95 51976 A no similarity 6 BAC67879.1 Non-secretory protein CDS SAVERM_171 192900 191479 hypothetical protein 10.15 50416 A similar to unknown proteins 5 BAC67880.1 Non-secretory protein CDS SAVERM_172 193615 194553 hypothetical protein PF12642: Conjugative transposon protein TcpC 4.75 31601 A similar to unknown proteins 5 BAC67881.1 Non-secretory protein CDS SAVERM_173 194571 194891 hypothetical protein 5 11113 A no similarity 6 BAC67882.1 Non-secretory protein CDS SAVERM_174 194888 195463 hypothetical protein 12.63 20448 A similar to unknown proteins 5 BAC67883.1 Non-secretory protein CDS SAVERM_175 195460 198141 putative ATP/GTP-binding protein PF12846: AAA-like domain 5.66 95759 A miscellaneous 4.7 BAC67884.1 Non-secretory protein CDS SAVERM_176 198138 198488 putative secreted protein 11.86 11945 A no similarity 6 BAC67885.1 Non-secretory protein CDS SAVERM_177 198490 201222 putative membrane protein, secreted 10.14 95333 A miscellaneous 4.7 BAC67886.1 Signal peptide CDS SAVERM_178 201219 202370 putative NLP/P60-family secreted protein (PgpA peptidase) Seems to have a cleavable N-term signal sequence, PF00877: NlpC/P60 family 8.98 39462 A miscellaneous 4.7 BAC67887.1 Signal peptide CDS SAVERM_179 202367 203014 putative secreted protein 11.35 21969 A no similarity 6 BAC67888.1 Signal peptide CDS SAVERM_180 203056 205614 hypothetical protein 10.74 93961 A miscellaneous 4.7 BAC67889.1 Non-secretory protein CDS SAVERM_181 205611 206525 hypothetical protein PF13814: Replication-relaxation 10.54 33933 A similar to unknown proteins 5 BAC67890.1 Non-secretory protein CDS SAVERM_182 207837 208697 putative secreted protein 7.81 29384 A similar to unknown proteins 5 BAC67891.1 Signal peptide CDS SAVERM_183 208719 209423 hypothetical protein PF08666: SAF domain 10.24 23369 A similar to unknown proteins 5 BAC67892.1 Non-secretory protein CDS SAVERM_184 209423 210250 hypothetical protein 9.26 28839 A similar to unknown proteins 5 BAC67893.1 Non-secretory protein CDS SAVERM_185 210240 211733 putative ATP/GTP-binding protein PF00437: Type II/IV secretion system protein 5.79 54616 A miscellaneous 4.7 BAC67894.1 Non-secretory protein CDS SAVERM_186 211730 212659 putative integral membrane protein PF00482: Type II secretion system (T2SS), protein F 11.56 33095 A miscellaneous 4.7 BAC67895.1 Non-secretory protein CDS SAVERM_187 212678 213562 putative integral membrane protein 7.36 31281 A miscellaneous 4.7 BAC67896.1 Non-secretory protein CDS SAVERM_188 213608 213823 hypothetical protein 10.87 7705 A no similarity 6 BAC67897.1 Non-secretory protein CDS SAVERM_189 213820 214248 putative membrane protein PF07811: TadE-like protein 10.76 15267 A miscellaneous 4.7 BAC67898.1 Non-secretory protein CDS SAVERM_190 214245 214706 putative membrane protein PF07811: TadE-like protein 6.51 15760 A miscellaneous 4.7 BAC67899.1 Non-secretory protein CDS SAVERM_191 214706 215158 putative membrane protein PF13400: Putative Flp pilus-assembly TadE/G-like 5.83 15040 A miscellaneous 4.7 BAC67900.1 Non-secretory protein CDS SAVERM_192 215158 218625 putative membrane protein PF01476: LysM domain 5.11 121352 A miscellaneous 4.7 BAC67901.1 Non-secretory protein CDS SAVERM_193 218903 220732 hypothetical protein PF10935: Protein of unknown function (DUF2637) 6.86 67020 A similar to unknown proteins 5 BAC67902.1 Non-secretory protein CDS SAVERM_194 221402 220848 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.4 20889 A miscellaneous 4.7 BAC67903.1 Non-secretory protein CDS SAVERM_195 222835 221399 hypothetical protein PF06036: Streptomyces protein of unknown function (DUF921) 10.57 52340 A similar to unknown proteins 5 BAC67904.1 Non-secretory protein CDS SAVERM_196 222871 224691 hypothetical protein PF01135: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 6.41 65733 A similar to unknown proteins 5 BAC67905.1 Non-secretory protein CDS SAVERM_197 225238 226227 hypothetical protein 8.46 37133 A similar to unknown proteins 5 BAC67906.1 Non-secretory protein CDS SAVERM_198 226312 227820 putative amino acid/metabolite permease PF00324: Amino acid permease 8.93 53163 A transport / binding proteins & lipoproteins 1.2 BAC67907.1 Non-secretory protein CDS SAVERM_199 227817 228737 glnA5 putative glutamine synthetase PF00120: Glutamine synthetase, catalytic domain 7.27 32888 A metabolism of amino acids & related molecules 2.2 BAC67908.1 Non-secretory protein CDS SAVERM_200 236937 229825 putative large secreted protein PF07591: Pretoxin HINT domain 4.65 255799 A miscellaneous 4.7 BAC67909.1 Signal peptide CDS SAVERM_201 237437 237682 hypothetical protein 4.15 8851 A similar to unknown proteins 5 BAC67910.1 Non-secretory protein CDS SAVERM_202 238601 237840 hypothetical protein 11.53 27772 A no similarity 6 BAC67911.1 Non-secretory protein CDS SAVERM_203 239462 239037 putative DUF4267 domain-containing protein PF14087: Domain of unknown function (DUF4267) 8.54 14709 A similar to unknown proteins 5 BAC67912.1 Non-secretory protein CDS SAVERM_204 240234 239788 putative membrane protein PF08592: Domain of unknown function (DUF1772) 9.92 16197 A miscellaneous 4.7 BAC67913.1 Non-secretory protein CDS SAVERM_205 240325 240903 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.98 21025 A regulation 3.5.2 BAC67914.1 Non-secretory protein CDS SAVERM_206 241966 241742 putative Tn3 family transposase truncated, PF01526: Tn3 transposase DDE domain 4.55 7996 A transposon & IS 4.5 BAC67915.1 Non-secretory protein CDS SAVERM_207 242195 241989 putative Tn3 family transposase truncated, PF01526: Tn3 transposase DDE domain 10.63 7582 A miscellaneous 4.7 BAC67916.1 Non-secretory protein CDS SAVERM_208 243411 242908 putative IstB-like ATP-binding protein PF01695: IstB-like ATP binding protein 6.52 18443 A miscellaneous 4.7 BAC67917.1 Non-secretory protein CDS SAVERM_209 244771 243581 putative IS110 family IS900-like transposase IS110 family (244816..242245) Inverted repeat sequence (13/17 bp). Target sequence (GG). 10.2 43470 A transposon & IS 4.5 BAC67918.1 Non-secretory protein CDS SAVERM_210 246040 245081 putative XRE-family transcriptional regulator PF01381: Helix-turn-helix 8.8 34941 A regulation 3.5.2 BAC67919.1 Non-secretory protein CDS SAVERM_211 246653 246027 hypothetical protein 11.99 22204 A no similarity 6 BAC67920.1 Non-secretory protein CDS SAVERM_212 248142 247471 hypothetical protein 5.76 24274 A similar to unknown proteins 5 BAC67921.1 Non-secretory protein CDS SAVERM_213 248741 248139 sig60 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 6.97 22230 A RNA initiation 3.5.1 BAC67922.1 Non-secretory protein CDS SAVERM_214 249661 249173 hypothetical protein 11.44 16974 A no similarity 6 BAC67923.1 Non-secretory protein CDS SAVERM_215 253416 249733 hypothetical protein PF05729: NACHT domain 6.09 135076 A similar to unknown proteins 5 BAC67924.1 Non-secretory protein CDS SAVERM_216 254895 254011 putative pyrophosphatase PF03819: MazG nucleotide pyrophosphohydrolase domain 6.15 32785 A metabolism of phosphates 2.6 BAC67925.1 Non-secretory protein CDS SAVERM_217 255013 255273 fabC4 putative acyl carrier protein PF00550: Phosphopantetheine attachment site 3.92 9471 A metabolism of lipids 2.4 BAC67926.1 Non-secretory protein CDS SAVERM_218 255270 255677 putative XRE-family transcriptional regulator PF01381: Helix-turn-helix 4.74 15202 A regulation 3.5.2 BAC67927.1 Non-secretory protein CDS SAVERM_219 255674 256570 hypothetical protein PF06114: Domain of unknown function (DUF955) 6.73 31823 A no similarity 6 BAC67928.1 Non-secretory protein CDS SAVERM_220 256598 257401 hypothetical protein PF00303: Thymidylate synthase 9.03 29333 A similar to unknown proteins 5 BAC67929.1 Non-secretory protein CDS SAVERM_221 258474 257443 hypothetical protein 9.06 38788 A similar to unknown proteins 5 BAC67930.1 Non-secretory protein CDS SAVERM_222 258522 258809 hypothetical protein 8.53 10580 A no similarity 6 BAC67931.1 Non-secretory protein CDS SAVERM_223 260024 261079 putative DNA-binding protein PF03457: Helicase associated domain 10.85 39910 A regulation 3.5.2 BAC67932.1 Non-secretory protein CDS SAVERM_224 261139 262191 hypothetical protein 7.18 38139 A no similarity 6 BAC67933.1 Non-secretory protein CDS SAVERM_225 264521 263244 putative IS256 family IS666-like transposase IS256 family (263224..264596) Inverted repeat sequence (10/16 bp) 9.45 46691 A transposon & IS 4.5 BAC67934.1 Non-secretory protein CDS SAVERM_226 266317 264551 putative reverse transcriptase homolog; similar to GII intron PF00078: Reverse transcriptase (RNA-dependent DNA polymerase) 11.03 67532 A DNA replication 3.1 BAC67935.1 Non-secretory protein CDS SAVERM_227 266779 268044 putative IS701 family ISMmq4-like transposase IS701 family (266715..268155) Inverted repeat sequence (16/18 bp). Target sequence (CTAG) 4.67 46725 A transposon & IS 4.5 BAC67936.1 Non-secretory protein CDS SAVERM_228 268251 269444 hypothetical protein PF07643: Protein of unknown function (DUF1598) 9.08 43808 A similar to unknown proteins 5 BAC67937.1 Non-secretory protein CDS SAVERM_229 269776 270012 putative transposase 4.12 8632 A transposon & IS 4.5 BAC67938.1 Non-secretory protein CDS SAVERM_230 271758 270055 putative secreted protein Tat substrate, PF05935: Arylsulfotransferase (ASST) 8.74 62199 A similar to unknown proteins 5 BAC67939.1 Signal peptide CDS SAVERM_231 273277 272429 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 5.22 29737 A regulation 3.5.2 BAC67940.1 Non-secretory protein CDS SAVERM_232 273962 273444 hypothetical protein 4.63 18520 A no similarity 6 BAC67941.1 Non-secretory protein CDS SAVERM_233 274494 274210 hypothetical protein 3.96 10236 A similar to unknown proteins 5 BAC67942.1 Non-secretory protein CDS SAVERM_234 275168 274689 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.42 16809 A regulation 3.5.2 BAC67943.1 Non-secretory protein CDS SAVERM_235 275233 275721 putative anti-sigma factor antagonist PF01740: STAS domain 6.23 17601 A regulation 3.5.2 BAC67944.1 Non-secretory protein CDS SAVERM_236 275872 276393 hypothetical protein 11.88 18969 A no similarity 6 BAC67945.1 Non-secretory protein CDS SAVERM_237 276877 278016 putative DNA-binding protein PF01590: GAF domain 5.61 40696 A regulation 3.5.2 BAC67946.1 Non-secretory protein CDS SAVERM_238 278037 278444 putative DNA-binding protein PF07228: Stage II sporulation protein E (SpoIIE) 6.72 15053 A regulation 3.5.2 BAC67947.1 Non-secretory protein CDS SAVERM_239 279057 278470 hypothetical protein 5.02 20962 A similar to unknown proteins 5 BAC67948.1 Non-secretory protein CDS SAVERM_240 279635 279267 hypothetical protein 6.68 12879 A similar to unknown proteins 5 BAC67949.1 Non-secretory protein CDS SAVERM_241 279919 279644 hypothetical protein PF03869: Arc-like DNA binding domain 4.88 9884 A no similarity 6 BAC67950.1 Non-secretory protein CDS SAVERM_242 280782 280342 putative secreted protein 11.43 15863 A no similarity 6 BAC67951.1 Signal peptide CDS SAVERM_243 281585 281208 hypothetical protein 11.54 13693 A no similarity 6 BAC67952.1 Non-secretory protein CDS SAVERM_244 281928 282242 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 6.79 11742 A regulation 3.5.2 BAC67953.1 Non-secretory protein CDS SAVERM_245 283503 282829 putative LysE-family efflux protein PF01810: LysE type translocator 10.56 23528 A transport / binding proteins & lipoproteins 1.2 BAC67954.1 Non-secretory protein CDS SAVERM_246 284041 283694 hypothetical protein PF00202: Aminotransferase class-III 10.2 12596 A similar to unknown proteins 5 BAC67955.1 Non-secretory protein CDS SAVERM_247 284429 286645 hypothetical protein PF05729: NACHT domain 9.26 78498 A similar to unknown proteins 5 BAC67956.1 Non-secretory protein CDS SAVERM_248 287775 287461 hypothetical protein 4.5 11380 A no similarity 6 BAC67957.1 Non-secretory protein CDS SAVERM_249 288562 288173 putative secreted protein 11.89 12838 A no similarity 6 BAC67958.1 Signal peptide CDS SAVERM_250 288726 292160 hypothetical protein PF07719: Tetratricopeptide repeat 7.34 124341 A similar to unknown proteins 5 BAC67959.1 Non-secretory protein CDS SAVERM_251 293723 292968 putative integral membrane protein PF02355: Protein export membrane protein 6.23 26345 A transport / binding proteins & lipoproteins 1.2 BAC67960.1 Non-secretory protein CDS SAVERM_252 294014 294610 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.94 21876 A transport / binding proteins & lipoproteins 1.2 BAC67961.1 Non-secretory protein CDS SAVERM_253 294912 295244 putative MutT-family protein PF00293: NUDIX domain 4.4 12354 A miscellaneous 4.7 BAC67962.1 Non-secretory protein CDS SAVERM_254 295675 296976 putative IS5 family ISFa13B-like transposase PF01609: Transposase DDE domain 10.29 47582 A transposon & IS 4.5 BAC67963.1 Signal peptide CDS SAVERM_255 296991 298436 putative metallopeptidase Tat substrate, PF01433: Peptidase family M1 9.86 52374 A protein modification 3.8 BAC67964.1 Signal peptide CDS SAVERM_256 298664 299872 putative ISAs1 family IS1629-like transposase PF01609: Transposase DDE domain, ISL3 family (298511..299908) Inverted repeat sequence (30/37 bp) Target sequence (GG) 10.82 43379 A transposon & IS 4.5 BAC67965.1 Non-secretory protein CDS SAVERM_257 300469 299873 putative ABC transporter ATP-binding protein microcin cluster, the gene will be truncated by insertion of ISSav20, PF00005: ABC transporter 4.73 20876 A transport / binding proteins & lipoproteins 1.2 BAC67966.1 Non-secretory protein CDS SAVERM_7586 300885 300466 mcjB1 hypothetical protein microcin cluster, PF13471: Transglutaminase-like superfamily 11.36 14871 A Non-secretory protein CDS SAVERM_258 301145 300882 putative PqqD family protein microcin cluster, PF05402: Coenzyme PQQ synthesis protein D (PqqD) 4.61 9237 A similar to unknown proteins 5 BAC67967.1 Non-secretory protein CDS SAVERM_259 303052 301142 mcjC1 putative asparagine synthase microcin cluster, probably foramtion of amide bond, PF00733: Asparagine synthase 8.12 68666 A metabolism of amino acids & related molecules 2.2 BAC67968.1 Non-secretory protein CDS SAVERM_7584 303240 303121 mcjA1 putative microcin mature peptide microcin cluster, MTAETSYETPILTEIGDFADVTRATYRGFWVDFLGGWWF 3.82 4403 A Non-secretory protein CDS SAVERM_260 303674 304072 hypothetical protein PF13700: Domain of unknown function (DUF4158) 6.53 14740 A transposon & IS 4.5 BAC67969.1 Non-secretory protein CDS SAVERM_261 304104 304334 hypothetical protein 4.12 8619 A no similarity 6 BAC67970.1 Non-secretory protein CDS SAVERM_262 304527 305000 hypothetical protein 10.96 16221 A no similarity 6 BAC67971.1 Non-secretory protein CDS SAVERM_263 306945 305311 putative ISL3 family ISFsp1-like transposase ISL3 family (307013..305283) Inverted repeat sequence (30/30 bp) Target sequence (AGAATTCA); same as SAV7545 and SAV75480 9.83 60169 A transposon & IS 4.5 BAC67972.1 Non-secretory protein CDS SAVERM_264 309302 307092 hypothetical protein PF13576: Pentapeptide repeats (9 copies) 6.29 79663 A similar to unknown proteins 5 BAC67973.1 Non-secretory protein CDS SAVERM_265 309794 310207 hypothetical protein 4.61 15043 A similar to unknown proteins 5 BAC67974.1 Non-secretory protein CDS SAVERM_266 311114 310455 hypothetical protein 11.24 25103 A no similarity 6 BAC67975.1 Non-secretory protein CDS SAVERM_267 311330 311680 hypothetical protein 5.91 13102 A no similarity 6 BAC67976.1 Non-secretory protein CDS SAVERM_268 312479 312030 hypothetical protein 8.63 16546 A no similarity 6 BAC67977.1 Non-secretory protein CDS SAVERM_269 314877 312589 putative secreted protein 5.34 79252 A similar to unknown proteins 5 BAC67978.1 Signal peptide CDS SAVERM_270 315325 315852 hypothetical protein PF12671: Putative amidase domain 6.11 19986 A no similarity 6 BAC67979.1 Non-secretory protein CDS SAVERM_271 317873 317520 putative secreted protein 4.47 12765 A no similarity 6 BAC67980.1 Non-secretory protein CDS SAVERM_272 319056 320099 hypothetical protein 6.29 38275 A no similarity 6 BAC67981.1 Non-secretory protein CDS SAVERM_273 320615 320959 putative DNA invertase/recombinase PF02796: Helix-turn-helix domain of resolvase 10.3 11674 A transposon & IS 4.5 BAC67982.1 Non-secretory protein CDS SAVERM_274 321200 320979 putative IS630 family transposase 5.81 8489 A transposon & IS 4.5 BAC67983.1 Non-secretory protein CDS SAVERM_275 321655 322395 hypothetical protein PF07719: Tetratricopeptide repeat 7.84 26776 A similar to unknown proteins 5 BAC67984.1 Non-secretory protein CDS SAVERM_276 322432 322938 putative MutT-family protein PF00293: NUDIX domain 4.73 18384 A miscellaneous 4.7 BAC67985.1 Non-secretory protein CDS SAVERM_277 323014 323400 putative terminal protein Tpg homolog 6.96 14104 A DNA packaging & segregation 3.4 BAC67986.1 Non-secretory protein CDS SAVERM_278 324121 323714 hypothetical protein 9.75 13970 A no similarity 6 BAC67987.1 Non-secretory protein CDS SAVERM_279 324309 325121 putative endonuclease PF02945: Recombination endonuclease VII 6.12 29946 A DNA modification & repair 3.2 BAC67988.1 Non-secretory protein CDS SAVERM_280 325362 325622 hypothetical protein 12.51 9186 A no similarity 6 BAC67989.1 Non-secretory protein CDS SAVERM_281 325633 326067 hypothetical protein 9.98 16621 A no similarity 6 BAC67990.1 Non-secretory protein CDS SAVERM_282 326509 326189 hypothetical protein 10.02 11859 A no similarity 6 BAC67991.1 Non-secretory protein CDS SAVERM_283 326629 327654 hypothetical protein 11.31 37667 A no similarity 6 BAC67992.1 Non-secretory protein CDS SAVERM_284 327994 327842 hypothetical protein 12.38 5204 A no similarity 6 BAC67993.1 Non-secretory protein CDS SAVERM_285 328293 328691 hypothetical protein PF00589: Phage integrase family 7.78 14172 A similar to unknown proteins 5 BAC67994.1 Non-secretory protein CDS SAVERM_286 336546 329452 putative large secreted protein PF07591: Pretoxin HINT domain 4.45 253412 A miscellaneous 4.7 BAC67995.1 Signal peptide CDS SAVERM_287 337179 336652 putative IS630 family ISRj1-like transposase IS630 family (337854..336641) Inverted repeat sequence (13/13 bp). Target sequence (CTAG). 10.33 20175 A transposon & IS 4.5 BAC67996.1 Non-secretory protein CDS SAVERM_288 337778 337203 putative IS630 family ISMac13-like transposase IS630 family (337854..336641) Inverted repeat sequence (13/13 bp). Target sequence (CTAG). 11.94 21702 A transposon & IS 4.5 BAC67997.1 Non-secretory protein CDS SAVERM_289 337911 339185 putative IS701 family ISAzvi8-like transposase IS701 family (337859..339284) Inverted repeat sequence (16/16 bp). Target sequence (CTAG). same as SAV319 and SAV977. 8.39 47067 A transposon & IS 4.5 BAC67998.1 Non-secretory protein CDS SAVERM_290 339735 339271 putative IS3L family IS469-likee transposase IS30 family (339207..342900) Inverted repeat sequence (13/17 bp) 12.08 16668 A transposon & IS 4.5 BAC67999.1 Non-secretory protein CDS SAVERM_291 341939 339819 putative IS30 family ISLxx5-like transposase IS30 family (339207..342900) Inverted repeat sequence (13/17 bp). 11.45 78342 A transposon & IS 4.5 BAC68000.1 Non-secretory protein CDS SAVERM_292 343063 343689 putative TetR-family transcriptional regulator PF02909: Tetracyclin repressor, C-terminal all-alpha domain 5.21 22207 A regulation 3.5.2 BAC68001.1 Non-secretory protein CDS SAVERM_293 345154 343805 putative oxidoreductase PF01794: Ferric reductase like transmembrane component 9.46 49679 A miscellaneous 4.7 BAC68002.1 Non-secretory protein CDS SAVERM_294 345771 345361 putative invasion protein PF13564: DoxX-like family 10.44 13687 A transformation & competence 1.1 BAC68003.1 Non-secretory protein CDS SAVERM_295 346056 345826 hypothetical protein 9 8043 A no similarity 6 BAC68004.1 Non-secretory protein CDS SAVERM_296 347669 346092 putative FAD-binding monooxygenase PF01494: FAD binding domain 6.57 56544 A miscellaneous 4.7 BAC68005.1 Non-secretory protein CDS SAVERM_297 348571 347666 putative alpha/beta hydrolase PF12697: Alpha/beta hydrolase family 7.78 33591 A miscellaneous 4.7 BAC68006.1 Non-secretory protein CDS SAVERM_298 349424 348591 putative alpha/beta hydrolase PF12697: Alpha/beta hydrolase family 6.51 30060 A miscellaneous 4.7 BAC68007.1 Non-secretory protein CDS SAVERM_299 349710 350726 lipW putative secreted esterase/lipase Tat substrate, PF07859: alpha/beta hydrolase fold 8.79 36242 A detoxification 4.2 BAC68008.1 Signal peptide CDS SAVERM_300 352264 351026 putative IS256 family IS1164-like transposase IS256 family (352397..350972). Inverted repeat sequence (17/23 bp). Target sequence (CG); same as SAV347 (with 1bp-mismatch). 7.83 45705 A transposon & IS 4.5 BAC68009.1 Non-secretory protein CDS SAVERM_301 352678 353949 hypothetical protein PF01609: Transposase DDE domain 12.1 48027 A similar to unknown proteins 5 BAC68010.1 Non-secretory protein CDS SAVERM_302 354545 354832 hypothetical protein 13.05 11084 A no similarity 6 BAC68011.1 Non-secretory protein CDS SAVERM_303 355009 356106 putative IS110 family IS1547-like transposase IS116/IS110/IS902 family 10.63 39938 A transposon & IS 4.5 BAC68012.1 Non-secretory protein CDS SAVERM_304 357105 355951 hypothetical protein PF06779: Uncharacterised MFS-type transporter YbfB 11.3 39988 A similar to unknown proteins 5 BAC68013.1 Non-secretory protein CDS SAVERM_305 357868 359805 putative membrane protein PF09972: Predicted membrane protein (DUF2207) 7.72 68287 A miscellaneous 4.7 BAC68014.1 Non-secretory protein CDS SAVERM_306 360375 361958 hypothetical protein 9.12 57489 A regulation 3.5.2 BAC68015.1 Non-secretory protein CDS SAVERM_307 362562 363170 hypothetical protein PF13376: Bacteriocin-protection, YdeI or OmpD-Associated 9.74 22716 A similar to unknown proteins 5 BAC68016.1 Non-secretory protein CDS SAVERM_308 364411 364046 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.38 13321 A similar to unknown proteins 5 BAC68017.1 Non-secretory protein CDS SAVERM_309 366810 368000 putative IS3 family ISVisp1-like transposase IS3 family (366773..368534). Inverted repeat sequence (11/11 bp) 9.15 43222 A transposon & IS 4.5 BAC68018.1 Non-secretory protein CDS SAVERM_310 368148 368522 putative IS5 family IS1373-like transposase IS3 family (366773..368534) Inverted repeat sequence (11/11 bp) 9.69 13550 A transposon & IS 4.5 BAC68019.1 Non-secretory protein CDS SAVERM_311 369621 368620 putative IS4 family ISFsp6-like transposase IS4 family, partial 8.68 35148 A transposon & IS 4.5 BAC68020.1 Non-secretory protein CDS SAVERM_312 370132 369344 putative IS4 family ISFsp5-like transposase IS4 family (370300..368537) Inverted repeat sequence (21/22 bp). Target sequence (TA). 11.47 17679 A transposon & IS 4.5 BAC68021.1 Non-secretory protein CDS SAVERM_7574 370796 370323 putative IS630 family IS885-like transposase IS630 family 11.05 17647 A transposon & IS 4.5 BAF64417.1 Non-secretory protein CDS SAVERM_313 372637 371009 putative IS4 family ISFsp6-like transposase IS4 family (372771..370996) Inverted repeat sequence (36/37 bp). Target sequence (GAGTACTTT); same as SAV365. 10.06 59935 A transposon & IS 4.5 BAC68022.1 Non-secretory protein CDS SAVERM_314 372788 373066 putative IS3 IS1372-like family transposase IS3 family (372707..374011) Inverted repeat sequence (10/11 bp). Target sequence (CC); Translation will be controlled by the frameshift with SAV315. 10.64 10495 A transposon & IS 4.5 BAC68023.1 Non-secretory protein CDS SAVERM_315 373063 373980 putative IS3 ISAav4-like family transposase IS3 family (372707..374011) Inverted repeat sequence (10/11 bp). Target sequence (CC) 8.6 34621 A transposon & IS 4.5 BAC68024.1 Non-secretory protein CDS SAVERM_316 374506 374009 putative IS630 family ISBs2-like transposase PF06056: Putative ATPase subunit of terminase (gpP-like) 10.49 17647 A transposon & IS 4.5 BAC68025.2 Non-secretory protein CDS SAVERM_317 375582 374674 putative IS982 family ISCef2-like transposase IS607 family (376826..374645) Inverted repeat sequence (16/17 bp) Target sequence (CTAG). 9.36 33683 A transposon & IS 4.5 BAC68026.1 Non-secretory protein CDS SAVERM_318 376615 375668 putative ISL3 family ISPpu12-like transposase IS607 family (374641..376830) Inverted repeat sequence (16/17 bp) Target sequence (CTAG). 4.63 35554 A transposon & IS 4.5 BAC68027.1 Non-secretory protein CDS SAVERM_319 376883 378157 putative IS701 family ISAzvi8-like transposase IS701 family (376831..378256) Inverted repeat sequence (16/16 bp). Target sequence (CTAG). same as SAV289 and SAV977. 8.39 42623 A transposon & IS 4.5 BAC68028.1 Non-secretory protein CDS SAVERM_320 378862 378281 putative secreted protein PF00378: Enoyl-CoA hydratase/isomerase family 10.47 20018 A similar to unknown proteins 5 BAC68029.1 Non-secretory protein CDS SAVERM_321 380458 379220 prpB1 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 6.02 44283 A protein modification 3.8 BAC68030.1 Non-secretory protein CDS SAVERM_322 381536 380736 hypothetical protein PF03006: Haemolysin-III related 8.79 27862 A similar to unknown proteins 5 BAC68031.1 Non-secretory protein CDS SAVERM_323 381924 381592 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 8.49 12312 A regulation 3.5.2 BAC68032.1 Non-secretory protein CDS SAVERM_324 383349 383053 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 9.4 11442 A regulation 3.5.2 BAC68033.1 Non-secretory protein CDS SAVERM_325 384198 383431 hypothetical protein PF07201: Hypersensitivity response secretion protein HrpJ 11.27 27870 A no similarity 6 BAC68034.1 Non-secretory protein CDS SAVERM_326 385533 385228 hypothetical protein PF03819: MazG nucleotide pyrophosphohydrolase domain 4.25 11103 A similar to unknown proteins 5 BAC68035.1 Non-secretory protein CDS SAVERM_327 386746 386051 hypothetical protein 7.63 24307 A no similarity 6 BAC68036.1 Non-secretory protein CDS SAVERM_328 386768 387076 hypothetical protein 9.98 11341 A similar to unknown proteins 5 BAC68037.1 Non-secretory protein CDS SAVERM_329 387129 387536 hypothetical protein 6.75 14168 A similar to unknown proteins 5 BAC68038.1 Non-secretory protein CDS SAVERM_330 387947 387639 hypothetical protein 11.75 10990 A no similarity 6 BAC68039.1 Non-secretory protein CDS SAVERM_331 388265 387951 hypothetical protein 9.25 11695 A no similarity 6 BAC68040.1 Non-secretory protein CDS SAVERM_332 388722 388958 hypothetical protein 12.21 8254 A no similarity 6 BAC68042.1 Non-secretory protein CDS SAVERM_333 388766 388386 hypothetical protein 10.18 13473 A no similarity 6 BAC68041.1 Non-secretory protein CDS SAVERM_334 389084 389704 hypothetical protein 5.88 22201 A no similarity 6 BAC68043.1 Non-secretory protein CDS SAVERM_335 391292 389694 hypothetical protein PF01966: HD domain 4.88 58892 A no similarity 6 BAC68044.1 Non-secretory protein CDS SAVERM_336 392177 391476 hypothetical protein 10.23 25506 A no similarity 6 BAC68045.1 Non-secretory protein CDS SAVERM_337 392309 393166 hypothetical protein 11.41 32749 A similar to unknown proteins 5 BAC68046.1 Non-secretory protein CDS SAVERM_338 394816 393683 hypothetical protein 6.04 40149 A similar to unknown proteins 5 BAC68047.1 Non-secretory protein CDS SAVERM_339 395724 394813 ldhA putative lactate dehydrogenase PF00056: lactate/malate dehydrogenase, NAD binding domain 8.23 31147 A membrane bioenergetics 1.4 BAC68048.1 Non-secretory protein CDS SAVERM_340 397091 395736 hypothetical protein PF01636: Phosphotransferase enzyme family 10 47453 A no similarity 6 BAC68049.1 Non-secretory protein CDS SAVERM_341 397615 397379 hypothetical protein 7.81 8546 A no similarity 6 BAC68050.1 Non-secretory protein CDS SAVERM_342 398019 397612 hypothetical protein 5.65 14977 A no similarity 6 BAC68051.1 Non-secretory protein CDS SAVERM_343 398215 399555 putative regulatory protein PF06036: Streptomyces protein of unknown function (DUF921) 9.28 48419 A regulation 3.5.2 BAC68052.1 Non-secretory protein CDS SAVERM_344 400892 399603 hypothetical protein PF06054: Competence protein CoiA-like family 8.11 48520 A similar to unknown proteins 5 BAC68053.1 Non-secretory protein CDS SAVERM_345 401070 401894 hypothetical protein 10.86 29436 A no similarity 6 BAC68054.1 Non-secretory protein CDS SAVERM_346 402923 404059 putative secreted protein 9.55 40109 A no similarity 6 BAC68055.1 Non-secretory protein CDS SAVERM_347 405830 404592 putative IS256 family IS1164-like transposase IS256 family (405963..404538). Inverted repeat sequence (17/23 bp). Target sequence (NG); same as ISSav6A (with 1bp mismatch) 7.83 45733 A transposon & IS 4.5 BAC68056.1 Non-secretory protein CDS SAVERM_348 406594 408870 katB putative catalase PF00199: Catalase 5.62 81387 A detoxification 4.2 BAC68057.1 Non-secretory protein CDS SAVERM_349 408998 409465 hypothetical protein 8.49 17405 A similar to unknown proteins 5 BAC68058.1 Non-secretory protein CDS SAVERM_350 411953 409830 prpD putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 6.15 75360 A protein modification 3.8 BAC68059.1 Non-secretory protein CDS SAVERM_351 413366 412866 hypothetical protein 12.42 17525 A no similarity 6 BAC68060.1 Non-secretory protein CDS SAVERM_352 413661 414347 putative secreted protein 9.77 24777 A no similarity 6 BAC68061.1 Signal peptide CDS SAVERM_353 414815 416212 hypothetical protein PF01609: Transposase DDE domain 8.67 51907 A similar to unknown proteins 5 BAC68062.1 Non-secretory protein CDS SAVERM_354 416987 419176 putative secreted protein 5.34 76912 A similar to unknown proteins 5 BAC68063.1 Signal peptide CDS SAVERM_355 419179 420861 putative glycosyltransferase PF00534: Glycosyl transferases group 1 9.04 60154 A specific pathways 2.1.1 BAC68064.1 Non-secretory protein CDS SAVERM_356 420855 422207 putative membrane protein PF07730: Histidine kinase 9.7 46101 A miscellaneous 4.7 BAC68065.1 Non-secretory protein CDS SAVERM_357 422345 423352 galE4 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 6.1 35745 A specific pathways 2.1.1 BAC68066.1 Non-secretory protein CDS SAVERM_358 423399 424112 mpg1 putative mannose-1-phosphate guanyltransferase PF00483: Nucleotidyl transferase 6.08 26037 A main glycolytic pathways 2.1.2 BAC68067.1 Non-secretory protein CDS SAVERM_359 424117 425016 putative NDP-hexose 4-ketoreductase PF01370: NAD dependent epimerase/dehydratase family 6.15 30270 A miscellaneous 4.7 BAC68068.1 Non-secretory protein CDS SAVERM_360 425013 425681 hypothetical protein 7.74 23572 A similar to unknown proteins 5 BAC68069.1 Non-secretory protein CDS SAVERM_361 425823 426356 hypothetical protein 11.1 20100 A similar to unknown proteins 5 BAC68070.1 Non-secretory protein CDS SAVERM_362 427010 426615 putative secreted protein 8.29 13413 A no similarity 6 BAC68071.1 Non-secretory protein CDS SAVERM_363 428631 427297 putative membrane protein 10 46995 A miscellaneous 4.7 BAC68072.1 Non-secretory protein CDS SAVERM_364 429688 428654 putative IS110 family ISLxx2-like transposase IS116/IS110/IS902 family 10.91 37375 A transposon & IS 4.5 BAC68073.1 Non-secretory protein CDS SAVERM_365 430053 431681 putative IS4 family ISFsp6-like transposase IS4 family (429919..431694). Inverted repeat sequence (36/37 bp). Target sequence (GNGTACNTC); same as SAV313. 10.06 59901 A transposon & IS 4.5 BAC68074.1 Non-secretory protein CDS SAVERM_366 432038 434323 hypothetical protein PF07929: Plasmid pRiA4b ORF-3-like protein 4.42 80952 A similar to unknown proteins 5 BAC68075.1 Non-secretory protein CDS SAVERM_367 434410 437262 helZ1 putative SNF2/RAD54 family helicase PF00176: SNF2 family N-terminal domain 7.14 103449 A DNA modification & repair 3.2 BAC68076.1 Non-secretory protein CDS SAVERM_368 437259 438503 hypothetical protein PF04434: SWIM zinc finger 6.94 44329 A similar to unknown proteins 5 BAC68077.1 Non-secretory protein CDS SAVERM_369 438792 439298 hypothetical protein 7.68 18358 A no similarity 6 BAC68078.1 Non-secretory protein CDS SAVERM_370 439959 439342 int2 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 10.01 22244 A phage-related functions 4.4 BAC68079.1 Non-secretory protein CDS SAVERM_371 440566 439970 putative oxidoreductase PF03807: NADP oxidoreductase coenzyme F420-dependent 4.96 20698 A miscellaneous 4.7 BAC68080.1 Non-secretory protein CDS SAVERM_372 441426 440608 suhB2 putative myo-inositol 1-monophosphatase PF00459: Inositol monophosphatase family 4.59 28672 A specific pathways 2.1.1 BAC68081.1 Non-secretory protein CDS SAVERM_373 441565 442470 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 9.62 32421 A regulation 3.5.2 BAC68082.1 Non-secretory protein CDS SAVERM_374 443421 443774 hypothetical protein 12.87 12616 A no similarity 6 BAC68083.1 Non-secretory protein CDS SAVERM_375 444076 444585 putative IS605 family IS606-like transposase IS200/IS605 family 12.08 19582 A transposon & IS 4.5 BAC68084.1 Non-secretory protein CDS SAVERM_376 445748 444528 hypothetical protein PF02954: Bacterial regulatory protein, Fis family 6.53 43568 A similar to unknown proteins 5 BAC68085.1 Non-secretory protein CDS SAVERM_377 445913 447400 fadD1 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.04 53652 A metabolism of lipids 2.4 BAC68086.1 Non-secretory protein CDS SAVERM_378 448310 448119 putative IS5 family ISFa13A-like transposase IS5 family, truncated 9.3 7409 A transposon & IS 4.5 BAC68087.1 Non-secretory protein CDS SAVERM_379 449558 449403 hypothetical protein 3.84 5468 A no similarity 6 BAC68088.1 Non-secretory protein CDS SAVERM_380 452924 449586 hypothetical protein 7.08 115581 A similar to unknown proteins 5 BAC68089.1 Non-secretory protein CDS SAVERM_381 453216 454730 putative phage tail sheath protein PF04984: Phage tail sheath protein 5.02 54192 A phage-related functions 4.4 BAC68090.1 Non-secretory protein CDS SAVERM_382 454732 455262 hypothetical protein 6.8 20019 A similar to unknown proteins 5 BAC68091.1 Non-secretory protein CDS SAVERM_383 455295 456008 hypothetical protein 4.24 25332 A similar to unknown proteins 5 BAC68092.1 Non-secretory protein CDS SAVERM_384 456005 456901 hypothetical protein PF04554: Extensin-like region 6.81 31025 A similar to unknown proteins 5 BAC68093.1 Non-secretory protein CDS SAVERM_385 456898 458088 putative secreted protein 9.93 40421 A similar to unknown proteins 5 BAC68094.1 Non-secretory protein CDS SAVERM_386 458085 459584 hypothetical protein 6.81 52039 A similar to unknown proteins 5 BAC68095.1 Non-secretory protein CDS SAVERM_387 459466 460251 putative AAA family ATPase PF00004: ATPase family associated with various cellular activities (AAA) 5.16 28250 A miscellaneous 4.7 BAC68096.1 Non-secretory protein CDS SAVERM_388 460571 461251 hypothetical protein 6.02 23889 A similar to unknown proteins 5 BAC68097.1 Non-secretory protein CDS SAVERM_389 461251 461568 hypothetical protein PF01476: LysM domain 5.6 11318 A similar to unknown proteins 5 BAC68098.1 Non-secretory protein CDS SAVERM_390 461558 462664 hypothetical protein 8.4 39156 A similar to unknown proteins 5 BAC68099.1 Non-secretory protein CDS SAVERM_391 462705 463295 hypothetical protein 4.64 20394 A similar to unknown proteins 5 BAC68100.1 Non-secretory protein CDS SAVERM_392 463306 463653 hypothetical protein 8.53 11330 A no similarity 6 BAC68101.1 Non-secretory protein CDS SAVERM_393 463650 464039 hypothetical protein PF04965: GPW / gp25 family 4.41 13998 A similar to unknown proteins 5 BAC68102.1 Non-secretory protein CDS SAVERM_394 464036 466855 hypothetical protein PF04865: Baseplate J-like protein 5.37 99411 A similar to unknown proteins 5 BAC68103.1 Non-secretory protein CDS SAVERM_395 466862 469465 hypothetical protein 6.09 91024 A similar to unknown proteins 5 BAC68104.1 Non-secretory protein CDS SAVERM_396 469462 471561 hypothetical protein 6.21 76830 A similar to unknown proteins 5 BAC68105.1 Non-secretory protein CDS SAVERM_397 471571 472863 hypothetical protein 6.07 46775 A similar to unknown proteins 5 BAC68106.1 Non-secretory protein CDS SAVERM_398 472897 474789 hypothetical protein PF06451: Moricin 6.73 67847 A similar to unknown proteins 5 BAC68107.1 Non-secretory protein CDS SAVERM_399 475045 474824 hypothetical protein 4.58 7827 A no similarity 6 BAC68108.1 Non-secretory protein CDS SAVERM_400 475824 475108 putative transcriptional regulator PF03704: Bacterial transcriptional activator domain 7.01 26247 A regulation 3.5.2 BAC68109.1 Non-secretory protein CDS SAVERM_401 476025 478859 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 6.95 101542 A regulation 3.5.2 BAC68110.1 Non-secretory protein CDS SAVERM_402 479630 479076 hypothetical protein 12.11 20979 A similar to unknown proteins 5 BAC68111.1 Non-secretory protein CDS SAVERM_403 481349 479883 pntB putative pyridine nucleotide transhydrogenase, beta subunit 6.51 51028 A metabolism of coenzymes & prosthetic groups 2.5 BAC68112.1 Non-secretory protein CDS SAVERM_404 482912 481356 pntA putative pyridine nucleotide transhydrogenase, alpha subunit 5.64 53305 A metabolism of coenzymes & prosthetic groups 2.5 BAC68113.1 Non-secretory protein CDS SAVERM_405 484188 484907 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 11.51 26199 A miscellaneous 4.7 BAC68114.1 Non-secretory protein CDS SAVERM_406 484941 485378 hypothetical protein PF00293: NUDIX domain 5.25 16241 A similar to unknown proteins 5 BAC68115.1 Non-secretory protein CDS SAVERM_7575 485375 485860 putative dipeptidase 12.06 17288 A protein modification 3.8 BAC68116.1 Non-secretory protein CDS SAVERM_407 487415 486648 pteH thioesterase filipin gene cluster 5.77 28425 A antibiotic production 4.3 BAC68117.1 Non-secretory protein CDS SAVERM_408 489155 487512 pteG putative cholesterol oxidase filipin gene cluster, Tat substrate, PF05199: GMC oxidoreductase 8.63 59061 A specific pathways 2.1.1 BAC68118.1 Signal peptide CDS SAVERM_409 490319 489621 pteF putative LuxR-family transcriptional regulator filipin gene cluster, PF00196: Bacterial regulatory proteins, luxR family 10.11 25096 A regulation 3.5.2 BAC68119.1 Non-secretory protein CDS SAVERM_410 490599 494192 pteR DnrI/RedD/AfsR-family transcriptional regulator filipin gene cluster, PF03704: Bacterial transcriptional activator domain, PF07721: Tetratricopeptide repeat 6.95 130245 A regulation 3.5.2 BAC68120.1 Non-secretory protein CDS SAVERM_411 494442 494248 pteE ferredoxin fdxI, filipin gene cluster, PF00037: 4Fe-4S binding domain 4.06 6752 A membrane bioenergetics 1.4 BAC68121.1 Non-secretory protein CDS SAVERM_412 495701 494487 pteD cytochrome P450 hydroxylase CYP105D6, filipin gene cluster 4.86 43972 A metabolism of coenzymes & prosthetic groups 2.5 BAC68122.1 Non-secretory protein CDS SAVERM_413 497482 496283 pteC cytochrome P450 hydroxylase CYP105P1, filipin gene cluster 4.79 43827 A metabolism of coenzymes & prosthetic groups 2.5 BAC68123.1 Non-secretory protein CDS SAVERM_414 498785 497529 pteB putative dehydrogenase filipin gene cluster, PF00107: Zinc-binding dehydrogenase 6.29 45510 A miscellaneous 4.7 BAC68124.1 Non-secretory protein CDS SAVERM_415 508904 498846 pteA5 modular polyketide synthase filipin gene cluster 5.12 353401 A antibiotic production 4.3 BAC68125.1 Non-secretory protein CDS SAVERM_416 527388 508951 pteA4 modular polyketide synthase filipin gene cluster 4.75 642037 A antibiotic production 4.3 BAC68126.1 Non-secretory protein CDS SAVERM_417 532975 527468 pteA3 modular polyketide synthase filipin gene cluster 4.72 192237 A antibiotic production 4.3 BAC68127.1 Non-secretory protein CDS SAVERM_418 543705 533011 pteA2 modular polyketide synthase filipin gene cluster 4.68 371263 A antibiotic production 4.3 BAC68128.1 Non-secretory protein CDS SAVERM_419 567017 543777 pteA1 modular polyketide synthase filipin gene cluster 4.71 806343 A antibiotic production 4.3 BAC68129.1 Non-secretory protein CDS SAVERM_420 567663 568697 putative Tn3 family ISXc5-like transposase PF01526: Transposase 9.48 38787 A transposon & IS 4.5 BAC68130.1 Non-secretory protein CDS SAVERM_421 568699 569952 putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 9.02 43965 A transport / binding proteins & lipoproteins 1.2 BAC68131.1 Signal peptide CDS SAVERM_422 570763 570215 hypothetical protein 11.33 19807 A similar to unknown proteins 5 BAC68132.1 Non-secretory protein CDS SAVERM_423 570940 571578 putative IS30 family ISCmi3-like transposase IS30 family, partial 10.17 23311 A transposon & IS 4.5 BAC68133.1 Non-secretory protein CDS SAVERM_7576 571598 571915 putative IS3 family ISAav40like transposase IS3 family, partial 8.45 11803 A transposon & IS 4.5 BAD67173.1 Non-secretory protein CDS SAVERM_424 574845 573907 sig3 putative RNA polymerase ECF-subfamily sigma factor similar to SCO0159, PF04542: Sigma-70 region 2 6.81 34100 A RNA initiation 3.5.1 BAC68134.1 Non-secretory protein CDS SAVERM_425 576046 574856 putative oxidoreductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 8.79 41596 A miscellaneous 4.7 BAC68135.1 Non-secretory protein CDS SAVERM_426 576603 576232 hypothetical protein 9.49 13348 A similar to unknown proteins 5 BAC68136.1 Non-secretory protein CDS SAVERM_427 577165 576830 hypothetical protein 5.71 11876 A similar to unknown proteins 5 BAC68137.1 Non-secretory protein CDS SAVERM_428 578180 577719 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 5.04 17231 A similar to unknown proteins 5 BAC68138.1 Non-secretory protein CDS SAVERM_429 579136 579753 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 5.98 22920 A similar to unknown proteins 5 BAC68139.1 Non-secretory protein CDS SAVERM_430 579746 580549 putative dehydrogenase PF00106: short chain dehydrogenase 6.96 26794 A miscellaneous 4.7 BAC68140.1 Non-secretory protein CDS SAVERM_431 581254 580610 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.5 23373 A regulation 3.5.2 BAC68141.1 Non-secretory protein CDS SAVERM_432 581626 582858 putative secreted protein PF02415: Chlamydia polymorphic membrane protein (Chlamydia_PMP) 5.37 41611 A similar to unknown proteins 5 BAC68142.1 Signal peptide CDS SAVERM_433 582893 584755 putative carboxylesterase PF00135: Carboxylesterase 9.23 65242 A detoxification 4.2 BAC68143.1 Signal peptide CDS SAVERM_434 584755 585144 hypothetical protein 10.81 13932 A similar to unknown proteins 5 BAC68144.1 Non-secretory protein CDS SAVERM_435 585449 585874 hypothetical protein 10.21 15354 A similar to unknown proteins 5 BAC68145.1 Non-secretory protein CDS SAVERM_436 586517 585858 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.64 23348 A regulation 3.5.2 BAC68146.1 Non-secretory protein CDS SAVERM_437 590051 587625 prpM1 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.19 88058 A protein modification 3.8 BAC68147.1 Non-secretory protein CDS SAVERM_438 591778 590678 hypothetical protein PF11017: Protein of unknown function (DUF2855) 4.97 40121 A similar to unknown proteins 5 BAC68148.1 Non-secretory protein CDS SAVERM_439 592773 592072 hypothetical protein PF09995: Uncharacterized protein conserved in bacteria (DUF2236) 9.8 26454 A no similarity 6 BAC68149.1 Non-secretory protein CDS SAVERM_440 594232 595248 rpoA2 putative RNA polymerase alpha subunit second RNA polymerase alpha subunit, PF01000: RNA polymerase Rpb3/RpoA insert domain 4.47 36500 A RNA elongation 3.5.3 BAC68150.1 Non-secretory protein CDS SAVERM_441 595471 596031 putative ISL3 family IS466A-like transposase ISL3 family 11.77 20841 A transposon & IS 4.5 BAC68151.1 Non-secretory protein CDS SAVERM_442 596538 596843 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 4.78 10922 A similar to unknown proteins 5 BAC68152.1 Non-secretory protein CDS SAVERM_443 596972 597148 hypothetical protein 7.68 6480 A no similarity 6 BAC68153.1 Non-secretory protein CDS SAVERM_444 600774 598312 wapA putative cell wall-associated protein PF05593: RHS Repeat 5 86999 A cell wall 1.1 BAC68154.1 Non-secretory protein CDS SAVERM_445 601425 601030 putative Tn3 family ISXc5-like transposase Tn3 family, truncated 7.09 14829 A transposon & IS 4.5 BAC68155.1 Non-secretory protein CDS SAVERM_446 601615 601349 putative IS21 family IS1474-like transposase IS21 family, truncated 9.72 9077 A transposon & IS 4.5 BAC68156.1 Non-secretory protein CDS SAVERM_447 601641 601862 putative IS630 family ISMma10-like transposase IS630 family, truncated 12.04 7633 A transposon & IS 4.5 BAC68157.1 Signal peptide CDS SAVERM_448 603446 602829 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.09 23006 A regulation 3.5.2 BAC68158.1 Non-secretory protein CDS SAVERM_449 603569 603973 hypothetical protein PF07876: Stress responsive A/B Barrel Domain 4.91 15078 A similar to unknown proteins 5 BAC68159.1 Non-secretory protein CDS SAVERM_450 604002 604904 hypothetical protein PF01370: NAD dependent epimerase/dehydratase family 9.5 32324 A similar to unknown proteins 5 BAC68160.1 Non-secretory protein CDS SAVERM_451 605373 605005 putative anti-sigma factor antagonist PF01740: STAS domain, phosphorylated/unphosphorylated form 4.51 12462 A regulation 3.5.2 BAC68161.1 Non-secretory protein CDS SAVERM_452 605510 606031 hypothetical protein 7.68 18533 A similar to unknown proteins 5 BAC68162.1 Non-secretory protein CDS SAVERM_453 606058 606540 hypothetical protein PF10025: Uncharacterized conserved protein (DUF2267) 7.63 17880 A similar to unknown proteins 5 BAC68163.1 Non-secretory protein CDS SAVERM_454 606685 607839 hypothetical protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 10.86 42158 A similar to unknown proteins 5 BAC68164.1 Non-secretory protein CDS SAVERM_455 608373 607861 hypothetical protein 8.51 18400 A no similarity 6 BAC68165.1 Non-secretory protein CDS SAVERM_456 608423 609064 hypothetical protein 11.99 23477 A no similarity 6 BAC68166.1 Non-secretory protein CDS SAVERM_457 610703 609036 hypothetical protein PF04434: SWIM zinc finger 5.02 60692 A similar to unknown proteins 5 BAC68167.1 Non-secretory protein CDS SAVERM_458 612434 611754 hspR18_1 putative hsp18 transcriptional regulator 7.68 24151 A regulation 3.5.2 BAC68168.1 Non-secretory protein CDS SAVERM_459 612565 612999 hsp18_1 putative heat shock protein PF00011: Hsp20/alpha crystallin family 4.87 16188 A adaptation to atypical conditions 4.1 BAC68169.1 Non-secretory protein CDS SAVERM_460 613088 613483 hypothetical protein PF06118: Archaeal PaREP8 protein 5.19 14369 A similar to unknown proteins 5 BAC68170.1 Non-secretory protein CDS SAVERM_461 614081 613563 hypothetical protein 4.33 18690 A no similarity 6 BAC68171.1 Non-secretory protein CDS SAVERM_462 614700 614386 hypothetical protein 4.45 11406 A no similarity 6 BAC68172.1 Non-secretory protein CDS SAVERM_463 614951 614793 hypothetical protein 8.98 5875 A no similarity 6 BAC68173.1 Non-secretory protein CDS SAVERM_464 615528 615205 hypothetical protein 4.46 10300 A no similarity 6 BAC68174.1 Non-secretory protein CDS SAVERM_465 615875 616378 hypothetical protein PF00190: Cupin doamin, 100% same as SAV878 4.63 18407 A similar to unknown proteins 5 BAC68175.1 Non-secretory protein CDS SAVERM_466 618189 618728 putative secreted protein 4.78 17700 A no similarity 6 BAC68176.1 Signal peptide CDS SAVERM_467 618731 619111 hypothetical protein 7.62 13852 A no similarity 6 BAC68177.1 Non-secretory protein CDS SAVERM_468 619319 619990 putative oxygenase 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 5.73 25388 A miscellaneous 4.7 BAC68178.1 Non-secretory protein CDS SAVERM_469 620530 621735 putative secreted lipase Tat substrate, PF03403: Platelet-activating factor acetylhydrolase, plasma/intracellular isoform II 7 42975 A metabolism of lipids 2.4 BAC68179.1 Signal peptide CDS SAVERM_470 621832 622614 putative IS5 family IS493-like transposase PF01609: Transposase DDE domain 12.01 28712 A transposon & IS 4.5 BAC68180.1 Non-secretory protein CDS SAVERM_471 622993 623559 hypothetical protein PF01872: RibD C-terminal domain 4.68 20742 A similar to unknown proteins 5 BAC68181.1 Non-secretory protein CDS SAVERM_472 625432 624344 putative regulatory protein PF00165: Bacterial regulatory helix-turn-helix proteins, araC family 12.53 39244 A regulation 3.5.2 BAC68182.1 Non-secretory protein CDS SAVERM_473 626249 625518 putative ISL3 family IS469-like transposase ISL3 family 11.47 26556 A transposon & IS 4.5 BAC68183.1 Non-secretory protein CDS SAVERM_474 627271 626420 putative methyltransferase PF02409: O-methyltransferase N-terminus 4.95 30657 A miscellaneous 4.7 BAC68184.1 Non-secretory protein CDS SAVERM_475 627523 627377 hypothetical protein 10.75 5368 A no similarity 6 BAC68185.1 Non-secretory protein CDS SAVERM_476 628107 627541 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.32 20996 A similar to unknown proteins 5 BAC68186.1 Non-secretory protein CDS SAVERM_477 628625 628882 hypothetical protein 4.28 9568 A similar to unknown proteins 5 BAC68187.1 Non-secretory protein CDS SAVERM_478 629473 629790 hypothetical protein 6.94 11317 A similar to unknown proteins 5 BAC68188.1 Non-secretory protein CDS SAVERM_479 630354 629806 putative IS630 family ISPlu10-like transposase IS3 family (630954..629809) Inverted repeat seqnce (25/26 bp). Target sequence (TA); Translation will be controlled by framenshift with SAV480. 11.82 21104 A transposon & IS 4.5 BAC68189.1 Non-secretory protein CDS SAVERM_480 630686 630351 putative IS4 family ISXo14-like transposase IS3 family (630954..629809) Inverted repeat seqnce (25/26 bp). Target sequence (TA). 11.76 12680 A transposon & IS 4.5 BAC68190.1 Non-secretory protein CDS SAVERM_481 631222 631539 hypothetical protein 9.46 11383 A similar to unknown proteins 5 BAC68192.1 Non-secretory protein CDS SAVERM_482 631274 630951 hypothetical protein 4.99 11554 A no similarity 6 BAC68191.1 Non-secretory protein CDS SAVERM_483 631783 631562 hypothetical protein 12.21 7538 A no similarity 6 BAC68193.1 Signal peptide CDS SAVERM_484 632638 631817 putative methyltransferase PF07021: Methionine biosynthesis protein MetW 4.76 29330 A miscellaneous 4.7 BAC68194.1 Non-secretory protein CDS SAVERM_485 632948 633259 hypothetical protein 11.98 11105 A no similarity 6 BAC68195.1 Non-secretory protein CDS SAVERM_486 633243 633470 hypothetical protein 4.61 8986 A no similarity 6 BAC68196.1 Non-secretory protein CDS SAVERM_487 634218 633937 putative secreted protein 11.85 9969 A no similarity 6 BAC68197.1 Signal peptide CDS SAVERM_488 635061 634378 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.31 24514 A regulation 3.5.2 BAC68198.1 Non-secretory protein CDS SAVERM_489 635181 635900 putative secreted protein PF00950: ABC 3 transport family 8.48 23991 A no similarity 6 BAC68199.1 Non-secretory protein CDS SAVERM_490 636563 636261 hypothetical protein 12.28 11066 A no similarity 6 BAC68200.1 Non-secretory protein CDS SAVERM_491 637317 636931 putative transcriptional regulator PF01638: Transcriptional regulator 8.74 14711 A regulation 3.5.2 BAC68201.1 Non-secretory protein CDS SAVERM_492 637423 638256 echA1 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 4.51 29295 A metabolism of lipids 2.4 BAC68202.1 Non-secretory protein CDS SAVERM_493 639388 639053 putative secreted protein PF00137: ATP synthase subunit C 11.94 11812 A similar to unknown proteins 5 BAC68203.1 Non-secretory protein CDS SAVERM_494 640821 640006 hypothetical protein 5.16 28663 A similar to unknown proteins 5 BAC68204.1 Non-secretory protein CDS SAVERM_495 641145 641333 hypothetical protein 8.52 6602 A no similarity 6 BAC68205.1 Non-secretory protein CDS SAVERM_496 641343 641822 hypothetical protein PF01230: HIT domain 4.89 18249 A similar to unknown proteins 5 BAC68206.1 Non-secretory protein CDS SAVERM_497 642389 642613 int3 putative recombinase/integrase probably pseudogene 10.43 7845 A DNA recombination 3.3 BAC68207.1 Non-secretory protein CDS SAVERM_498 642610 643092 int4 putative recombinase/integrase 9.6 17691 A DNA recombination 3.3 BAC68208.1 Non-secretory protein CDS SAVERM_499 643727 643080 hypothetical protein PF00320: GATA zinc finger 9.46 25031 A similar to unknown proteins 5 BAC68209.1 Non-secretory protein CDS SAVERM_500 643739 644002 hypothetical protein 9.5 10171 A similar to unknown proteins 5 BAC68210.1 Non-secretory protein CDS SAVERM_501 645011 644154 putative nuclease PF00565: Staphylococcal nuclease homologue 5.34 31216 A DNA modification & repair 3.2 BAC68211.1 Non-secretory protein CDS SAVERM_502 645671 645222 hypothetical protein 6.86 16693 A no similarity 6 BAC68212.1 Non-secretory protein CDS SAVERM_503 646712 646464 hypothetical protein 12.28 8991 A no similarity 6 BAC68213.1 Non-secretory protein CDS SAVERM_504 647130 646906 infA2 putative translation initiation factor IF-1 PF00575: S1 RNA binding domain 9.97 8673 A initiation 3.7.3 BAC68214.1 Non-secretory protein CDS SAVERM_7577 648520 648107 putative IS5 family ISBce20-like transposase IS5 family 5.73 14995 A transposon & IS 4.5 BAD67174.1 Non-secretory protein CDS SAVERM_505 649314 648664 putative monooxygenase PF03992: Antibiotic biosynthesis monooxygenase 4.74 24002 A miscellaneous 4.7 BAC68215.1 Non-secretory protein CDS SAVERM_506 650027 650887 hypothetical protein PF07690: Major Facilitator Superfamily 10.31 28940 A similar to unknown proteins 5 BAC68216.1 Non-secretory protein CDS SAVERM_507 653355 652300 putative cinnamoyl-CoA reductase PF01073: 3-beta hydroxysteroid dehydrogenase/isomerase family 4.64 37303 A specific pathways 2.1.1 BAC68217.1 Non-secretory protein CDS SAVERM_508 653742 654326 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.93 21110 A regulation 3.5.2 BAC68218.1 Non-secretory protein CDS SAVERM_509 654727 654353 putative IS5 family ISSco3-like transposase IS5 family 4.08 13466 A transposon & IS 4.5 BAC68219.1 Non-secretory protein CDS SAVERM_510 654951 655112 hypothetical protein 12.41 5859 A no similarity 6 BAC68220.1 Non-secretory protein CDS SAVERM_511 656608 655559 hypothetical protein PF01966: HD domain 4.56 38010 A similar to unknown proteins 5 BAC68221.1 Non-secretory protein CDS SAVERM_512 657562 656762 putative hydrolase PF00561: alpha/beta hydrolase fold 5.53 28514 A miscellaneous 4.7 BAC68222.1 Non-secretory protein CDS SAVERM_513 657798 658799 bdpJ putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 7.57 36069 A regulation 3.5.2 BAC68223.1 Non-secretory protein CDS SAVERM_514 658738 659214 hypothetical protein 9.22 17272 A no similarity 6 BAC68224.1 Non-secretory protein CDS SAVERM_515 660030 659554 putative oxidoreductase with iron-sulfur subunit PF01799: [2Fe-2S] binding domain 5.74 17089 A miscellaneous 4.7 BAC68225.1 Non-secretory protein CDS SAVERM_516 662125 660050 putative oxidoreductase PF02738: Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain 10.96 72385 A miscellaneous 4.7 BAC68226.1 Non-secretory protein CDS SAVERM_517 663070 662516 hypothetical protein PF01527: Transposase 11.37 19820 A similar to unknown proteins 5 BAC68227.1 Non-secretory protein CDS SAVERM_518 663246 663079 hypothetical protein 8.27 6139 A no similarity 6 BAC68228.1 Non-secretory protein CDS SAVERM_519 664171 663296 putative hydrolase PF00561: alpha/beta hydrolase fold 7.72 31148 A miscellaneous 4.7 BAC68229.1 Non-secretory protein CDS SAVERM_520 664873 664226 putative transcriptional regulator PF01638: Transcriptional regulator 8.5 23707 A regulation 3.5.2 BAC68230.1 Non-secretory protein CDS SAVERM_521 665000 665731 putative secreted protein PF03208: PRA1 family protein 12.2 24502 A similar to unknown proteins 5 BAC68231.1 Signal peptide CDS SAVERM_522 665728 665937 hypothetical protein 10.11 7587 A similar to unknown proteins 5 BAC68232.1 Non-secretory protein CDS SAVERM_523 667279 666194 putative Tn3 family ISSod9-like transposase Tn3 family 8.32 39687 A transposon & IS 4.5 BAC68233.1 Non-secretory protein CDS SAVERM_524 668142 668879 cdh putative CDP-diacylglycerol phosphotidylhydrolase PF02611: CDP-diacylglycerol pyrophosphatase 6.94 27029 A metabolism of lipids 2.4 BAC68234.1 Non-secretory protein CDS SAVERM_525 669258 669710 putative IS630 family ISXo7-like transposase IS630 family 9.79 17661 A transposon & IS 4.5 BAC68235.1 Non-secretory protein CDS SAVERM_526 671113 670688 hypothetical protein PF12158: Protein of unknown function (DUF3592) 11.07 15714 A no similarity 6 BAC68236.1 Non-secretory protein CDS SAVERM_527 671956 672573 sig4 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 11.48 22161 A RNA initiation 3.5.1 BAC68237.1 Non-secretory protein CDS SAVERM_528 672570 673388 putative ABC transporter permease protein PF01061: ABC-2 type transporter 8.5 28357 A transport / binding proteins & lipoproteins 1.2 BAC68238.1 Non-secretory protein CDS SAVERM_529 673385 674218 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.67 29927 A transport / binding proteins & lipoproteins 1.2 BAC68239.1 Non-secretory protein CDS SAVERM_530 674215 675609 putative secreted protein PF00335: Tetraspanin family 10.4 48786 A no similarity 6 BAC68240.1 Non-secretory protein CDS SAVERM_531 675606 676181 putative secreted protein PF00960: Neocarzinostatin family 12.11 19572 A no similarity 6 BAC68241.1 Signal peptide CDS SAVERM_532 676319 676693 hypothetical protein 6.51 12525 A similar to unknown proteins 5 BAC68242.1 Non-secretory protein CDS SAVERM_533 676902 677138 hypothetical protein 10.43 8211 A no similarity 6 BAC68243.1 Non-secretory protein CDS SAVERM_534 677241 678026 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.85 28413 A miscellaneous 4.7 BAC68244.1 Non-secretory protein CDS SAVERM_535 678091 678423 hypothetical protein 5.59 11908 A similar to unknown proteins 5 BAC68245.1 Non-secretory protein CDS SAVERM_536 678746 678456 hypothetical protein 4.55 10612 A no similarity 6 BAC68246.1 Non-secretory protein CDS SAVERM_537 679055 679966 putative Sir2-family regulator protein PF02146: Sir2 family 7.94 32124 A regulation 3.5.2 BAC68247.1 Non-secretory protein CDS SAVERM_538 680351 680782 hypothetical protein 4.29 15607 A similar to unknown proteins 5 BAC68248.1 Non-secretory protein CDS SAVERM_539 682687 681371 hypothetical protein PF07907: YibE/F-like protein 8.82 48670 A no similarity 6 BAC68249.1 Non-secretory protein CDS SAVERM_540 684113 683712 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 6.52 14887 A regulation 3.5.2 BAC68250.1 Non-secretory protein CDS SAVERM_541 684229 684993 putative 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase PF00561: alpha/beta hydrolase fold 5.23 26092 A specific pathways 2.1.1 BAC68251.1 Non-secretory protein CDS SAVERM_542 685826 686794 hypothetical protein 9.5 35386 A similar to unknown proteins 5 BAC68252.1 Non-secretory protein CDS SAVERM_543 688139 687276 folD2 putative methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase PF02882: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain 6.51 29760 A metabolism of coenzymes & prosthetic groups 2.5 BAC68253.1 Non-secretory protein CDS SAVERM_544 689843 688569 putative serine protease PF00082: Subtilase family 8.06 42775 A protein modification 3.8 BAC68254.1 Non-secretory protein CDS SAVERM_545 690814 690137 ribA4 putative GTP cyclohydrolase II riboflavin biosynthesis, PF00925: GTP cyclohydrolase II 6.62 24292 A metabolism of coenzymes & prosthetic groups 2.5 BAC68255.1 Non-secretory protein CDS SAVERM_546 691955 690909 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.95 36671 A miscellaneous 4.7 BAC68256.1 Non-secretory protein CDS SAVERM_547 693268 692180 hypothetical protein PF00515: TPR Domain 6.1 39170 A no similarity 6 BAC68257.1 Non-secretory protein CDS SAVERM_548 694434 693265 hypothetical protein 4.16 41783 A no similarity 6 BAC68258.1 Non-secretory protein CDS SAVERM_549 695799 694471 putative peroxidase PF04261: Dyp-type peroxidase family 4.87 48571 A miscellaneous 4.7 BAC68259.1 Non-secretory protein CDS SAVERM_550 696545 695916 hypothetical protein 4.73 23226 A no similarity 6 BAC68260.1 Non-secretory protein CDS SAVERM_551 697507 696920 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.14 21110 A regulation 3.5.2 BAC68261.1 Non-secretory protein CDS SAVERM_552 699213 697702 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.53 51794 A transport / binding proteins & lipoproteins 1.2 BAC68262.1 Non-secretory protein CDS SAVERM_553 700701 700072 hypothetical protein 4.73 23226 A no similarity 6 BAC68263.1 Non-secretory protein CDS SAVERM_554 701238 702260 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.68 36778 A regulation 3.5.2 BAC68264.1 Non-secretory protein CDS SAVERM_555 702503 703630 celA1 putative secreted endo-1,4-beta-glucanase PF01670: Glycosyl hydrolase family 12 7.2 38717 A specific pathways 2.1.1 BAC68265.1 Signal peptide CDS SAVERM_556 703943 704353 celS1 putative cellulose-binding protein PF00553: Cellulose binding domain 4.57 14175 A specific pathways 2.1.1 BAC68266.1 Non-secretory protein CDS SAVERM_557 704446 706671 guxA1 putative cellulose 1,4-beta-cellobiosidase PF01341: Glycosyl hydrolases family 6 5.8 77396 A specific pathways 2.1.1 BAC68267.1 Signal peptide CDS SAVERM_558 707738 708082 hypothetical protein 12.33 11957 A no similarity 6 BAC68268.1 Non-secretory protein CDS SAVERM_559 708335 708796 putative secreted protein 6.61 18169 A similar to unknown proteins 5 BAC68269.1 Signal peptide CDS SAVERM_560 709185 710330 nicT1 putative high-affinity nickel-transport protein PF03824: High-affinity nickel-transport protein 9.7 41308 A transport / binding proteins & lipoproteins 1.2 BAC68270.1 Non-secretory protein CDS SAVERM_561 711135 710518 putative NADH dehydrogenase/NAD(P)H nitroreductase PF00881: Nitroreductase family 4.8 22347 A membrane bioenergetics 1.4 BAC68271.1 Non-secretory protein CDS SAVERM_562 713301 711283 acsA3 putative acetoacetyl-CoA synthetase PF00501: AMP-binding enzyme 5.51 72223 A specific pathways 2.1.1 BAC68272.1 Non-secretory protein CDS SAVERM_563 714925 713315 mhpA putative 3-(3-hydroxy-phenyl)propionate hydroxylase Rif19 homolog, PF01494: FAD binding domain 7.44 59143 A metabolism of coenzymes & prosthetic groups 2.5 BAC68273.1 Non-secretory protein CDS SAVERM_564 715860 714922 putative 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase PF01557: Fumarylacetoacetate (FAA) hydrolase family 7.66 33684 A specific pathways 2.1.1 BAC68274.1 Non-secretory protein CDS SAVERM_565 716894 715857 bphC putative 2,3-dihydroxybiphenyl-1,2-dioxygenase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 6 37866 A detoxification 4.2 BAC68275.1 Non-secretory protein CDS SAVERM_566 717140 717775 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.98 22981 A regulation 3.5.2 BAC68276.1 Non-secretory protein CDS SAVERM_567 717968 719413 hypothetical protein PF01590: GAF domain 7.74 52024 A similar to unknown proteins 5 BAC68277.1 Non-secretory protein CDS SAVERM_568 719128 720147 prpI1 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.47 36011 A protein modification 3.8 BAC68278.1 Non-secretory protein CDS SAVERM_569 720606 721364 putative hydrolase PF00561: alpha/beta hydrolase fold 4.5 28124 A miscellaneous 4.7 BAC68279.1 Non-secretory protein CDS SAVERM_570 721705 722091 ssgY putative SsgA homolog (the deletion was not affected on the sporulation) PF04686: Streptomyces sporulation and cell division protein, SsgA 4.17 13901 A regulation 3.5.2 BAC68280.1 Non-secretory protein CDS SAVERM_571 722855 723661 hypothetical protein PF03691: Uncharacterised protein family (UPF0167) 6.55 28621 A similar to unknown proteins 5 BAC68281.1 Non-secretory protein CDS SAVERM_572 724497 723643 hypothetical protein PF07287: Protein of unknown function (DUF1446) 8.11 30518 A similar to unknown proteins 5 BAC68282.1 Non-secretory protein CDS SAVERM_573 725370 724687 hypothetical protein 6.73 24145 A similar to unknown proteins 5 BAC68283.1 Non-secretory protein CDS SAVERM_574 726644 725598 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.91 36080 A miscellaneous 4.7 BAC68284.1 Non-secretory protein CDS SAVERM_575 729997 726776 cyp2 putative cytochrome P450 / NADPH-ferrihemoprotein reductase CYP102D1, bifunctional P450:NADPH-P450 reductase 4.89 118590 A metabolism of coenzymes & prosthetic groups 2.5 BAC68285.1 Non-secretory protein CDS SAVERM_576 730897 731553 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.95 23842 A regulation 3.5.2 BAC68286.1 Non-secretory protein CDS SAVERM_577 732822 732025 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.4 28432 A regulation 3.5.2 BAC68287.1 Non-secretory protein CDS SAVERM_578 733389 733207 hypothetical protein 4.09 6653 A no similarity 6 BAC68288.1 Non-secretory protein CDS SAVERM_579 734434 734105 hypothetical protein PF07978: NIPSNAP 4.48 12223 A no similarity 6 BAC68289.1 Non-secretory protein CDS SAVERM_580 734922 734503 ssgZ putative SsgA homolog (the deletion was not affected on the sporulation) PF04686: Streptomyces sporulation and cell division protein, SsgA 4.6 15204 A regulation 3.5.2 BAC68290.1 Non-secretory protein CDS SAVERM_581 735294 734950 putative secreted protein 6.62 11986 A no similarity 6 BAC68291.1 Signal peptide CDS SAVERM_582 735716 735925 fdxA putative ferredoxin 4.17 7404 A membrane bioenergetics 1.4 BAC68292.1 Non-secretory protein CDS SAVERM_583 735915 737279 fprA putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.44 47645 A membrane bioenergetics 1.4 BAC68293.1 Non-secretory protein CDS SAVERM_584 737312 738511 cyp3 putative cytochrome P450 CYP147B1, fdxA and fprA are located at upstream 4.8 44221 A metabolism of coenzymes & prosthetic groups 2.5 BAC68294.1 Non-secretory protein CDS SAVERM_585 739236 738601 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.32 22592 A regulation 3.5.2 BAC68295.1 Non-secretory protein CDS SAVERM_586 739502 741964 prpL1 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain, PF01590: GAF domain 5.05 88372 A protein modification 3.8 BAC68296.1 Non-secretory protein CDS SAVERM_587 742052 744481 prpJ1 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.21 86291 A protein modification 3.8 BAC68297.1 Non-secretory protein CDS SAVERM_588 745287 744841 putative AsnC-family transcriptional regulator PF01037: AsnC family 7.51 16342 A regulation 3.5.2 BAC68298.1 Non-secretory protein CDS SAVERM_589 745381 746199 putative F420-dependent dehydrogenase PF00296: Luciferase-like monooxygenase 6.73 29839 A membrane bioenergetics 1.4 BAC68299.1 Non-secretory protein CDS SAVERM_590 746196 746633 cdd1 putative cytidine/deoxycytidine deaminase PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region 4.88 15513 A miscellaneous 4.7 BAC68300.1 Non-secretory protein CDS SAVERM_591 747162 746752 gvpK1 putative gas vesicle synthesis protein PF05121: Gas vesicle protein K 4.3 15031 A gas vesicle 4.7.1 BAC68301.1 Non-secretory protein CDS SAVERM_592 747446 747159 gvpS1 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 4.87 9959 A gas vesicle 4.7.1 BAC68302.1 Non-secretory protein CDS SAVERM_593 748261 747446 gvpL1 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 5.35 29437 A gas vesicle 4.7.1 BAC68303.1 Non-secretory protein CDS SAVERM_594 748707 748258 gvpJ1 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 7.7 16274 A gas vesicle 4.7.1 BAC68304.1 Non-secretory protein CDS SAVERM_595 748928 748704 putative secreted protein 4.14 7693 A no similarity 6 BAC68305.1 Non-secretory protein CDS SAVERM_596 749176 748925 gvpG1 putative gas vesicle synthesis protein PF05120: Gas vesicle protein G 4.11 9466 A gas vesicle 4.7.1 BAC68306.1 Non-secretory protein CDS SAVERM_597 749916 749194 gvpF1 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 4.74 25980 A gas vesicle 4.7.1 BAC68307.1 Non-secretory protein CDS SAVERM_598 750369 749920 gvpA1 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 5.37 16008 A gas vesicle 4.7.1 BAC68308.1 Non-secretory protein CDS SAVERM_599 750848 750480 gvpO1 putative gas vesicle synthesis protein PF05800: Gas vesicle synthesis protein GvpO 10.08 13842 A gas vesicle 4.7.1 BAC68309.1 Non-secretory protein CDS SAVERM_600 752148 751402 fecC1 putative ABC transporter iron(III)/siderophore transport system ATP-binding protein fhuC, PF00005: ABC transporter 5.38 26492 A transport / binding proteins & lipoproteins 1.2 BAC68310.1 Non-secretory protein CDS SAVERM_601 753176 752205 fecD1 putative ABC transporter iron(III)/siderophore permease protein fhuB, PF01032: FecCD transport family 11.41 32951 A transport / binding proteins & lipoproteins 1.2 BAC68311.1 Non-secretory protein CDS SAVERM_602 754285 753242 fecB putative ABC transporter iron(III)/siderophore-binding protein fhuD, PF01497: Periplasmic binding protein 8.54 36585 A transport / binding proteins & lipoproteins 1.2 BAC68312.1 Signal peptide CDS SAVERM_603 758698 754376 nrps6 putative non-ribosomal peptide synthetase nrps6 gene cluster 6.48 154786 A antibiotic production 4.3 BAC68313.1 Non-secretory protein CDS SAVERM_604 758963 758706 hypothetical protein nrps6 gene cluster, PF00550: Phosphopantetheine attachment site 3.98 9666 A similar to unknown proteins 5 BAC68314.1 Non-secretory protein CDS SAVERM_605 760552 758996 fadD2 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase nrps6 gene cluster, PF00501: AMP-binding enzyme 5.68 56573 A metabolism of lipids 2.4 BAC68315.1 Non-secretory protein CDS SAVERM_606 761123 760605 hypothetical protein nrps6 gene cluster 5.25 19446 A similar to unknown proteins 5 BAC68316.1 Non-secretory protein CDS SAVERM_607 762010 761120 putative taurine catabolism dioxygenase nrps6 gene cluster, PF02668: Taurine catabolism dioxygenase TauD, TfdA family 6.05 33867 A miscellaneous 4.7 BAC68317.1 Non-secretory protein CDS SAVERM_608 762285 762046 fabC2 putative acyl carrier protein nrps6 gene cluster, PF00550: Phosphopantetheine attachment site 3.94 8557 A metabolism of lipids 2.4 BAC68318.1 Non-secretory protein CDS SAVERM_609 763277 762282 fabH4 putative 3-oxoacyl-ACP synthase III nrps6 gene cluster, PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 6.7 34470 A metabolism of lipids 2.4 BAC68319.1 Non-secretory protein CDS SAVERM_610 764827 763424 putative MFS transporter protein PF07690: Major Facilitator Superfamily 9.34 46848 A transport / binding proteins & lipoproteins 1.2 BAC68320.1 Non-secretory protein CDS SAVERM_611 765853 765101 putative beta-hydroxylase PF05118: Aspartyl/Asparaginyl beta-hydroxylase 4.78 28323 A miscellaneous 4.7 BAC68321.1 Non-secretory protein CDS SAVERM_612 766415 765882 hypothetical protein 5.32 18657 A similar to unknown proteins 5 BAC68322.1 Non-secretory protein CDS SAVERM_613 767298 767819 putative secreted protein PF04314: Protein of unknown function (DUF461) 11.36 18150 A similar to unknown proteins 5 BAC68323.1 Non-secretory protein CDS SAVERM_614 768552 767899 sig5 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 5.79 23632 A RNA initiation 3.5.1 BAC68324.1 Non-secretory protein CDS SAVERM_615 769429 768752 putative secreted protein PF04207: Tetrahydromethanopterin S-methyltransferase, subunit D 11.33 22964 A similar to unknown proteins 5 BAC68325.1 Non-secretory protein CDS SAVERM_616 770101 769580 putative secreted protein Tat substrate, PF04314: Protein of unknown function (DUF461) 11.93 17731 A similar to unknown proteins 5 BAC68326.1 Non-secretory protein CDS SAVERM_617 772353 770098 ctpB putative cation-transporting P-type ATPase PF00122: E1-E2 ATPase 7 77514 A membrane bioenergetics 1.4 BAC68327.1 Non-secretory protein CDS SAVERM_618 772664 772353 hypothetical protein PF07172: Glycine rich protein family 6.51 10421 A similar to unknown proteins 5 BAC68328.1 Non-secretory protein CDS SAVERM_619 773498 773199 hypothetical protein 7.29 10813 A no similarity 6 BAC68329.1 Non-secretory protein CDS SAVERM_620 774389 773556 putative hydrolase PF00561: alpha/beta hydrolase fold 6.27 29997 A miscellaneous 4.7 BAC68330.1 Non-secretory protein CDS SAVERM_621 774469 774984 putative MarR-family transcriptional regulator PF01047: MarR family 7.53 17901 A regulation 3.5.2 BAC68331.1 Non-secretory protein CDS SAVERM_622 775498 775956 hypothetical protein 8.26 16585 A similar to unknown proteins 5 BAC68332.1 Non-secretory protein CDS SAVERM_623 776002 776298 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 11.63 10662 A regulation 3.5.2 BAC68333.1 Non-secretory protein CDS SAVERM_624 777039 776473 hypothetical protein 5.03 20377 A similar to unknown proteins 5 BAC68334.1 Non-secretory protein CDS SAVERM_625 777216 778127 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 7.43 32388 A regulation 3.5.2 BAC68335.1 Non-secretory protein CDS SAVERM_626 778334 779140 hypothetical protein PF08242: Methyltransferase domain 5.56 29001 A similar to unknown proteins 5 BAC68336.1 Non-secretory protein CDS SAVERM_627 781029 779554 putative glycosyl hydrolase, secreted PF03663: Glycosyl hydrolase family 76 6.42 52841 A miscellaneous 4.7 BAC68337.1 Signal peptide CDS SAVERM_628 782660 781050 agaA1 putative alpha-galactosidase, secreted PF00652: QXW lectin repeat 5.04 56259 A specific pathways 2.1.1 BAC68338.1 Signal peptide CDS SAVERM_629 782844 783239 hypothetical protein 6.25 13819 A similar to unknown proteins 5 BAC68339.1 Non-secretory protein CDS SAVERM_630 784940 783885 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 7.04 37817 A regulation 3.5.2 BAC68340.1 Non-secretory protein CDS SAVERM_631 785356 785871 hypothetical protein PF00754: F5/8 type C domain 6.35 17945 A similar to unknown proteins 5 BAC68342.1 Non-secretory protein CDS SAVERM_632 785402 785031 hypothetical protein 9.16 13272 A no similarity 6 BAC68341.1 Non-secretory protein CDS SAVERM_633 786451 786915 putative secreted protein 6.35 17432 A no similarity 6 BAC68343.1 Non-secretory protein CDS SAVERM_634 788248 789312 putative IS110 family ISLxx2-like transposase IS110 family 10.33 38600 A transposon & IS 4.5 BAC68344.1 Non-secretory protein CDS SAVERM_635 790355 789498 echA2 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.42 30192 A metabolism of lipids 2.4 BAC68345.1 Non-secretory protein CDS SAVERM_636 791451 790843 putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family 4.53 21574 A regulation 3.5.2 BAC68346.1 Non-secretory protein CDS SAVERM_637 792676 792236 hypothetical protein 6.26 16100 A similar to unknown proteins 5 BAC68347.1 Non-secretory protein CDS SAVERM_638 793192 794145 hypothetical protein 4.65 34711 A similar to unknown proteins 5 BAC68348.1 Non-secretory protein CDS SAVERM_639 795285 794749 pkn1 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.98 20007 A protein modification 3.8 BAC68349.1 Non-secretory protein CDS SAVERM_640 796901 797425 hypothetical protein 7.53 19021 A no similarity 6 BAC68350.1 Non-secretory protein CDS SAVERM_641 797764 798072 hypothetical protein 11.46 11046 A similar to unknown proteins 5 BAC68351.1 Non-secretory protein CDS SAVERM_642 801284 798051 putative membrane protein PF05729: NACHT domain 10.27 118809 A miscellaneous 4.7 BAC68352.1 Non-secretory protein CDS SAVERM_643 801581 801354 hypothetical protein 4.61 7881 A no similarity 6 BAC68353.1 Non-secretory protein CDS SAVERM_644 802775 803185 putative secreted protein 9.78 15424 A no similarity 6 BAC68354.1 Signal peptide CDS SAVERM_645 803486 803307 hypothetical protein 4.74 6058 A no similarity 6 BAC68355.1 Non-secretory protein CDS SAVERM_646 804099 803533 putative two-component system sensor kinase frameshift 6.85 19630 A miscellaneous 4.7 BAC68356.1 Non-secretory protein CDS SAVERM_647 804863 804165 putative sensor kinase frameshift 4.74 24520 A miscellaneous 4.7 BAC68357.1 Non-secretory protein CDS SAVERM_648 805603 804917 putative two-component system response regulator PF00072: Response regulator receiver domain 5.68 24926 A regulation 3.5.2 BAC68358.1 Non-secretory protein CDS SAVERM_649 806720 806100 ard putative phosphotransferase (aminonucleoside antibiotic resistance) similar to aminonucleoside antibiotic A201A phosphotransferase, PF07931: Chloramphenicol phosphotransferase-like protein 7.98 23112 A miscellaneous 4.7 BAC68359.1 Non-secretory protein CDS SAVERM_650 807493 808398 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 5.13 32508 A miscellaneous 4.7 BAC68360.1 Non-secretory protein CDS SAVERM_651 808670 808509 hypothetical protein 11.86 6360 A no similarity 6 BAC68361.1 Non-secretory protein CDS SAVERM_652 810859 809624 fsr putative fosmidomycin resistance protein (membrane efflux protein) probable membrane efflux protein, PF07690: Major Facilitator Superfamily 8.59 41906 A transport / binding proteins & lipoproteins 1.2 BAC68362.1 Non-secretory protein CDS SAVERM_653 810914 811657 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, araC family 8.55 28632 A regulation 3.5.2 BAC68363.1 Non-secretory protein CDS SAVERM_654 812788 811793 putative oxidoreductase PF00248: Aldo/keto reductase family 5.23 35015 A miscellaneous 4.7 BAC68364.1 Non-secretory protein CDS SAVERM_655 812915 813775 putative DNA-binding protein PF01381: Helix-turn-helix 7.35 31732 A regulation 3.5.2 BAC68365.1 Non-secretory protein CDS SAVERM_656 814319 813831 hypothetical protein 4.48 17635 A no similarity 6 BAC68366.1 Non-secretory protein CDS SAVERM_657 815231 814839 hypothetical protein 4.63 13964 A no similarity 6 BAC68367.1 Non-secretory protein CDS SAVERM_658 816663 815233 putative membrane protein PF06072: Alphaherpesvirus tegument protein US9 9.5 52904 A miscellaneous 4.7 BAC68368.1 Non-secretory protein CDS SAVERM_659 818171 817263 bdpD putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.79 32403 A regulation 3.5.2 BAC68369.1 Non-secretory protein CDS SAVERM_660 818311 818904 blaB1 putative metallo-beta-lactamase PF00753: Metallo-beta-lactamase superfamily 5.19 20942 A detoxification 4.2 BAC68370.1 Non-secretory protein CDS SAVERM_661 819619 818939 hypothetical protein 8.59 24183 A no similarity 6 BAC68371.1 Non-secretory protein CDS SAVERM_662 820334 819960 hypothetical protein 11.38 12896 A similar to unknown proteins 5 BAC68372.1 Non-secretory protein CDS SAVERM_663 820435 821349 sig6 putative RNA polymerase ECF-subfamily sigma factor similar to SCO0414, PF04542: Sigma-70 region 2 6.31 32640 A RNA initiation 3.5.1 BAC68373.1 Non-secretory protein CDS SAVERM_664 821389 822165 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 4.34 28174 A miscellaneous 4.7 BAC68374.1 Non-secretory protein CDS SAVERM_665 823653 822808 fabG1 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 5.98 29222 A metabolism of lipids 2.4 BAC68375.1 Non-secretory protein CDS SAVERM_666 824581 824426 hypothetical protein 6.8 5729 A no similarity 6 BAC68376.1 Non-secretory protein CDS SAVERM_667 826418 824979 putative oxidoreductase similar to dihydrolipoamide dehydrogenase, PF00070: Pyridine nucleotide-disulphide oxidoreductase 4.62 50823 A miscellaneous 4.7 BAC68377.1 Non-secretory protein CDS SAVERM_668 827309 826839 putative lyase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.72 17094 A miscellaneous 4.7 BAC68378.1 Non-secretory protein CDS SAVERM_669 827554 828144 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.86 20579 A regulation 3.5.2 BAC68379.1 Non-secretory protein CDS SAVERM_670 829534 828242 insA putative IS701 family ISFsp9-like transposase PF01609: Transposase DDE domain, IS701 family (830160..828223). Inverted repeat sequence (22/24 bp) 9.56 48599 A transposon & IS 4.5 BAC68380.1 Non-secretory protein CDS SAVERM_671 829572 830048 hypothetical protein PF02452: PemK-like protein, IS701 family (830160..828223). Inverted repeat sequence (22/24 bp) 4.78 16987 A no similarity 6 BAC68381.1 Non-secretory protein CDS SAVERM_672 830486 830860 hypothetical protein PF07820: TraC-like protein 4.66 13594 A no similarity 6 BAC68382.1 Non-secretory protein CDS SAVERM_673 830882 831715 hypothetical protein 4.24 31403 A similar to unknown proteins 5 BAC68383.1 Non-secretory protein CDS SAVERM_674 831803 832024 hypothetical protein 11.37 8161 A similar to unknown proteins 5 BAC68384.1 Non-secretory protein CDS SAVERM_675 833383 832592 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 11.69 27729 A regulation 3.5.2 BAC68385.1 Non-secretory protein CDS SAVERM_676 833510 834505 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.53 35192 A miscellaneous 4.7 BAC68386.1 Non-secretory protein CDS SAVERM_677 835604 834687 putative dehydrogenase PF03446: NAD binding domain of 6-phosphogluconate dehydrogenase 4.53 32088 A miscellaneous 4.7 BAC68387.1 Non-secretory protein CDS SAVERM_678 835665 836027 putative transcriptional regulator PF01638: Transcriptional regulator 6.35 13352 A regulation 3.5.2 BAC68388.1 Non-secretory protein CDS SAVERM_679 836553 836768 hypothetical protein 11.31 7458 A no similarity 6 BAC68389.1 Non-secretory protein CDS SAVERM_680 837091 837753 hypothetical protein 6.03 24359 A no similarity 6 BAC68390.1 Non-secretory protein CDS SAVERM_681 837899 838645 putative phosphotransferase PF01636: Phosphotransferase enzyme family 4.48 26601 A miscellaneous 4.7 BAC68391.1 Non-secretory protein CDS SAVERM_682 838882 838664 putative IS5 family ISBce20-like transposase IS5 family 11.9 8529 A miscellaneous 4.7 BAC68392.1 Non-secretory protein CDS SAVERM_683 839342 839061 putative IS5 family ISJp4-like transposase IS5 family 9.66 10042 A transposon & IS 4.5 BAC68393.1 Non-secretory protein CDS SAVERM_684 839665 839489 hypothetical protein 11.81 6656 A similar to unknown proteins 5 BAC68394.1 Non-secretory protein CDS SAVERM_685 840232 839801 hypothetical protein 11.85 15741 A similar to unknown proteins 5 BAC68395.1 Non-secretory protein CDS SAVERM_686 840508 840777 hypothetical protein 11.71 9193 A no similarity 6 BAC68396.1 Non-secretory protein CDS SAVERM_687 840896 841369 hypothetical protein PF03794: Domain of Unknown function 4.92 18258 A similar to unknown proteins 5 BAC68397.1 Non-secretory protein CDS SAVERM_688 842362 842616 hypothetical protein 10.19 9309 A similar to unknown proteins 5 BAC68398.1 Non-secretory protein CDS SAVERM_689 843443 842970 putative secreted protein 9.45 17901 A similar to unknown proteins 5 BAC68399.1 Signal peptide CDS SAVERM_690 843495 843770 putative IS5 family ISScl1-like transposase 9.94 10038 A transposon & IS 4.5 BAC68400.1 Non-secretory protein CDS SAVERM_691 844562 843915 hspR18_2 putative hsp18 transcriptional regulator 7.04 23009 A regulation 3.5.2 BAC68401.1 Non-secretory protein CDS SAVERM_692 844710 845141 hsp18_2 putative heat shock protein PF00011: Hsp20/alpha crystallin family 4.72 16196 A adaptation to atypical conditions 4.1 BAC68402.1 Non-secretory protein CDS SAVERM_693 847663 846848 hypothetical protein PF04871: Uso1 / p115 like vesicle tethering protein, C terminal region 4.45 30013 A similar to unknown proteins 5 BAC68403.1 Non-secretory protein CDS SAVERM_694 849155 848379 putative ABC transporter permease protein Tat substrate, PF01061: ABC-2 type transporter 9.54 27749 A transport / binding proteins & lipoproteins 1.2 BAC68404.1 Non-secretory protein CDS SAVERM_695 850117 849152 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.78 34011 A transport / binding proteins & lipoproteins 1.2 BAC68405.1 Non-secretory protein CDS SAVERM_696 850836 850165 hypothetical protein 6.12 22671 A similar to unknown proteins 5 BAC68406.1 Non-secretory protein CDS SAVERM_697 851082 851816 putative MarR-family transcriptional regulator PF01047: MarR family 9.01 26935 A regulation 3.5.2 BAC68407.1 Non-secretory protein CDS SAVERM_698 853549 851975 prpC1 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain 6.97 56431 A protein modification 3.8 BAC68408.1 Non-secretory protein CDS SAVERM_699 853859 854782 putative dehydrogenase PF00106: short chain dehydrogenase 10.38 32843 A miscellaneous 4.7 BAC68409.1 Non-secretory protein CDS SAVERM_700 854938 855585 sig7 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 7.19 23721 A RNA initiation 3.5.1 BAC68410.1 Non-secretory protein CDS SAVERM_701 855582 856205 hypothetical protein 8.49 22259 A no similarity 6 BAC68411.1 Non-secretory protein CDS SAVERM_702 856474 857739 putative acyltransferase PF01757: Acyltransferase family 10.43 45555 A miscellaneous 4.7 BAC68412.1 Non-secretory protein CDS SAVERM_703 858470 859033 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.33 20630 A miscellaneous 4.7 BAC68413.1 Non-secretory protein CDS SAVERM_704 859191 859688 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.33 18066 A miscellaneous 4.7 BAC68414.1 Non-secretory protein CDS SAVERM_705 860134 860766 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.93 21998 A regulation 3.5.2 BAC68415.1 Non-secretory protein CDS SAVERM_706 862141 861137 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.41 35020 A miscellaneous 4.7 BAC68416.1 Non-secretory protein CDS SAVERM_707 862846 862181 hypothetical protein PF03807: NADP oxidoreductase coenzyme F420-dependent 7.78 23219 A similar to unknown proteins 5 BAC68417.1 Non-secretory protein CDS SAVERM_708 863978 862995 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.84 34955 A miscellaneous 4.7 BAC68418.1 Non-secretory protein CDS SAVERM_709 864953 864552 hypothetical protein 4.63 14896 A no similarity 6 BAC68419.1 Non-secretory protein CDS SAVERM_710 865173 864970 hypothetical protein 4.91 7181 A no similarity 6 BAC68420.1 Non-secretory protein CDS SAVERM_711 865893 865372 putative transcriptional regulator PF01638: Transcriptional regulator 7.64 18819 A regulation 3.5.2 BAC68421.1 Non-secretory protein CDS SAVERM_712 866057 865902 hypothetical protein 10.99 5668 A no similarity 6 BAC68422.1 Non-secretory protein CDS SAVERM_713 866511 866302 putative IS5 family IS112-like transposase truncated 11.03 7728 A miscellaneous 4.7 BAC68423.1 Non-secretory protein CDS SAVERM_714 867341 866655 putative phosphatase 4.77 24772 A miscellaneous 4.7 BAC68424.1 Non-secretory protein CDS SAVERM_715 868694 867789 hypothetical protein PF00058: Low-density lipoprotein receptor repeat class B 4.65 32546 A similar to unknown proteins 5 BAC68425.1 Non-secretory protein CDS SAVERM_716 869677 868691 fadC6 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 4.89 35059 A metabolism of lipids 2.4 BAC68426.1 Non-secretory protein CDS SAVERM_717 870525 869743 echA3 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.42 27138 A metabolism of lipids 2.4 BAC68427.1 Non-secretory protein CDS SAVERM_718 871754 870522 putative fatty acid-CoA racemase PF02515: CoA-transferase family III 4.81 43719 A metabolism of lipids 2.4 BAC68428.1 Non-secretory protein CDS SAVERM_719 873001 871760 gcdH1 putative glutaryl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.2 45306 A metabolism of lipids 2.4 BAC68429.1 Non-secretory protein CDS SAVERM_720 873180 873584 putative IS5 family IS1648-like transposase truncated 10.24 14722 A miscellaneous 4.7 BAC68430.1 Non-secretory protein CDS SAVERM_721 873907 873611 putative hydrolase 4.78 10646 A miscellaneous 4.7 BAC68431.1 Non-secretory protein CDS SAVERM_722 875568 875810 putative AraC-family transcriptional regulator truncated 11.16 9083 A miscellaneous 4.7 BAC68432.1 Non-secretory protein CDS SAVERM_723 875850 876020 hypothetical protein 10.1 6227 A similar to unknown proteins 5 BAC68433.1 Non-secretory protein CDS SAVERM_724 876545 877597 putative dehydrogenase PF00106: short chain dehydrogenase 10.64 37182 A miscellaneous 4.7 BAC68434.1 Non-secretory protein CDS SAVERM_725 878420 877599 hypothetical protein 11.84 29246 A no similarity 6 BAC68435.1 Non-secretory protein CDS SAVERM_726 879468 878482 putative oxidoreductase 6.87 35282 A miscellaneous 4.7 BAC68436.1 Non-secretory protein CDS SAVERM_727 881234 880629 hypothetical protein 7.06 22371 A no similarity 6 BAC68437.1 Non-secretory protein CDS SAVERM_728 881442 881179 hypothetical protein 4.79 9370 A similar to unknown proteins 5 BAC68438.1 Non-secretory protein CDS SAVERM_729 882500 881547 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.97 33592 A regulation 3.5.2 BAC68439.1 Non-secretory protein CDS SAVERM_730 882605 883498 hypothetical protein PF01073: 3-beta hydroxysteroid dehydrogenase/isomerase family 4.64 31168 A similar to unknown proteins 5 BAC68440.1 Non-secretory protein CDS SAVERM_731 883572 883937 hypothetical protein 4.14 13951 A similar to unknown proteins 5 BAC68441.1 Non-secretory protein CDS SAVERM_732 884059 884292 hypothetical protein 11.63 7956 A no similarity 6 BAC68442.1 Signal peptide CDS SAVERM_733 885191 884559 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 7.67 21659 A similar to unknown proteins 5 BAC68443.1 Non-secretory protein CDS SAVERM_734 885591 887036 putative protease, secreted PF03572: Peptidase family S41B 9.29 52346 A protein modification 3.8 BAC68444.1 Signal peptide CDS SAVERM_735 887118 887300 hypothetical protein 6.77 6801 A no similarity 6 BAC68445.1 Non-secretory protein CDS SAVERM_736 887475 887681 putative transcriptional regulator PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 11.85 8163 A regulation 3.5.2 BAC68446.1 Non-secretory protein CDS SAVERM_737 888492 887698 putative 2-haloalkanoic acid dehalogenase PF00702: haloacid dehalogenase-like hydrolase 4.99 28541 A detoxification 4.2 BAC68447.1 Non-secretory protein CDS SAVERM_738 888812 888636 hypothetical protein PF05532: CsbD-like 10.59 5989 A similar to unknown proteins 5 BAC68448.1 Non-secretory protein CDS SAVERM_739 888992 889162 putative membrane protein 12.52 6262 A miscellaneous 4.7 BAC68449.1 Non-secretory protein CDS SAVERM_740 889498 889851 hypothetical protein PF05239: PRC-barrel domain 5.9 12958 A similar to unknown proteins 5 BAC68450.1 Non-secretory protein CDS SAVERM_741 890067 890906 sig8 putative RNA polymerase sigma factor similar to SCO0600:sigJ, RNA polymerase alternative sigma factor, PF04545: Sigma-70, region 4 4.65 31454 A RNA initiation 3.5.1 BAC68451.1 Non-secretory protein CDS SAVERM_742 891284 892279 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, araC family 7.91 36936 A regulation 3.5.2 BAC68452.1 Non-secretory protein CDS SAVERM_743 892951 893352 putative peptidase inhibitor, secreted PF03995: Peptidase inhibitor family I36 4.84 14134 A protein modification 3.8 BAC68453.1 Signal peptide CDS SAVERM_744 893903 893346 putative IS630 family ISSod10-like transposase IS630 family (894501..893349) Inverted repeat sequence (23/25 bp). Target sequence (TA); Translation will be controlled by frameshit with SAV745. Completely same as SAV7569. 11.59 21298 A transposon & IS 4.5 BAC68454.1 Non-secretory protein CDS SAVERM_745 894439 893900 putative IS630 family IS885-like transposase IS630 family (894501..893349) Inverted repeat sequence (23/25 bp). Target sequence (TA). 11.6 20628 A transposon & IS 4.5 BAC68455.1 Non-secretory protein CDS SAVERM_746 894729 895703 hypothetical protein 5.93 33855 A no similarity 6 BAC68456.1 Non-secretory protein CDS SAVERM_747 896150 897283 hypothetical protein 4.99 41307 A no similarity 6 BAC68457.1 Non-secretory protein CDS SAVERM_748 897643 899004 putative secreted protein PF01569: PAP2 superfamily 7.9 48071 A similar to unknown proteins 5 BAC68458.1 Signal peptide CDS SAVERM_749 899828 899196 putative methyltransferase 8.27 22019 A miscellaneous 4.7 BAC68459.1 Non-secretory protein CDS SAVERM_750 900012 900425 putative transcriptional regulator 8.54 14097 A regulation 3.5.2 BAC68460.1 Non-secretory protein CDS SAVERM_751 901504 902592 putative carboxylase-amine ligase PF04107: Glutamate-cysteine ligase family 2(GCS2) 4.99 39793 A similar to unknown proteins 5 BAC68461.1 Non-secretory protein CDS SAVERM_752 903400 903011 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.31 13972 A similar to unknown proteins 5 BAC68462.1 Non-secretory protein CDS SAVERM_753 903648 903457 hypothetical protein 12.06 7131 A no similarity 6 BAC68463.1 Non-secretory protein CDS SAVERM_754 903755 904408 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.43 23420 A regulation 3.5.2 BAC68464.1 Non-secretory protein CDS SAVERM_755 904587 905627 putative dehydrogenase PF00106: short chain dehydrogenase 11.38 36314 A miscellaneous 4.7 BAC68465.1 Signal peptide CDS SAVERM_756 908071 906101 putative secreted protein PF02254: TrkA-N domain 6.39 69750 A similar to unknown proteins 5 BAC68466.1 Non-secretory protein CDS SAVERM_757 909086 910072 putative secreted protein PF03734: ErfK/YbiS/YcfS/YnhG 9.87 34385 A similar to unknown proteins 5 BAC68467.1 Signal peptide CDS SAVERM_758 911494 910889 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 9.15 22515 A miscellaneous 4.7 BAC68468.1 Non-secretory protein CDS SAVERM_759 911580 912161 hypothetical protein 11.35 21237 A similar to unknown proteins 5 BAC68469.1 Non-secretory protein CDS SAVERM_760 912768 912097 putative multicopper oxidase PF00394: Multicopper oxidase 7.66 25333 A miscellaneous 4.7 BAC68470.1 Non-secretory protein CDS SAVERM_761 912968 912621 hypothetical protein 11.86 12711 A no similarity 6 BAC68471.1 Non-secretory protein CDS SAVERM_762 913425 914252 putative methyltransferase PF08241: Methyltransferase domain 5.12 28958 A miscellaneous 4.7 BAC68472.1 Non-secretory protein CDS SAVERM_763 914658 914353 hypothetical protein 10.77 10948 A similar to unknown proteins 5 BAC68473.1 Non-secretory protein CDS SAVERM_764 915531 914734 putative secreted protein 11.92 27414 A similar to unknown proteins 5 BAC68474.1 Non-secretory protein CDS SAVERM_765 915750 915541 putative secreted protein 12.63 7432 A similar to unknown proteins 5 BAC68475.1 Non-secretory protein CDS SAVERM_766 915952 916188 hypothetical protein 7.53 8172 A no similarity 6 BAC68476.1 Non-secretory protein CDS SAVERM_767 918416 916344 prpJ2 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain, PF01590: GAF domain 5.03 72357 A protein modification 3.8 BAC68477.1 Non-secretory protein CDS SAVERM_768 918676 919065 hypothetical protein 11.78 13354 A similar to unknown proteins 5 BAC68478.1 Non-secretory protein CDS SAVERM_769 919888 919505 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.22 13654 A similar to unknown proteins 5 BAC68479.1 Non-secretory protein CDS SAVERM_770 921387 920542 putative dehydrogenase PF00106: short chain dehydrogenase 4.42 29680 A miscellaneous 4.7 BAC68480.1 Non-secretory protein CDS SAVERM_771 921494 922408 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.73 32712 A regulation 3.5.2 BAC68481.1 Non-secretory protein CDS SAVERM_772 922928 922521 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 11.65 14719 A regulation 3.5.2 BAC68482.1 Non-secretory protein CDS SAVERM_773 923590 922853 hypothetical protein PF01212: Beta-eliminating lyase 6.18 27433 A similar to unknown proteins 5 BAC68483.1 Non-secretory protein CDS SAVERM_774 925370 923778 putative monooxygenase PF01360: Monooxygenase 5.35 55993 A miscellaneous 4.7 BAC68484.1 Non-secretory protein CDS SAVERM_775 925541 926167 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.53 22730 A regulation 3.5.2 BAC68485.1 Non-secretory protein CDS SAVERM_776 926516 926268 hypothetical protein 8.5 8536 A similar to unknown proteins 5 BAC68486.1 Non-secretory protein CDS SAVERM_777 927077 926586 hypothetical protein 9.1 17611 A similar to unknown proteins 5 BAC68487.1 Non-secretory protein CDS SAVERM_778 927524 928555 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 4.76 36785 A similar to unknown proteins 5 BAC68488.1 Non-secretory protein CDS SAVERM_779 928799 928972 putative Tn3 family ISXc5-like transposase truncated 9.49 6454 A transposon & IS 4.5 BAC68489.1 Non-secretory protein CDS SAVERM_780 930075 929152 putative monooxygenase PF00296: Luciferase-like monooxygenase 5.61 31955 A miscellaneous 4.7 BAC68490.1 Non-secretory protein CDS SAVERM_781 930473 930895 putative secreted protein PF07681: DoxX 11.99 14168 A no similarity 6 BAC68491.1 Signal peptide CDS SAVERM_782 931179 930904 hypothetical protein 11.99 9926 A no similarity 6 BAC68492.1 Non-secretory protein CDS SAVERM_783 931759 932133 hypothetical protein 12.98 14014 A similar to unknown proteins 5 BAC68493.1 Non-secretory protein CDS SAVERM_784 932225 932773 hypothetical protein 3.09 18706 A similar to unknown proteins 5 BAC68494.1 Non-secretory protein CDS SAVERM_785 934714 934229 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.04 17595 A similar to unknown proteins 5 BAC68495.1 Non-secretory protein CDS SAVERM_786 938727 935953 prpJ3 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; membrane protein 5.03 98760 A protein modification 3.8 BAC68496.1 Non-secretory protein CDS SAVERM_787 939773 939117 hypothetical protein PF07931: Chloramphenicol phosphotransferase-like protein 6.34 24099 A similar to unknown proteins 5 BAC68497.1 Non-secretory protein CDS SAVERM_788 940638 940165 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 4.89 16781 A similar to unknown proteins 5 BAC68498.1 Non-secretory protein CDS SAVERM_789 942349 940910 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.76 51038 A specific pathways 2.1.1 BAC68499.1 Non-secretory protein CDS SAVERM_790 942767 942366 hypothetical protein PF08332: Calcium/calmodulin dependent protein kinase II Association 4.44 14720 A similar to unknown proteins 5 BAC68500.1 Non-secretory protein CDS SAVERM_791 944381 942846 putative cytosine/uracil/thiamine/allantoin permease PF02133: Permease for cytosine/purines, uracil, thiamine, allantoin 8.29 53851 A transport / binding proteins & lipoproteins 1.2 BAC68501.1 Non-secretory protein CDS SAVERM_792 944545 945936 putative transcriptional regulator PF07905: Purine catabolism regulatory protein-like family 5.58 49721 A regulation 3.5.2 BAC68502.1 Non-secretory protein CDS SAVERM_793 946221 946775 putative membrane protein PF07681: DoxX 10.72 18293 A miscellaneous 4.7 BAC68503.1 Non-secretory protein CDS SAVERM_794 947036 948439 putative amino acid transporter PF00324: Amino acid permease 9.79 48474 A transport / binding proteins & lipoproteins 1.2 BAC68504.1 Non-secretory protein CDS SAVERM_795 949270 948548 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.38 26327 A similar to unknown proteins 5 BAC68505.1 Non-secretory protein CDS SAVERM_796 950035 949418 hypothetical protein 9.75 22390 A similar to unknown proteins 5 BAC68506.1 Non-secretory protein CDS SAVERM_797 950984 950601 hypothetical protein 5.09 13542 A no similarity 6 BAC68507.1 Non-secretory protein CDS SAVERM_798 951585 950995 hypothetical protein 12.81 19940 A similar to unknown proteins 5 BAC68508.1 Non-secretory protein CDS SAVERM_799 951881 951567 hypothetical protein 11.56 10633 A similar to unknown proteins 5 BAC68509.1 Non-secretory protein CDS SAVERM_800 951882 952160 hypothetical protein 4.77 9676 A similar to unknown proteins 5 BAC68510.1 Non-secretory protein CDS SAVERM_801 952657 954111 argG1 putative argininosuccinate synthase PF00764: Arginosuccinate synthase 4.62 52648 A metabolism of amino acids & related molecules 2.2 BAC68511.1 Non-secretory protein CDS SAVERM_802 954464 955318 putative alginate lyase PF08787: Alginate lyase 8.86 29447 A similar to unknown proteins 5 BAC68512.1 Signal peptide CDS SAVERM_803 957277 955607 pgmA putative phosphoglucomutase PF02878: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 4.69 58427 A main glycolytic pathways 2.1.2 BAC68513.1 Non-secretory protein CDS SAVERM_804 958059 957808 putative secreted protein 5.47 8219 A no similarity 6 BAC68514.1 Signal peptide CDS SAVERM_805 958262 958134 hypothetical protein PF00098: Zinc knuckle 12.07 4550 A no similarity 6 BAC68515.1 Non-secretory protein CDS SAVERM_806 958610 960352 hypothetical protein PF00515: TRP domain 5 63917 A similar to unknown proteins 5 BAC68516.1 Non-secretory protein CDS SAVERM_807 960571 960810 hypothetical protein PF01381: Helix-turn-helix 7.72 8491 A no similarity 6 BAC68517.1 Non-secretory protein CDS SAVERM_808 962355 961036 prpC2 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain 4.6 47791 A protein modification 3.8 BAC68518.1 Non-secretory protein CDS SAVERM_809 963100 962573 sig9 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 11.13 19141 A RNA initiation 3.5.1 BAC68519.1 Non-secretory protein CDS SAVERM_810 964286 963156 putative dehydrogenase PF00070: Pyridine nucleotide-disulphide oxidoreductase 9.81 39115 A miscellaneous 4.7 BAC68520.1 Non-secretory protein CDS SAVERM_811 964678 964283 hypothetical protein PF05239: PRC-barrel domain 6.24 14440 A similar to unknown proteins 5 BAC68521.1 Non-secretory protein CDS SAVERM_812 965100 964891 putative small hydrophilic protein 10.91 7511 A miscellaneous 4.7 BAC68522.1 Non-secretory protein CDS SAVERM_813 965661 965305 hypothetical protein PF05239: PRC-barrel domain 5.61 13009 A similar to unknown proteins 5 BAC68523.1 Non-secretory protein CDS SAVERM_814 966421 966143 putative secreted protein 11.36 10888 A no similarity 6 BAC68524.1 Non-secretory protein CDS SAVERM_815 967134 967313 hypothetical protein 12.9 6569 A similar to unknown proteins 5 BAC68525.1 Non-secretory protein CDS SAVERM_816 967424 967597 hypothetical protein PF05532: CsbD-like 12.25 6543 A similar to unknown proteins 5 BAC68526.1 Non-secretory protein CDS SAVERM_817 968503 968219 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 4.29 10013 A similar to unknown proteins 5 BAC68527.1 Non-secretory protein CDS SAVERM_818 968939 970015 hypothetical protein PF01636: Phosphotransferase enzyme family 6.59 39250 A similar to unknown proteins 5 BAC68528.1 Non-secretory protein CDS SAVERM_819 970221 971444 putative hydrolase PF03403: Platelet-activating factor acetylhydrolase, plasma/intracellular isoform II 6.69 44611 A miscellaneous 4.7 BAC68529.1 Signal peptide CDS SAVERM_820 972096 971806 hypothetical protein 6.08 10610 A no similarity 6 BAC68530.1 Non-secretory protein CDS SAVERM_821 972629 972201 putative IS200/IS605 family ISFsp4-like transposase IS200/IS605 family 8.48 16138 A transposon & IS 4.5 BAC68531.1 Non-secretory protein CDS SAVERM_822 972680 973894 putative IS200/IS605 family ISMma22-like transposase IS200/IS605 family 11.33 44747 A transposon & IS 4.5 BAC68532.1 Non-secretory protein CDS SAVERM_823 974766 974221 hypothetical protein 4.16 20149 A no similarity 6 BAC68533.1 Non-secretory protein CDS SAVERM_824 975546 975818 hypothetical protein 12.39 9816 A no similarity 6 BAC68534.1 Non-secretory protein CDS SAVERM_825 977037 976138 aph1 putative aminoglycoside phosphotransferase PF01636: Phosphotransferase enzyme family 4.67 32218 A detoxification 4.2 BAC68535.1 Non-secretory protein CDS SAVERM_826 977664 977461 cspD1 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.56 7187 A adaptation to atypical conditions 4.1 BAC68536.1 Non-secretory protein CDS SAVERM_827 978292 979311 fabH6 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 4.34 36029 A metabolism of lipids 2.4 BAC68537.1 Non-secretory protein CDS SAVERM_828 982674 979582 putative rhamnosidase PF05592: Bacterial alpha-L-rhamnosidase 6.29 111885 A specific pathways 2.1.1 BAC68538.1 Non-secretory protein CDS SAVERM_829 983523 983146 hypothetical protein 6.09 13746 A similar to unknown proteins 5 BAC68539.1 Non-secretory protein CDS SAVERM_830 983747 983523 hypothetical protein 4.63 8183 A similar to unknown proteins 5 BAC68540.1 Non-secretory protein CDS SAVERM_831 984960 983914 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.9 37983 A regulation 3.5.2 BAC68541.1 Non-secretory protein CDS SAVERM_832 985991 984957 putative oxidoreductase, GFO/IDH/MOCA-family protein PF01408: Oxidoreductase family, NAD-binding Rossmann fold 6.39 36781 A miscellaneous 4.7 BAC68542.1 Non-secretory protein CDS SAVERM_833 986839 985988 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 6.04 31177 A miscellaneous 4.7 BAC68543.1 Non-secretory protein CDS SAVERM_834 988160 986811 putative aminotransferase PF01041: DegT/DnrJ/EryC1/StrS aminotransferase family 6.63 48544 A regulation 3.5.2 BAC68544.1 Non-secretory protein CDS SAVERM_835 989314 988169 putative glycosyltransferase PF00535: Glycosyl transferase 4.94 43243 A specific pathways 2.1.1 BAC68545.1 Non-secretory protein CDS SAVERM_836 990832 989357 matE putative efflux family protein PF01554: MatE 11.48 52548 A transport / binding proteins & lipoproteins 1.2 BAC68546.1 Non-secretory protein CDS SAVERM_837 991487 991134 putative NADH:FMN oxidoreductase PF01613: Flavin reductase like domain 9.37 12107 A miscellaneous 4.7 BAC68547.1 Non-secretory protein CDS SAVERM_838 992719 991484 cyp4 putative cytochrome P450 CYP178A1, nrps7 gene cluster 5.94 45385 A metabolism of coenzymes & prosthetic groups 2.5 BAC68548.1 Non-secretory protein CDS SAVERM_839 994536 992728 nrps7-1 putative non-ribosomal peptide synthetase nrps7 gene cluster 6.42 64998 A antibiotic production 4.3 BAC68549.1 Non-secretory protein CDS SAVERM_840 995348 994545 putative thioesterase nrps7 gene cluster, PF00975: Thioesterase domain 7.11 29158 A antibiotic production 4.3 BAC68550.1 Non-secretory protein CDS SAVERM_841 996217 995480 putative ThiG homolog nrps7 gene cluster, PF05690: Thiazole biosynthesis protein ThiG 4.68 25754 A miscellaneous 4.7 BAC68551.1 Non-secretory protein CDS SAVERM_842 997125 996214 ilvE2 putative branched-chain amino acid aminotransferase nrps7 gene cluster, PF01063: Aminotransferase class IV 6.41 32632 A metabolism of amino acids & related molecules 2.2 BAC68552.1 Non-secretory protein CDS SAVERM_843 997847 997152 putative thioesterase nrps7 gene cluster, PF00975: Thioesterase domain 5.54 24178 A antibiotic production 4.3 BAC68553.1 Non-secretory protein CDS SAVERM_844 999166 997877 nrps7-2 putative non-ribosomal peptide synthetase nrps7 gene cluster 5.77 46539 A antibiotic production 4.3 BAC68554.1 Non-secretory protein CDS SAVERM_845 1002321 999163 putative modular polyketide synthase nrps7 gene cluster 4.87 112669 A antibiotic production 4.3 BAC68555.1 Non-secretory protein CDS SAVERM_846 1004011 1002287 nrps7-3 putative non-ribosomal peptide synthetase nrps7 gene cluster 5.3 61481 A antibiotic production 4.3 BAC68556.1 Non-secretory protein CDS SAVERM_847 1007462 1004016 nrps7-4 putative non-ribosomal peptide synthetase nrps7 gene cluster 5.56 122786 A antibiotic production 4.3 BAC68557.1 Non-secretory protein CDS SAVERM_848 1009384 1007459 nrps7-5 putative non-ribosomal peptide synthetase nrps7 gene cluster 7.48 67660 A antibiotic production 4.3 BAC68558.1 Non-secretory protein CDS SAVERM_849 1011063 1009432 putative methyltransferase nrps7 gene cluster, PF04055: Radical SAM superfamily 4.71 60334 A miscellaneous 4.7 BAC68559.1 Non-secretory protein CDS SAVERM_850 1012883 1013704 hypothetical protein nrps7 gene cluster 7.42 29294 A similar to unknown proteins 5 BAC68560.1 Non-secretory protein CDS SAVERM_851 1013968 1013750 putative MbtH-like protein nrps7 gene cluster, PF03621: MbtH-like protein 4.16 7986 A miscellaneous 4.7 BAC68561.1 Non-secretory protein CDS SAVERM_852 1015736 1014084 nrps7-6 putative non-ribosomal peptide synthetase nrps7 gene cluster 4.66 60355 A antibiotic production 4.3 BAC68562.1 Non-secretory protein CDS SAVERM_853 1017331 1015739 nrps7-7 putative non-ribosomal peptide synthetase nrps7 gene cluster 6.17 57147 A antibiotic production 4.3 BAC68563.1 Non-secretory protein CDS SAVERM_854 1019550 1017328 putative amidase nrps7 gene cluster, PF01804: Penicillin amidase 6.76 78839 A miscellaneous 4.7 BAC68564.1 Non-secretory protein CDS SAVERM_855 1021202 1019547 nrps7-8 putative non-ribosomal peptide synthetase nrps7 gene cluster 6.11 59105 A antibiotic production 4.3 BAC68565.1 Non-secretory protein CDS SAVERM_856 1022031 1021234 putative thioesterase nrps7 gene cluster, PF00975: Thioesterase domain 5.81 28688 A antibiotic production 4.3 BAC68566.1 Non-secretory protein CDS SAVERM_857 1023063 1024484 nrps7-9 putative non-ribosomal peptide synthetase nrps7 gene cluster 6.73 51332 A antibiotic production 4.3 BAC68567.1 Non-secretory protein CDS SAVERM_858 1024676 1024900 hypothetical protein nrps7 gene cluster 5.01 8028 A no similarity 6 BAC68568.1 Non-secretory protein CDS SAVERM_859 1025128 1026513 nrps7-10 putative non-ribosomal peptide synthetase nrps7 gene cluster 4.96 50103 A antibiotic production 4.3 BAC68569.1 Non-secretory protein CDS SAVERM_860 1026551 1028176 nrps7-11 putative non-ribosomal peptide synthetase nrps7 gene cluster 4.92 59797 A antibiotic production 4.3 BAC68570.1 Non-secretory protein CDS SAVERM_861 1028236 1029129 putative reductase nrps7 gene cluster, PF00070: Pyridine nucleotide-disulphide oxidoreductase 4.8 31755 A miscellaneous 4.7 BAC68571.1 Non-secretory protein CDS SAVERM_862 1031103 1029133 hypothetical protein nrps7 gene cluster 5.91 69044 A similar to unknown proteins 5 BAC68572.1 Non-secretory protein CDS SAVERM_863 1032413 1031106 hypothetical protein nrps7 gene cluster 5.54 46142 A similar to unknown proteins 5 BAC68573.1 Non-secretory protein CDS SAVERM_864 1032669 1032421 putative peptide carrier protein nrps7 gene cluster, PF00550: Phosphopantetheine attachment site 4.72 9210 A protein secretion 1.6 BAC68574.1 Non-secretory protein CDS SAVERM_865 1035416 1032666 nrps7-12 putative non-ribosomal peptide synthetase nrps7 gene cluster 5.05 98886 A antibiotic production 4.3 BAC68575.1 Non-secretory protein CDS SAVERM_866 1035992 1035525 hypothetical protein nrps7 gene cluster 6.63 17088 A similar to unknown proteins 5 BAC68576.1 Non-secretory protein CDS SAVERM_867 1036695 1038659 putative ABC transporter ATP-binding protein nrps7 gene cluster, PF00005: ABC transporter 8.13 68412 A transport / binding proteins & lipoproteins 1.2 BAC68577.1 Non-secretory protein CDS SAVERM_868 1038659 1040461 putative ABC transporter ATP-binding protein nrps7 gene cluster, PF00005: ABC transporter 8.95 63713 A transport / binding proteins & lipoproteins 1.2 BAC68578.1 Non-secretory protein CDS SAVERM_869 1040665 1042269 nrps7-13 putative non-ribosomal peptide synthetase nrps7 gene cluster 7.9 57107 A antibiotic production 4.3 BAC68579.1 Non-secretory protein CDS SAVERM_870 1042274 1042495 hypothetical protein 3.7 8003 A no similarity 6 BAC68580.1 Non-secretory protein CDS SAVERM_871 1042499 1043434 putative Fe(II)/alpha-ketoglutarate dependent hydroxylase PF05721: Phytanoyl-CoA dioxygenase (PhyH) 4.89 35796 A miscellaneous 4.7 BAC68581.1 Non-secretory protein CDS SAVERM_872 1043718 1044683 putative oxidoreductase PF00248: Aldo/keto reductase family 6.26 34005 A miscellaneous 4.7 BAC68582.1 Non-secretory protein CDS SAVERM_873 1045295 1044960 hypothetical protein PF03621: MbtH-like protein 11.99 12688 A no similarity 6 BAC68583.1 Non-secretory protein CDS SAVERM_874 1045629 1047416 putative solute-binding dependent transport lipoprotein PF00497: Bacterial extracellular solute-binding proteins, family 3 5.3 64606 A transport / binding proteins & lipoproteins 1.2 BAC68584.1 Non-secretory protein CDS SAVERM_875 1048737 1047772 pip putative proline iminopeptidase PF00561: alpha/beta hydrolase fold 5.23 35370 A protein modification 3.8 BAC68585.1 Non-secretory protein CDS SAVERM_876 1049165 1049596 hypothetical protein PF07366: SnoaL-like polyketide cyclase 6.42 16102 A similar to unknown proteins 5 BAC68586.1 Non-secretory protein CDS SAVERM_877 1050455 1050985 cpt putative chloramphenicol 3-O phosphotransferase similar to Cpt(Q56148) chloramphenicol-producing Streptomyces venezuelae. Streptomyces coelicolor A3(2) has different resistance mechanism (probably efflux, CmlR), PF07931: Chloramphenicol phosphotransferase-like protein 4.58 18554 A transport / binding proteins & lipoproteins 1.2 BAC68587.1 Non-secretory protein CDS SAVERM_878 1051615 1052112 hypothetical protein PF00190: Cupin doamin, 100% same as SAV465 4.63 18175 A similar to unknown proteins 5 BAC68588.1 Non-secretory protein CDS SAVERM_879 1053874 1052915 ku2 putative Ku70/Ku80 protein probably involving non-homologous end-joining, PF02735: Ku70/Ku80 beta-barrel domain 6.27 35797 A DNA modification & repair 3.2 BAC68589.1 Non-secretory protein CDS SAVERM_880 1054536 1054267 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.26 9933 A regulation 3.5.2 BAC68590.1 Non-secretory protein CDS SAVERM_881 1054718 1055842 putative monooxygenase PF01360: Monooxygenase 4.6 40255 A miscellaneous 4.7 BAC68591.1 Non-secretory protein CDS SAVERM_882 1056786 1056028 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.26 27349 A regulation 3.5.2 BAC68592.1 Non-secretory protein CDS SAVERM_883 1056846 1057706 hypothetical protein PF01113: Dihydrodipicolinate reductase, N-terminus 5.36 30633 A similar to unknown proteins 5 BAC68593.1 Non-secretory protein CDS SAVERM_884 1057857 1058840 putative IS481 family ISAni1-like transposase PF00665: Integrase core domain 10.86 37273 A transposon & IS 4.5 BAC68594.1 Non-secretory protein CDS SAVERM_885 1059494 1059823 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 4.73 12201 A similar to unknown proteins 5 BAC68595.1 Non-secretory protein CDS SAVERM_886 1060657 1060061 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 5.73 21365 A similar to unknown proteins 5 BAC68596.1 Non-secretory protein CDS SAVERM_887 1061121 1065185 putative glycosyl hydrolase, secreted Tat substrate, PF00754: F5/8 type C domain 6.44 148432 A specific pathways 2.1.1 BAC68597.1 Signal peptide CDS SAVERM_888 1066835 1065315 putative hydrolase PF00561: alpha/beta hydrolase fold 7.75 54613 A miscellaneous 4.7 BAC68598.1 Non-secretory protein CDS SAVERM_889 1067280 1066921 hypothetical protein PF00877: NlpC/P60 family 5.02 12666 A similar to unknown proteins 5 BAC68599.1 Non-secretory protein CDS SAVERM_890 1067692 1069515 hypothetical protein 6.4 66781 A similar to unknown proteins 5 BAC68600.1 Non-secretory protein CDS SAVERM_891 1070419 1069805 putative quaternary amine transporter PF03596: Cadmium resistance transporter 7.61 21195 A transport / binding proteins & lipoproteins 1.2 BAC68601.1 Non-secretory protein CDS SAVERM_892 1071018 1070683 hypothetical protein 7.95 11862 A no similarity 6 BAC68602.1 Non-secretory protein CDS SAVERM_893 1071857 1071654 cspD2 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.54 7208 A adaptation to atypical conditions 4.1 BAC68603.1 Non-secretory protein CDS SAVERM_894 1072856 1072353 hypothetical protein PF08271: TFIIB zinc-binding 11.73 18307 A no similarity 6 BAC68604.1 Non-secretory protein CDS SAVERM_895 1073465 1073232 hypothetical protein 5.79 8184 A no similarity 6 BAC68605.1 Non-secretory protein CDS SAVERM_896 1074296 1074871 terD1 putative tellurium resistance protein PF02342: Bacterial stress protein 4.23 20108 A detoxification 4.2 BAC68606.1 Non-secretory protein CDS SAVERM_897 1075406 1075047 putative secreted alpha-amylase inhibitor PF01356: Alpha amylase inhibitor 7.13 12552 A protein modification 3.8 BAC68607.1 Signal peptide CDS SAVERM_898 1077479 1076865 sig10 putative RNA polymerase ECF-subfamily sigma factor similar to SCO0866, PF04542: Sigma-70 region 2 5.31 21878 A RNA initiation 3.5.1 BAC68608.1 Non-secretory protein CDS SAVERM_899 1078340 1077654 putative secreted protein 11.63 23478 A similar to unknown proteins 5 BAC68609.1 Signal peptide CDS SAVERM_900 1079067 1078669 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.61 14635 A similar to unknown proteins 5 BAC68610.1 Non-secretory protein CDS SAVERM_901 1079174 1080226 putative transcriptional regulator PF08279: HTH domain 8.84 37489 A regulation 3.5.2 BAC68611.1 Non-secretory protein CDS SAVERM_902 1080407 1080958 hypothetical protein PF01636: Phosphotransferase enzyme family 7.06 19317 A similar to unknown proteins 5 BAC68612.1 Non-secretory protein CDS SAVERM_903 1081464 1082558 putative membrane protein 6.59 39481 A miscellaneous 4.7 BAC68613.1 Non-secretory protein CDS SAVERM_904 1082866 1083876 putative oxidoreductase PF00248: Aldo/keto reductase family 4.95 37025 A miscellaneous 4.7 BAC68614.1 Non-secretory protein CDS SAVERM_905 1084959 1084639 hypothetical protein 6.24 11365 A similar to unknown proteins 5 BAC68615.1 Non-secretory protein CDS SAVERM_906 1086564 1085023 putative tripeptidyl-peptidase C, secreted PF08386: TAP-like protein 6.86 54630 A protein modification 3.8 BAC68616.1 Non-secretory protein CDS SAVERM_907 1087349 1086726 hypothetical protein 7.5 23409 A no similarity 6 BAC68617.1 Non-secretory protein CDS SAVERM_908 1087677 1088615 putative dehydrogenase PF01073: 3-beta hydroxysteroid dehydrogenase/isomerase family 6.8 33506 A miscellaneous 4.7 BAC68618.1 Non-secretory protein CDS SAVERM_909 1088612 1089535 sig11 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 4.86 34199 A RNA initiation 3.5.1 BAC68619.1 Non-secretory protein CDS SAVERM_910 1089696 1090277 putative reductase PF03358: NADPH-dependent FMN reductase 5.01 20743 A miscellaneous 4.7 BAC68620.1 Non-secretory protein CDS SAVERM_911 1090528 1091295 putative dehydrogenase PF00106: short chain dehydrogenase 5.24 26250 A metabolism of lipids 2.4 BAC68621.1 Non-secretory protein CDS SAVERM_912 1092819 1091689 pcpB putative pentachlorophenol 4-monooxygenase PF01360: Monooxygenase 6.9 39821 A miscellaneous 4.7 BAC68622.1 Non-secretory protein CDS SAVERM_913 1092937 1093518 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.75 20924 A regulation 3.5.2 BAC68623.1 Non-secretory protein CDS SAVERM_914 1093703 1094287 hypothetical protein PF00582: Universal stress protein family 9.89 20376 A similar to unknown proteins 5 BAC68624.1 Non-secretory protein CDS SAVERM_915 1094554 1094970 hypothetical protein 9.6 14453 A no similarity 6 BAC68625.1 Non-secretory protein CDS SAVERM_916 1094980 1096380 lysA2 putative diaminopimelate decarboxylase PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain 7.81 49212 A metabolism of amino acids & related molecules 2.2 BAC68626.1 Non-secretory protein CDS SAVERM_917 1097768 1097100 kdpC putative potassium-transporting ATPase subunit C PF02669: K+-transporting ATPase, c chain 5.66 23488 A transport / binding proteins & lipoproteins 1.2 BAC68627.1 Non-secretory protein CDS SAVERM_918 1099877 1097793 kdpB putative potassium-transporting ATPase subunit B PF00122: E1-E2 ATPase 4.87 73117 A transport / binding proteins & lipoproteins 1.2 BAC68628.1 Non-secretory protein CDS SAVERM_919 1101631 1099967 kdpA putative potassium-transporting ATPase subunit A PF03814: Potassium-transporting ATPase A subunit 9.1 58114 A transport / binding proteins & lipoproteins 1.2 BAC68629.1 Non-secretory protein CDS SAVERM_7583 1101729 1101640 kdpF putative potassium-transporting ATPase subunit F PF09604: F subunit of K+-transporting ATPase (Potass_KdpF) 4.26 3130 A transport / binding proteins & lipoproteins 1.2 Non-secretory protein CDS SAVERM_920 1102472 1101987 putative secreted protein 11.3 17341 A similar to unknown proteins 5 BAC68630.1 Non-secretory protein CDS SAVERM_921 1103326 1102907 putative anti-sigma factor antagonist PF01740: STAS domain 4.49 14528 A regulation 3.5.2 BAC68631.1 Non-secretory protein CDS SAVERM_922 1104566 1103319 prpC3 putative magnesium or manganese-dependent protein phosphatase PF00785: PAC motif 4.7 44921 A protein modification 3.8 BAC68632.1 Non-secretory protein CDS SAVERM_923 1105369 1104566 putative hydrolase PF00561: alpha/beta hydrolase fold 4.32 28910 A miscellaneous 4.7 BAC68633.1 Non-secretory protein CDS SAVERM_924 1105704 1108190 prpC4 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.4 90220 A protein modification 3.8 BAC68634.1 Non-secretory protein CDS SAVERM_925 1108453 1109142 hypothetical protein 4.49 24495 A no similarity 6 BAC68635.1 Non-secretory protein CDS SAVERM_926 1109139 1119155 putative transcriptional activator SRCAP homolog a giant polypeptide 3338 aa 5.58 345049 A regulation 3.5.2 BAC68636.1 Non-secretory protein CDS SAVERM_927 1119155 1120723 hypothetical protein 5.12 55343 A similar to unknown proteins 5 BAC68637.1 Non-secretory protein CDS SAVERM_928 1120720 1121583 hypothetical protein 5.19 30979 A similar to unknown proteins 5 BAC68638.1 Non-secretory protein CDS SAVERM_929 1121580 1125176 putative secreted protein 6.19 127821 A similar to unknown proteins 5 BAC68639.1 Non-secretory protein CDS SAVERM_930 1125173 1127746 putative N-acetylmuramoyl-L-alanine amidase PF01510: N-acetylmuramoyl-L-alanine amidase 6.78 93077 A cell wall 1.1 BAC68640.1 Non-secretory protein CDS SAVERM_931 1128495 1127788 putative two-component system response regulator PF00072: Response regulator receiver domain 5.16 25273 A regulation 3.5.2 BAC68641.1 Non-secretory protein CDS SAVERM_932 1129679 1128492 putative two-component system sensor kinase Tat substrate, PF07730: Histidine kinase 10.38 42031 A sensors 1.3 BAC68642.1 Non-secretory protein CDS SAVERM_933 1129772 1130797 putative ABC transporter ATP-binding protein PF00005: ABC transporter 11.88 37109 A transport / binding proteins & lipoproteins 1.2 BAC68643.1 Non-secretory protein CDS SAVERM_934 1130794 1131567 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.36 26450 A transport / binding proteins & lipoproteins 1.2 BAC68644.1 Non-secretory protein CDS SAVERM_935 1132045 1134894 aveR LuxR-family transcriptional regulator positive response regulator for avermectin biosynthetic gene cluster, avermectin gene cluster 8.54 101479 A regulation 3.5.2 BAC68645.1 Non-secretory protein CDS SAVERM_936 1135849 1134941 aveF C-5 ketoreductase avermectin gene cluster 7.45 31648 A antibiotic production 4.3 BAC68646.1 Non-secretory protein CDS SAVERM_937 1137480 1136629 aveD C5-O-methyltransferase avermectin gene cluster 5.35 30113 A antibiotic production 4.3 BAC68647.1 Non-secretory protein CDS SAVERM_938 1137817 1149735 aveA1 type I polyketide synthase AVES 1 avermectin gene cluster 6.37 416860 A antibiotic production 4.3 BAC68648.1 Non-secretory protein CDS SAVERM_939 1149787 1168506 aveA2 type I polyketide synthase AVES 2 avermectin gene cluster 6.41 666306 A antibiotic production 4.3 BAC68649.1 Non-secretory protein CDS SAVERM_940 1168503 1169546 aveC AveC avermectin gene cluster 8.03 37747 A antibiotic production 4.3 BAC68650.1 Non-secretory protein CDS SAVERM_941 1171000 1169630 aveE cytochrome P450 hydroxylase CYP171A1, avermectin gene cluster 9.42 49656 A metabolism of coenzymes & prosthetic groups 2.5 BAC68651.1 Non-secretory protein CDS SAVERM_942 1187750 1171152 aveA3 type I polyketide synthase AVES 3 avermectin gene cluster 5.61 575209 A antibiotic production 4.3 BAC68652.1 Non-secretory protein CDS SAVERM_943 1202573 1187928 aveA4 type I polyketide synthase AVES 4 avermectin gene cluster 4.74 510316 A antibiotic production 4.3 BAC68653.1 Non-secretory protein CDS SAVERM_944 1202833 1203546 orf-1 reductase not involved in biosynthesis of avermectin, PF00106: short chain dehydrogenase 9.52 25167 A miscellaneous 4.7 BAC68654.1 Non-secretory protein CDS SAVERM_945 1203604 1204842 aveBI dTDP-L-oleandrose transferase (glycosyltransferase) avermectin gene cluster, PF00201: UDP-glucoronosyl and UDP-glucosyl transferase 6.3 45379 A antibiotic production 4.3 BAC68655.1 Non-secretory protein CDS SAVERM_946 1205815 1204748 aveBII dTDP-glucose 4,6-dehydratase avermectin gene cluster 5.89 38670 A antibiotic production 4.3 BAC68656.1 Non-secretory protein CDS SAVERM_947 1206711 1205812 aveBIII glucose-1-phosphate thymidyltransferase avermectin gene cluster 5.18 32450 A antibiotic production 4.3 BAC68657.1 Non-secretory protein CDS SAVERM_948 1206837 1207868 aveBIV dTDP-4-keto-6-deoxy-L-hexose 4-reductase avermectin gene cluster 8.12 35630 A antibiotic production 4.3 BAC68658.1 Non-secretory protein CDS SAVERM_949 1208599 1207922 aveBV dTDP-4-keto-6-deoxyhexose 3,5-epimerase avermectin gene cluster 9.13 24663 A antibiotic production 4.3 BAC68659.1 Non-secretory protein CDS SAVERM_950 1210070 1208661 aveBVI dTDP-4-keto-6-deoxy-L-hexose2,3-dehydratase avermectin gene cluster 10.09 53039 A antibiotic production 4.3 BAC68660.1 Non-secretory protein CDS SAVERM_951 1210840 1210067 aveBVII dTDP-6-deoxy-L-hexose 3-O-methyltransferase avermectin gene cluster 5.04 29174 A antibiotic production 4.3 BAC68661.1 Non-secretory protein CDS SAVERM_952 1211970 1210927 aveBVIII dTDP-4-keto-6-deoxy-L-hexose 2,3-reductase avermectin gene cluster 7.23 37774 A antibiotic production 4.3 BAC68662.1 Non-secretory protein CDS SAVERM_953 1212208 1212960 aveG thioesterase avermectin gene cluster 6.17 27329 A antibiotic production 4.3 BAC68663.1 Non-secretory protein CDS SAVERM_954 1213312 1214895 yerD1 putative glutamate synthase(ferredoxin) PF01645: Conserved region in glutamate synthase 7.58 57267 A metabolism of amino acids & related molecules 2.2 BAC68664.1 Non-secretory protein CDS SAVERM_955 1214909 1216672 poxB1 putative pyruvate dehydrogenase/oxidase FAD and thiamine PPi cofactors PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.04 62373 A main glycolytic pathways 2.1.2 BAC68665.1 Non-secretory protein CDS SAVERM_956 1218094 1216895 prpB2 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.24 42896 A protein modification 3.8 BAC68666.1 Non-secretory protein CDS SAVERM_957 1218275 1218448 hypothetical protein PF05532: CsbD-like 11.27 5949 A similar to unknown proteins 5 BAC68667.1 Non-secretory protein CDS SAVERM_958 1218971 1219141 putative secreted protein 12.52 6286 A similar to unknown proteins 5 BAC68668.1 Non-secretory protein CDS SAVERM_959 1219332 1219616 hypothetical protein 12.51 10704 A no similarity 6 BAC68669.1 Non-secretory protein CDS SAVERM_960 1219827 1220234 hypothetical protein PF04946: DGPF domain 4.2 14713 A similar to unknown proteins 5 BAC68670.1 Non-secretory protein CDS SAVERM_961 1220243 1221388 sig12 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 5.9 41324 A RNA initiation 3.5.1 BAC68671.1 Non-secretory protein CDS SAVERM_962 1221488 1221802 hypothetical protein 11.58 10672 A no similarity 6 BAC68672.1 Non-secretory protein CDS SAVERM_963 1222029 1223162 fdhA putative glutathione-independent formaldehyde dehydrogenase PF00107: Zinc-binding dehydrogenase 5.13 40316 A specific pathways 2.1.1 BAC68673.1 Non-secretory protein CDS SAVERM_964 1223517 1223957 hypothetical protein PF02987: Late embryogenesis abundant protein 11.63 14312 A similar to unknown proteins 5 BAC68674.1 Non-secretory protein CDS SAVERM_965 1225057 1224632 putative transcriptional regulator PF01638: Transcriptional regulator 9.15 15951 A regulation 3.5.2 BAC68675.1 Non-secretory protein CDS SAVERM_966 1225192 1225653 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.2 16319 A similar to unknown proteins 5 BAC68676.1 Non-secretory protein CDS SAVERM_967 1227438 1226230 putative glycosyl hydrolase, secreted Tat substrate 5.6 41992 A miscellaneous 4.7 BAC68677.1 Signal peptide CDS SAVERM_968 1228718 1227720 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.48 33755 A transport / binding proteins & lipoproteins 1.2 BAC68678.1 Non-secretory protein CDS SAVERM_969 1229716 1228751 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.28 33037 A transport / binding proteins & lipoproteins 1.2 BAC68679.1 Non-secretory protein CDS SAVERM_970 1231277 1229709 putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 5.99 55686 A transport / binding proteins & lipoproteins 1.2 BAC68680.1 Non-secretory protein CDS SAVERM_971 1232498 1231383 putative simple sugar ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 9.12 38690 A transport / binding proteins & lipoproteins 1.2 BAC68681.1 Signal peptide CDS SAVERM_972 1233692 1232679 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.54 36703 A regulation 3.5.2 BAC68682.1 Non-secretory protein CDS SAVERM_973 1233874 1236525 putative hydrolase, secreted PF07691: PA14 domain 5.93 95950 A miscellaneous 4.7 BAC68683.1 Signal peptide CDS SAVERM_974 1236913 1237734 putative non-heme chloroperoxidase PF00561: alpha/beta hydrolase fold 4.86 29828 A miscellaneous 4.7 BAC68684.1 Non-secretory protein CDS SAVERM_975 1239828 1238122 pkn2 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7.59 60378 A protein modification 3.8 BAC68685.1 Non-secretory protein CDS SAVERM_976 1239936 1240271 putative nucleotide-binding protein (truncated by insertion of ISSav4C) PF00027: Cyclic nucleotide-binding domain 4.69 12207 A miscellaneous 4.7 BAC68686.1 Non-secretory protein CDS SAVERM_977 1240310 1241584 putative IS701 family ISAzvi8-like transposase IS701 family (1240250..1241683) Inverted repeat sequence (16/16 bp). Target sequence (CTAG); same as SAV289 and SAV319. 8.39 42623 A transposon & IS 4.5 BAC68687.1 Non-secretory protein CDS SAVERM_978 1242469 1241684 putative IS481 family ISCmi2-like transposase PF00665: Integrase core domain 11.42 30075 A transposon & IS 4.5 BAC68688.1 Non-secretory protein CDS SAVERM_979 1242702 1242469 putative IS481 family IS1122-like transposase 12.26 8700 A transposon & IS 4.5 BAC68689.1 Non-secretory protein CDS SAVERM_7578 1243340 1242699 putative secreted protein PF07754: Domain of unknown function (DUF1610) 8.9 21900 A similar to unknown proteins 5 BAF64418.1 Non-secretory protein CDS SAVERM_980 1243471 1244862 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 8.32 49973 A regulation 3.5.2 BAC68690.1 Non-secretory protein CDS SAVERM_981 1244924 1245541 hypothetical protein 9.31 22702 A similar to unknown proteins 5 BAC68691.1 Non-secretory protein CDS SAVERM_982 1245553 1245675 putative nucleotide-binding protein (truncated) 4.54 4224 A similar to unknown proteins 5 BAC68692.1 Non-secretory protein CDS SAVERM_983 1246455 1247330 gmt geranyl diphosphate methyltransferase PF08241: Methyltransferase domain 6.92 32478 A miscellaneous 4.7 BAC68693.1 Non-secretory protein CDS SAVERM_984 1250234 1247421 hypothetical protein PF06893: Bacteriophage Mu P protein 5.67 102596 A similar to unknown proteins 5 BAC68694.1 Non-secretory protein CDS SAVERM_985 1251346 1250231 hypothetical protein PF00004: ATPase family associated with various cellular activities (AAA) 4.69 40916 A similar to unknown proteins 5 BAC68695.1 Non-secretory protein CDS SAVERM_986 1252792 1251356 hypothetical protein PF05762: VWA domain containing CoxE-like protein 6.27 52441 A similar to unknown proteins 5 BAC68696.1 Non-secretory protein CDS SAVERM_987 1254189 1252789 hypothetical protein 6.66 48152 A no similarity 6 BAC68697.1 Non-secretory protein CDS SAVERM_988 1254668 1254189 hypothetical protein 9.21 17201 A no similarity 6 BAC68698.1 Non-secretory protein CDS SAVERM_989 1254946 1255869 putative phosphotransferase PF01636: Phosphotransferase enzyme family 4.8 33084 A miscellaneous 4.7 BAC68699.1 Non-secretory protein CDS SAVERM_990 1256164 1256619 putative secreted protein 9.95 16877 A miscellaneous 4.7 BAC68700.1 Signal peptide CDS SAVERM_991 1257106 1257552 hypothetical protein 9.09 17137 A similar to unknown proteins 5 BAC68701.1 Non-secretory protein CDS SAVERM_992 1257609 1258790 putative membrane protein, ribonuclease BN-like family PF03631: Ribonuclease BN-like family 9.84 42628 A miscellaneous 4.7 BAC68702.1 Non-secretory protein CDS SAVERM_993 1259420 1258992 putative cysteine transferase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.84 15632 A miscellaneous 4.7 BAC68703.1 Non-secretory protein CDS SAVERM_994 1259676 1260971 ptpA1 putative conventional protein tyrosine phosphatase 5.93 48093 A protein modification 3.8 BAC68704.1 Non-secretory protein CDS SAVERM_995 1261713 1261279 hypothetical protein 3.96 15791 A similar to unknown proteins 5 BAC68705.1 Non-secretory protein CDS SAVERM_996 1262191 1262457 putative secreted protein 10.13 9103 A no similarity 6 BAC68706.1 Non-secretory protein CDS SAVERM_997 1262450 1263121 sig13 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 9.75 25502 A RNA initiation 3.5.1 BAC68707.1 Non-secretory protein CDS SAVERM_998 1263118 1264992 putative secreted protein PF01435: Peptidase family M48 8.27 67342 A similar to unknown proteins 5 BAC68708.1 Non-secretory protein CDS SAVERM_999 1266182 1265082 putative carboxylase-amine ligase PF04107: Glutamate-cysteine ligase family 2(GCS2) 5.96 39584 A similar to unknown proteins 5 BAC68709.1 Non-secretory protein CDS SAVERM_1000 1267947 1266577 sprC putative streptogrisin C (secreted serine protease) PF00089: Trypsin 6.5 46195 A protein modification 3.8 BAC68710.1 Signal peptide CDS SAVERM_1001 1269867 1268233 putative dehydrogenase PF01593: Flavin containing amine oxidoreductase 8.32 57491 A miscellaneous 4.7 BAC68711.1 Non-secretory protein CDS SAVERM_1002 1270425 1269949 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 7.64 17419 A similar to unknown proteins 5 BAC68712.1 Non-secretory protein CDS SAVERM_1003 1271402 1270524 putative dehydrogenase PF00106: short chain dehydrogenase 10.58 30872 A miscellaneous 4.7 BAC68713.1 Non-secretory protein CDS SAVERM_1004 1271761 1272111 hypothetical protein 7.32 12220 A similar to unknown proteins 5 BAC68714.1 Non-secretory protein CDS SAVERM_1005 1272571 1272152 putative oxidoreductase PF00571: CBS domain 4.34 14786 A miscellaneous 4.7 BAC68715.1 Non-secretory protein CDS SAVERM_1006 1273169 1272888 hypothetical protein PF04226: Transglycosylase associated protein 10.83 9761 A similar to unknown proteins 5 BAC68716.1 Non-secretory protein CDS SAVERM_1007 1273736 1274263 putative secreted protein 4.94 18327 A no similarity 6 BAC68717.1 Signal peptide CDS SAVERM_1008 1274688 1276823 putative secreted protein 4.4 76227 A similar to unknown proteins 5 BAC68718.1 Signal peptide CDS SAVERM_1009 1276910 1278451 putative glycosyltransferase PF00534: Glycosyl transferases group 1 7.4 55136 A specific pathways 2.1.1 BAC68719.1 Non-secretory protein CDS SAVERM_1010 1278448 1279854 hypothetical protein PF01988: Integral membrane protein DUF125 9.2 48352 A similar to unknown proteins 5 BAC68720.1 Non-secretory protein CDS SAVERM_1011 1280007 1280801 galE5 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 5.81 27565 A specific pathways 2.1.1 BAC68721.1 Non-secretory protein CDS SAVERM_1012 1280798 1281016 hypothetical protein 9.99 8035 A similar to unknown proteins 5 BAC68722.1 Non-secretory protein CDS SAVERM_1013 1281049 1281762 mpg2 putative mannose-1-phosphate guanyltransferase PF00483: Nucleotidyl transferase 5.94 25893 A main glycolytic pathways 2.1.2 BAC68723.1 Non-secretory protein CDS SAVERM_1014 1281770 1282696 putative NDP-hexose 4-ketoreductase PF01370: NAD dependent epimerase/dehydratase family 9.27 30841 A miscellaneous 4.7 BAC68724.1 Non-secretory protein CDS SAVERM_1015 1282693 1283355 hypothetical protein 7.58 23602 A similar to unknown proteins 5 BAC68725.1 Non-secretory protein CDS SAVERM_1016 1283901 1283443 hypothetical protein 6.23 17153 A similar to unknown proteins 5 BAC68726.1 Non-secretory protein CDS SAVERM_1017 1284066 1284428 hypothetical protein PF07300: Protein of unknown function (DUF1452) 6.63 13498 A similar to unknown proteins 5 BAC68727.1 Non-secretory protein CDS SAVERM_1018 1285032 1284484 putative integral membrane protein PF06532: Protein of unknown function (DUF1109) 8.23 19963 A miscellaneous 4.7 BAC68728.1 Non-secretory protein CDS SAVERM_1019 1286689 1285187 crtU beta-carotene desaturase/methylase crt gene cluster, conversion of beta-carotene to isoneriatene, PF01593: Flavin containing amine oxidoreductase 9.84 55041 A antibiotic production 4.3 BAC68729.1 Non-secretory protein CDS SAVERM_1020 1287474 1286743 crtT putative methyltransferase crt gene cluster, PF01209: ubiE/COQ5 methyltransferase family 8.5 25603 A antibiotic production 4.3 BAC68730.1 Non-secretory protein CDS SAVERM_1021 1288711 1287518 crtY lycopene cyclase crt gene cluster, PF05834: Lycopene cyclase protein 10.68 43161 A antibiotic production 4.3 BAC68731.1 Non-secretory protein CDS SAVERM_1022 1289024 1290265 crtE geranylgeranyl diphosphate synthase crt gene cluster, probably geranylgeranyl pyrophosphate synthase, PF00348: Polyprenyl synthetase 7.83 43532 A antibiotic production 4.3 BAC68732.1 Non-secretory protein CDS SAVERM_1023 1290262 1291803 crtI phytoene desaturase crt gene cluster, PF01593: Flavin containing amine oxidoreductase 10.31 54816 A metabolism of lipids 2.4 BAC68733.1 Non-secretory protein CDS SAVERM_1024 1291800 1292828 crtB phytoene synthase crt gene cluster, PF00494: Squalene/phytoene synthase 10.09 37736 A metabolism of lipids 2.4 BAC68734.1 Non-secretory protein CDS SAVERM_1025 1292825 1293904 crtV putative methylesterase crt gene cluster, PF00355: Rieske [2Fe-2S] domain 7.62 39248 A antibiotic production 4.3 BAC68735.1 Non-secretory protein CDS SAVERM_1026 1296224 1294125 putative secreted protein Tat substrate, PF00652: QXW lectin repeat 6.01 74861 A miscellaneous 4.7 BAC68736.1 Signal peptide CDS SAVERM_1027 1298349 1296307 bga1 putative beta-galactosidase PF02449: Beta-galactosidase 5.2 74933 A specific pathways 2.1.1 BAC68737.1 Non-secretory protein CDS SAVERM_1028 1299738 1298401 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 7.46 48194 A transport / binding proteins & lipoproteins 1.2 BAC68738.1 Signal peptide CDS SAVERM_1029 1300786 1299830 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.75 34134 A transport / binding proteins & lipoproteins 1.2 BAC68739.1 Non-secretory protein CDS SAVERM_1030 1301717 1300791 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.71 33799 A transport / binding proteins & lipoproteins 1.2 BAC68740.1 Non-secretory protein CDS SAVERM_1031 1301900 1302979 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.82 38543 A regulation 3.5.2 BAC68741.1 Non-secretory protein CDS SAVERM_1032 1303150 1303467 hypothetical protein 4.12 11333 A no similarity 6 BAC68742.1 Non-secretory protein CDS SAVERM_1033 1303909 1306188 putative integral membrane protein PF05976: Bacterial membrane protein of unknown function (DUF893) 7.95 81438 A miscellaneous 4.7 BAC68743.1 Non-secretory protein CDS SAVERM_1034 1307035 1306217 putative secreted protein 4.23 28033 A similar to unknown proteins 5 BAC68744.1 Signal peptide CDS SAVERM_1035 1308420 1307347 ppnK1 putative inorganic polyphosphate/ATP-NAD kinase PF01513: ATP-NAD kinase 5.98 37612 A miscellaneous 4.7 BAC68745.1 Non-secretory protein CDS SAVERM_1036 1309264 1308470 putative dehydrogenase PF00106: short chain dehydrogenase 4.61 28006 A miscellaneous 4.7 BAC68746.1 Non-secretory protein CDS SAVERM_1037 1312341 1309966 zmp1 putative griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 6.47 82168 A protein modification 3.8 BAC68747.1 Non-secretory protein CDS SAVERM_1038 1313665 1312721 hemC2 putative porphobilinogen deaminase PF01379: Porphobilinogen deaminase, dipyromethane cofactor binding domain 5.84 33545 A metabolism of coenzymes & prosthetic groups 2.5 BAC68748.1 Non-secretory protein CDS SAVERM_1039 1314851 1313907 hypothetical protein PF00144: Beta-lactamase 10.77 33063 A similar to unknown proteins 5 BAC68749.1 Signal peptide CDS SAVERM_1040 1315349 1315062 hypothetical protein 7.9 10157 A no similarity 6 BAC68750.1 Non-secretory protein CDS SAVERM_1041 1315431 1316003 hypothetical protein PF03466: LysR substrate binding domain 8.7 20163 A similar to unknown proteins 5 BAC68751.1 Non-secretory protein CDS SAVERM_1042 1318020 1316740 putative membrane protein PF07690: Major Facilitator Superfamily 11.06 43720 A miscellaneous 4.7 BAC68752.1 Non-secretory protein CDS SAVERM_1043 1320019 1318574 abfA putative secreted alpha L-arabinofuranosidase II Tat substrate, PF04616: Glycosyl hydrolases family 43 7.22 53105 A specific pathways 2.1.1 BAC68753.1 Signal peptide CDS SAVERM_1044 1321573 1320038 putative hydrolase, secreted PF04616: Glycosyl hydrolases family 43 6.1 54790 A miscellaneous 4.7 BAC68754.1 Signal peptide CDS SAVERM_1045 1322329 1321655 hypothetical protein 8.77 24693 A similar to unknown proteins 5 BAC68755.1 Non-secretory protein CDS SAVERM_1046 1323022 1322480 hypothetical protein 8.22 19644 A similar to unknown proteins 5 BAC68756.1 Non-secretory protein CDS SAVERM_1047 1323552 1323782 putative regulatory protein PF04149: Domain of unknown function (DUF397) 4.92 7838 A regulation 3.5.2 BAC68757.1 Non-secretory protein CDS SAVERM_1048 1323943 1324863 putative DNA-binding protein PF01381: Helix-turn-helix 5.32 34637 A regulation 3.5.2 BAC68758.1 Non-secretory protein CDS SAVERM_1049 1325763 1324945 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.82 30362 A similar to unknown proteins 5 BAC68759.1 Non-secretory protein CDS SAVERM_1050 1326741 1325884 putative oxidoreductase PF00248: Aldo/keto reductase family 5.19 30349 A miscellaneous 4.7 BAC68760.1 Non-secretory protein CDS SAVERM_1051 1327109 1328002 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 6.31 30917 A miscellaneous 4.7 BAC68761.1 Non-secretory protein CDS SAVERM_1052 1328871 1328062 hypothetical protein PF04672: Protein of unknown function (DUF574) 5.11 28996 A similar to unknown proteins 5 BAC68762.1 Non-secretory protein CDS SAVERM_1053 1329176 1330375 putative sugar hydrolase, secreted Tat substrate 8.57 42645 A miscellaneous 4.7 BAC68763.1 Signal peptide CDS SAVERM_1054 1332496 1330445 prpJ4 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain, PF01590: GAF domain 4.8 72532 A protein modification 3.8 BAC68764.1 Non-secretory protein CDS SAVERM_1055 1333503 1332766 hypothetical protein PF03861: ANTAR domain 4.88 26751 A similar to unknown proteins 5 BAC68765.1 Non-secretory protein CDS SAVERM_1056 1334098 1333655 putative MarR-family transcriptional regulator PF01047: MarR family 6.26 15587 A regulation 3.5.2 BAC68766.1 Non-secretory protein CDS SAVERM_1057 1334701 1334264 hypothetical protein 4.41 15648 A no similarity 6 BAC68767.1 Non-secretory protein CDS SAVERM_1058 1336405 1334840 hypothetical protein 8.84 54551 A no similarity 6 BAC68768.1 Non-secretory protein CDS SAVERM_1059 1336683 1337606 savR2 putative Mrr restriction system protein Tat substrate, PF04471: Restriction endonuclease 4.38 32646 A miscellaneous 4.7 BAC68769.1 Non-secretory protein CDS SAVERM_1060 1337762 1338721 putative ribonuclease BN PF03631: Ribonuclease BN-like family 9.87 33717 A RNA modification 3.6 BAC68770.1 Non-secretory protein CDS SAVERM_1061 1340271 1339060 putative aminotransferase PF00266: Aminotransferase class-V 5.25 42910 A metabolism of amino acids & related molecules 2.2 BAC68771.1 Non-secretory protein CDS SAVERM_1062 1341237 1340359 hypothetical protein 9.37 31513 A similar to unknown proteins 5 BAC68772.1 Non-secretory protein CDS SAVERM_1063 1341708 1341421 putative membrane protein PF07673: Protein of unknown function (DUF1602) 9.95 9205 A miscellaneous 4.7 BAC68773.1 Non-secretory protein CDS SAVERM_1064 1342008 1343222 clsA putative phospholipase D PF00614: Phospholipase D Active site motif 6.75 45556 A metabolism of lipids 2.4 BAC68774.1 Non-secretory protein CDS SAVERM_1065 1344437 1343403 hypothetical protein PF00043: Glutathione S-transferase, C-terminal domain 8.02 36898 A similar to unknown proteins 5 BAC68775.1 Non-secretory protein CDS SAVERM_1066 1344973 1345542 putative secreted protein 6.35 20105 A no similarity 6 BAC68776.1 Signal peptide CDS SAVERM_1067 1346481 1345801 putative dehydrogenase PF00106: short chain dehydrogenase 4.91 23769 A miscellaneous 4.7 BAC68777.1 Non-secretory protein CDS SAVERM_1068 1346651 1347208 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.93 19714 A regulation 3.5.2 BAC68778.1 Non-secretory protein CDS SAVERM_1069 1348486 1347446 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 4.63 38233 A similar to unknown proteins 5 BAC68779.1 Non-secretory protein CDS SAVERM_1070 1349763 1348483 hypothetical protein 6.59 46346 A no similarity 6 BAC68780.1 Non-secretory protein CDS SAVERM_1071 1350932 1349760 hypothetical protein PF00656: Caspase domain 4.93 42301 A similar to unknown proteins 5 BAC68781.1 Non-secretory protein CDS SAVERM_1072 1351064 1352230 hypothetical protein 10.22 42712 A similar to unknown proteins 5 BAC68782.1 Non-secretory protein CDS SAVERM_1073 1352542 1352922 putative secreted protein PF07681: DoxX 12.51 13276 A similar to unknown proteins 5 BAC68783.1 Signal peptide CDS SAVERM_1074 1352919 1353386 bcp1 putative bacterioferritin comigratory protein PF00578: AhpC/TSA family 5.66 16869 A miscellaneous 4.7 BAC68784.1 Non-secretory protein CDS SAVERM_1075 1354747 1353464 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 6.24 44562 A miscellaneous 4.7 BAC68785.1 Signal peptide CDS SAVERM_1076 1357158 1354744 hypothetical protein Tat substrate, PF03636: Glycosyl hydrolase family 65, N-terminal domain 6.94 86993 A similar to unknown proteins 5 BAC68786.1 Signal peptide CDS SAVERM_1077 1359115 1357289 agaA3 putative alpha-galactosidase, secreted PF03422: Carbohydrate binding module (family 6) 6.6 64940 A specific pathways 35795 BAC68787.1 Signal peptide CDS SAVERM_1078 1360014 1359193 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 7.56 30608 A transport / binding proteins & lipoproteins 1.2 BAC68788.1 Non-secretory protein CDS SAVERM_1079 1361069 1360116 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 7.9 34751 A transport / binding proteins & lipoproteins 1.2 BAC68789.1 Non-secretory protein CDS SAVERM_1080 1362439 1361096 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 8.8 48668 A transport / binding proteins & lipoproteins 1.2 BAC68790.1 Non-secretory protein CDS SAVERM_1081 1363636 1362458 putative ROK-family transcriptional regulator PF00480: ROK family 4.89 40311 A regulation 3.5.2 BAC68791.1 Non-secretory protein CDS SAVERM_1082 1363816 1365948 agaB1 putative alpha-galactosidase PF02065: Melibiase 6.3 78216 A specific pathways 2.1.1 BAC68792.1 Non-secretory protein CDS SAVERM_1083 1366684 1366037 putative secreted protein 5.06 22548 A miscellaneous 4.7 BAC68793.1 Non-secretory protein CDS SAVERM_1084 1367063 1367647 hypothetical protein PF09348: Domain of unknown function 10.38 21005 A similar to unknown proteins 5 BAC68794.1 Non-secretory protein CDS SAVERM_1085 1368024 1372298 putative two-component system sensor kinase PF00672: HAMP domain 4.59 152045 A sensors 1.3 BAC68795.1 Non-secretory protein CDS SAVERM_1086 1372393 1374891 prpF putative magnesium or manganese-dependent protein phosphatase PF03861: ANTAR domain 5.34 89006 A protein modification 3.8 BAC68796.1 Non-secretory protein CDS SAVERM_1087 1375028 1375915 sig14 putative RNA polymerase sigma factor RNA polymerase alternative sigma factor, PF04539: Sigma-70 region 3 5.04 32847 A RNA initiation 3.5.1 BAC68797.1 Non-secretory protein CDS SAVERM_1088 1376152 1375979 hypothetical protein PF05532: CsbD-like 10.79 6043 A similar to unknown proteins 5 BAC68798.1 Non-secretory protein CDS SAVERM_1089 1376590 1376258 hypothetical protein 5.99 11880 A similar to unknown proteins 5 BAC68799.1 Non-secretory protein CDS SAVERM_1090 1377075 1376875 putative secreted protein 11.9 7007 A similar to unknown proteins 5 BAC68800.1 Non-secretory protein CDS SAVERM_1091 1377301 1377678 putative anti-sigma factor antagonist PF01740: STAS domain 5.5 13616 A regulation 3.5.2 BAC68801.1 Non-secretory protein CDS SAVERM_1092 1378400 1377924 putative MarR-family transcriptional regulator PF01047: MarR family 8.1 17015 A regulation 3.5.2 BAC68802.1 Non-secretory protein CDS SAVERM_1093 1378554 1379741 prpB3 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 4.69 42903 A protein modification 3.8 BAC68803.1 Non-secretory protein CDS SAVERM_1094 1379931 1380830 rsbR putative positive regulatory protein PF01740: STAS domain 4.59 31757 A adaptation to atypical conditions 4.1 BAC68804.1 Non-secretory protein CDS SAVERM_1095 1380827 1381246 rsbS putative anti-sigma factor antagonist PF01740: STAS domain 5.5 14413 A adaptation to atypical conditions 4.1 BAC68805.1 Non-secretory protein CDS SAVERM_1096 1381294 1381689 rsbT putative anti-sigma factor PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.09 13723 A adaptation to atypical conditions 4.1 BAC68806.1 Non-secretory protein CDS SAVERM_1097 1381686 1382759 prpI2 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.31 36621 A protein modification 3.8 BAC68807.1 Non-secretory protein CDS SAVERM_1098 1382756 1384498 prpB4 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.25 62502 A protein modification 3.8 BAC68808.1 Non-secretory protein CDS SAVERM_1099 1384995 1384489 putative MarR-family transcriptional regulator PF01047: MarR family 11.47 18562 A regulation 3.5.2 BAC68809.1 Non-secretory protein CDS SAVERM_1100 1385447 1385881 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.68 15746 A regulation 3.5.2 BAC68810.1 Non-secretory protein CDS SAVERM_1101 1386520 1386020 hypothetical protein PF05239: PRC-barrel domain 5.3 18210 A similar to unknown proteins 5 BAC68811.1 Non-secretory protein CDS SAVERM_1102 1386972 1386577 putative anti-sigma factor antagonist PF01740: STAS domain 4.17 14006 A regulation 3.5.2 BAC68812.1 Non-secretory protein CDS SAVERM_1103 1387943 1387458 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.45 17150 A regulation 3.5.2 BAC68813.1 Non-secretory protein CDS SAVERM_1104 1388246 1390171 fadD3 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.79 69594 A metabolism of lipids 2.4 BAC68814.1 Non-secretory protein CDS SAVERM_1105 1390983 1390246 putative secreted protein 9.53 26071 A no similarity 6 BAC68815.1 Non-secretory protein CDS SAVERM_1106 1392991 1391231 putative subfamily M50B peptidases PF02163: Peptidase family M50 10.05 62646 A similar to unknown proteins 5 BAC68816.1 Non-secretory protein CDS SAVERM_1107 1393315 1393073 hypothetical protein 6.51 8506 A no similarity 6 BAC68817.1 Non-secretory protein CDS SAVERM_1108 1393842 1393534 hypothetical protein 5.48 10917 A no similarity 6 BAC68818.1 Non-secretory protein CDS SAVERM_1109 1393981 1394376 hypothetical protein PF01381: Helix-turn-helix 7.07 13878 A no similarity 6 BAC68819.1 Non-secretory protein CDS SAVERM_1110 1394582 1394878 hypothetical protein 4.38 10417 A no similarity 6 BAC68820.1 Non-secretory protein CDS SAVERM_1111 1396032 1395202 dppA1 putative D-aminopeptidase (family M55 peptidases ) PF04951: D-aminopeptidase 5.13 29052 A protein modification 3.8 BAC68821.1 Non-secretory protein CDS SAVERM_1112 1396223 1397143 putative taurine catabolism dioxygenase PF02668: Taurine catabolism dioxygenase TauD, TfdA family 6.84 34255 A specific pathways 2.1.1 BAC68822.1 Non-secretory protein CDS SAVERM_1113 1397677 1397147 hypothetical protein 4.18 19680 A similar to unknown proteins 5 BAC68823.1 Non-secretory protein CDS SAVERM_1114 1397751 1398434 hypothetical protein PF04156: IncA protein 10.38 23392 A no similarity 6 BAC68824.1 Non-secretory protein CDS SAVERM_1115 1398758 1400167 abfB putative alpha L-arabinofuranosidase Tat substrate, PF05270: Alpha-L-arabinofuranosidase B (ABFB) 6.32 51322 A specific pathways 2.1.1 BAC68825.1 Non-secretory protein CDS SAVERM_1116 1400293 1402032 hypothetical protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 10.18 62477 A similar to unknown proteins 5 BAC68826.1 Non-secretory protein CDS SAVERM_1117 1403417 1402053 putative metallopeptidase, secreted PF01433: Peptidase family M1 8.04 48933 A protein modification 3.8 BAC68827.1 Signal peptide CDS SAVERM_1118 1403619 1403963 hypothetical protein 10.17 12570 A no similarity 6 BAC68828.1 Non-secretory protein CDS SAVERM_1119 1405710 1404364 putative membrane transport protein PF07690: Major Facilitator Superfamily 10.87 46477 A transport / binding proteins & lipoproteins 1.2 BAC68829.1 Non-secretory protein CDS SAVERM_1120 1406389 1405778 putative membrane protein PF01810: LysE type translocator 11.99 20814 A miscellaneous 4.7 BAC68830.1 Non-secretory protein CDS SAVERM_1121 1406456 1407412 putative LysR-family transcriptional regulator PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 7.63 34257 A regulation 3.5.2 BAC68831.1 Non-secretory protein CDS SAVERM_1122 1407714 1409957 hypothetical protein PF07721: Tetratricopeptide repeat 5.92 81222 A similar to unknown proteins 5 BAC68832.1 Non-secretory protein CDS SAVERM_1123 1409996 1410571 hypothetical protein 7.42 20116 A no similarity 6 BAC68833.1 Non-secretory protein CDS SAVERM_1124 1411429 1410593 hypothetical protein PF02743: Cache domain 6.23 29531 A similar to unknown proteins 5 BAC68834.1 Non-secretory protein CDS SAVERM_1125 1411647 1412945 potD3 putative polyamine ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 4.72 46809 A transport / binding proteins & lipoproteins 1.2 BAC68835.1 Non-secretory protein CDS SAVERM_1126 1414465 1412969 xylB2 putative xylulose kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 5.76 53119 A specific pathways 2.1.1 BAC68836.1 Non-secretory protein CDS SAVERM_1127 1414635 1415312 hypothetical protein PF01987: Protein of unknown function DUF124 7.64 23927 A similar to unknown proteins 5 BAC68837.1 Non-secretory protein CDS SAVERM_1128 1417162 1415378 zmp2 putative griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 9.02 62268 A protein modification 3.8 BAC68838.1 Signal peptide CDS SAVERM_1129 1418525 1417491 idsA1 putative polyprenyl diphosphate synthase probably farnesyl pyrophosphate synthase, PF00348: Polyprenyl synthetase 7.21 35079 A metabolism of coenzymes & prosthetic groups 2.5 BAC68839.1 Non-secretory protein CDS SAVERM_1130 1419580 1418522 hypothetical protein PF00515: TPR Domain 9.2 37852 A similar to unknown proteins 5 BAC68840.1 Non-secretory protein CDS SAVERM_1131 1419909 1420535 putative alkylated DNA repair protein PF03171: 2OG-Fe(II) oxygenase superfamily 7.67 22679 A DNA modification & repair 3.2 BAC68841.1 Non-secretory protein CDS SAVERM_1132 1421135 1420548 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.09 20736 A regulation 3.5.2 BAC68842.1 Non-secretory protein CDS SAVERM_1133 1422697 1421141 putative membrane transport protein PF07690: Major Facilitator Superfamily 10.67 53089 A transport / binding proteins & lipoproteins 1.2 BAC68843.1 Non-secretory protein CDS SAVERM_1134 1423966 1422761 putative hydroxylase PF01360: Monooxygenase 7.11 44541 A miscellaneous 4.7 BAC68844.1 Non-secretory protein CDS SAVERM_1135 1424120 1424587 hypothetical protein PF07883: Cupin domain 8.14 16117 A similar to unknown proteins 5 BAC68845.1 Non-secretory protein CDS SAVERM_1136 1424869 1425225 melC1 tyrosinase co-factor protein melanin biosynthesis, PF06236: Tyrosinase co-factor MelC1 6.97 12096 A metabolism of coenzymes & prosthetic groups 2.5 BAC68846.1 Signal peptide CDS SAVERM_1137 1425261 1426085 melC2 tyrosinase melanin biosynthesis, PF00264: Common central domain of tyrosinase 7.15 30863 A metabolism of coenzymes & prosthetic groups 2.5 BAC68847.1 Non-secretory protein CDS SAVERM_1138 1426937 1426227 rnhA putative ribonuclease H PF00075: RNase H 8.32 24882 A RNA modification 3.6 BAC68848.1 Non-secretory protein CDS SAVERM_1139 1427146 1427637 hypothetical protein 6.01 17806 A similar to unknown proteins 5 BAC68849.1 Non-secretory protein CDS SAVERM_1140 1428514 1427717 putative hydroxylase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.1 28498 A miscellaneous 4.7 BAC68850.1 Non-secretory protein CDS SAVERM_1141 1428660 1429664 adhA1 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.91 35278 A specific pathways 2.1.1 BAC68851.1 Non-secretory protein CDS SAVERM_1142 1429684 1430985 prpB5 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 7.48 46225 A protein modification 3.8 BAC68852.1 Non-secretory protein CDS SAVERM_1143 1431142 1432050 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 9.29 32087 A no similarity 6 BAC68853.1 Signal peptide CDS SAVERM_1144 1432284 1434848 putative secreted protein Tat substrate, PF02210: Laminin G domain 6.29 92017 A miscellaneous 4.7 BAC68854.1 Signal peptide CDS SAVERM_1145 1435355 1434873 hypothetical protein PF06983: 3-demethylubiquinone-9 3-methyltransferase 4.26 17391 A no similarity 6 BAC68855.1 Non-secretory protein CDS SAVERM_1146 1435653 1436306 clpP4 putative ATP-dependent Clp protease proteolytic subunit 1 PF00574: Clp protease 4.8 23544 A adaptation to atypical conditions 4.1 BAC68856.1 Non-secretory protein CDS SAVERM_1147 1436308 1436910 clpP5 putative ATP-dependent Clp protease proteolytic subunit 2 PF00574: Clp protease 5.27 21757 A adaptation to atypical conditions 4.1 BAC68857.1 Non-secretory protein CDS SAVERM_1148 1437455 1437000 popR putative DNA-binding protein PF01381: Helix-turn-helix 11.62 16262 A regulation 3.5.2 BAC68858.1 Non-secretory protein CDS SAVERM_1149 1437699 1439168 putative secreted esterase PF01839: FG-GAP repeat 3.88 48916 A detoxification 4.2 BAC68859.1 Signal peptide CDS SAVERM_1150 1439316 1439543 hypothetical protein 7.52 8340 A similar to unknown proteins 5 BAC68860.1 Non-secretory protein CDS SAVERM_1151 1439664 1440551 sig15 putative RNA polymerase sigma factor similar to SCO7278, RNA polymerase alternative sigma factor, PF04539: Sigma-70 region 3 4.66 33403 A RNA initiation 3.5.1 BAC68861.1 Non-secretory protein CDS SAVERM_1152 1442164 1440671 hypothetical protein PF00781: Diacylglycerol kinase catalytic domain (presumed) 11.07 51407 A similar to unknown proteins 5 BAC68862.1 Non-secretory protein CDS SAVERM_1153 1442683 1442225 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.67 16415 A regulation 3.5.2 BAC68863.1 Non-secretory protein CDS SAVERM_1154 1444327 1442897 hypothetical protein PF05387: Chorion family 3 7.18 49663 A similar to unknown proteins 5 BAC68864.1 Non-secretory protein CDS SAVERM_1155 1444480 1445736 putative membrane protein 11.41 43669 A miscellaneous 4.7 BAC68865.1 Non-secretory protein CDS SAVERM_1156 1445834 1446853 putative monooxygenase PF00296: Luciferase-like monooxygenase 5.93 37054 A miscellaneous 4.7 BAC68866.1 Non-secretory protein CDS SAVERM_1157 1447837 1446863 pkn3 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.24 35628 A protein modification 3.8 BAC68867.1 Non-secretory protein CDS SAVERM_1158 1448433 1447837 hypothetical protein 4.27 21310 A no similarity 6 BAC68868.1 Non-secretory protein CDS SAVERM_1159 1450781 1448439 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.58 84474 A transport / binding proteins & lipoproteins 1.2 BAC68869.1 Non-secretory protein CDS SAVERM_1160 1451258 1450848 hypothetical protein 4.42 14909 A similar to unknown proteins 5 BAC68870.1 Non-secretory protein CDS SAVERM_1161 1451671 1452057 putative isomerase PF07366: SnoaL-like polyketide cyclase 4.27 13694 A miscellaneous 4.7 BAC68871.1 Non-secretory protein CDS SAVERM_1162 1453103 1452141 putative ion channel subunit PF00248: Aldo/keto reductase family 5.24 35182 A membrane bioenergetics 1.4 BAC68872.1 Non-secretory protein CDS SAVERM_1163 1453280 1454158 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.23 31404 A regulation 3.5.2 BAC68873.1 Non-secretory protein CDS SAVERM_1164 1454314 1454829 hypothetical protein 5.01 18917 A similar to unknown proteins 5 BAC68874.1 Non-secretory protein CDS SAVERM_1165 1455875 1454811 add1 putative adenosine deaminase PF00962: Adenosine/AMP deaminase 4.77 38203 A metabolism of nucleotides & nucleic acids 2.3 BAC68875.1 Non-secretory protein CDS SAVERM_1166 1456307 1455900 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.21 14878 A similar to unknown proteins 5 BAC68876.1 Non-secretory protein CDS SAVERM_1167 1457401 1456484 hypothetical protein PF01435: Peptidase family M48 11.98 31797 A similar to unknown proteins 5 BAC68877.1 Non-secretory protein CDS SAVERM_1168 1457769 1457398 hypothetical protein PF03965: Penicillinase repressor 6.52 13517 A similar to unknown proteins 5 BAC68878.1 Non-secretory protein CDS SAVERM_1169 1457969 1458820 putative secreted protein PF01569: PAP2 superfamily 11.79 29951 A similar to unknown proteins 5 BAC68879.1 Non-secretory protein CDS SAVERM_1170 1458666 1459718 putative sodium-dependent transporter PF01758: Sodium Bile acid symporter family 11.59 35088 A transport / binding proteins & lipoproteins 1.2 BAC68880.1 Non-secretory protein CDS SAVERM_1171 1461257 1460052 cyp5 putative cytochrome P450 CYP107F2 5.21 44942 A metabolism of coenzymes & prosthetic groups 2.5 BAC68881.1 Non-secretory protein CDS SAVERM_1172 1462783 1461860 putative oxidoreductase PF00248: Aldo/keto reductase family 6.32 32951 A miscellaneous 4.7 BAC68882.1 Non-secretory protein CDS SAVERM_1173 1464203 1462809 putative secreted protein PF00652: Ricin-type beta-trefoil lectin domain 6.51 50163 A similar to unknown proteins 5 BAC68883.1 Signal peptide CDS SAVERM_1174 1464641 1465246 hypothetical protein 4.45 21670 A similar to unknown proteins 5 BAC68884.1 Non-secretory protein CDS SAVERM_1175 1466494 1465703 hypothetical protein 8.54 29091 A similar to unknown proteins 5 BAC68885.1 Non-secretory protein CDS SAVERM_1176 1466827 1466669 hypothetical protein 7.62 5234 A no similarity 6 BAC68886.1 Non-secretory protein CDS SAVERM_1177 1468402 1466876 putative acyl-CoA synthetase PF00501: AMP-binding enzyme 7.35 53674 A metabolism of lipids 2.4 BAC68887.1 Non-secretory protein CDS SAVERM_1178 1470597 1468399 pabAB putative para-aminobenzoic acid synthase similar to Streptomyces griseus pabAB, PF00425: chorismate binding enzyme 7.21 80145 A metabolism of coenzymes & prosthetic groups 2.5 BAC68888.1 Non-secretory protein CDS SAVERM_1179 1471157 1470594 hypothetical protein 9.41 19909 A similar to unknown proteins 5 BAC68889.1 Non-secretory protein CDS SAVERM_1180 1471456 1473141 putative family M6 peptidase PF05547: Immune inhibitor A peptidase M6 4.93 60198 A protein modification 3.8 BAC68890.1 Non-secretory protein CDS SAVERM_1181 1473145 1473453 hypothetical protein 6.8 10998 A no similarity 6 BAC68891.1 Non-secretory protein CDS SAVERM_1182 1473954 1474355 hypothetical protein 6.95 15156 A no similarity 6 BAC68892.1 Non-secretory protein CDS SAVERM_1183 1474949 1474359 hypothetical protein PF04264: YceI like family 7.97 21260 A similar to unknown proteins 5 BAC68893.1 Non-secretory protein CDS SAVERM_1184 1475033 1475533 putative MarR-family transcriptional regulator PF01047: MarR family 5.22 17719 A regulation 3.5.2 BAC68894.1 Non-secretory protein CDS SAVERM_1185 1476667 1475897 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 9.49 27506 A regulation 3.5.2 BAC68895.1 Non-secretory protein CDS SAVERM_1186 1476726 1477133 hypothetical protein 10.05 14935 A similar to unknown proteins 5 BAC68896.1 Non-secretory protein CDS SAVERM_1187 1478626 1477301 aldH putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.85 47449 A specific pathways 2.1.1 BAC68897.1 Non-secretory protein CDS SAVERM_1188 1479232 1478786 amiA putative MarR-family transcriptional regulator PF01047: MarR family 7.16 16719 A regulation 3.5.2 BAC68898.1 Non-secretory protein CDS SAVERM_1189 1479316 1480428 amiC putative acetamidase regulatory protein PF01094: Receptor family ligand binding region 6.6 39877 A regulation 3.5.2 BAC68899.1 Non-secretory protein CDS SAVERM_1190 1480655 1481956 livK1 putative branched-chain amino acid ABC transporter substrate-binding protein Tat substrate, PF01094: Receptor family ligand binding region 9.81 45891 A transport / binding proteins & lipoproteins 1.2 BAC68900.1 Signal peptide CDS SAVERM_1191 1482024 1482920 livH1 putative branched-chain amino acid ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.81 31369 A transport / binding proteins & lipoproteins 1.2 BAC68901.1 Non-secretory protein CDS SAVERM_1192 1482917 1484026 livM1 putative branched-chain amino acid ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.22 38436 A transport / binding proteins & lipoproteins 1.2 BAC68902.1 Non-secretory protein CDS SAVERM_1193 1484023 1484829 livG1 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 4.74 28600 A transport / binding proteins & lipoproteins 1.2 BAC68903.1 Non-secretory protein CDS SAVERM_1194 1484829 1485521 livF1 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 8.75 24479 A transport / binding proteins & lipoproteins 1.2 BAC68904.1 Non-secretory protein CDS SAVERM_1195 1486716 1485526 sig16 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 6.39 43549 A RNA initiation 3.5.1 BAC68905.1 Non-secretory protein CDS SAVERM_1196 1487108 1486716 hypothetical protein PF04946: DGPF domain 4.78 14006 A similar to unknown proteins 5 BAC68906.1 Non-secretory protein CDS SAVERM_1197 1487174 1488235 hypothetical protein PF02771: Acyl-CoA dehydrogenase, N-terminal domain 6.8 37599 A similar to unknown proteins 5 BAC68907.1 Non-secretory protein CDS SAVERM_1198 1488724 1488921 putative IS607 familyISTvo1-like transposase IS607 family, partial 11.72 6700 A transposon & IS 4.5 BAC68908.1 Non-secretory protein CDS SAVERM_1199 1490019 1488976 bdpC putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.58 37091 A regulation 3.5.2 BAC68909.1 Non-secretory protein CDS SAVERM_1200 1490156 1491082 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.37 32140 A miscellaneous 4.7 BAC68910.1 Non-secretory protein CDS SAVERM_1201 1491478 1492473 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 8.77 34900 U miscellaneous 4.7 BAC68911.1 Non-secretory protein CDS SAVERM_1202 1492522 1493124 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.57 21771 U regulation 3.5.2 BAC68912.1 Non-secretory protein CDS SAVERM_1203 1493815 1493561 hypothetical protein 6.51 9090 U no similarity 6 BAC68913.1 Non-secretory protein CDS SAVERM_1204 1495142 1493973 putative IS630 family ISPsy1-like transposase IS3 family (1495177..1493942) Inverted repeat sequence (27/29 bp). Target sequence (CTAG). 11.05 42569 U transposon & IS 4.5 BAC68914.1 Non-secretory protein CDS SAVERM_1205 1496359 1495178 ssuD1 putative alkanesulfonate monooxygenase PF00296: Luciferase-like monooxygenase 6.05 42529 U miscellaneous 4.7 BAC68915.1 Non-secretory protein CDS SAVERM_1206 1497601 1496417 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.61 42238 U metabolism of lipids 2.4 BAC68916.1 Non-secretory protein CDS SAVERM_1207 1498161 1497607 putative NAD(P)H-dependent FMN reductase PF03358: NADPH-dependent FMN reductase 6.35 19101 U metabolism of coenzymes & prosthetic groups 2.5 BAC68917.1 Non-secretory protein CDS SAVERM_1208 1499448 1498327 putative monooxygenase PF00296: Luciferase-like monooxygenase 4.99 41700 U miscellaneous 4.7 BAC68918.1 Non-secretory protein CDS SAVERM_1209 1499955 1500875 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.25 33491 U regulation 3.5.2 BAC68919.1 Non-secretory protein CDS SAVERM_1210 1500906 1501055 hypothetical protein 13.24 5389 U no similarity 6 BAC68920.1 Non-secretory protein CDS SAVERM_1211 1501530 1503104 putative oxidoreductase PF01073: 3-beta-hydroxysteroid dehydrogenase/isomerase family 9.71 57605 U miscellaneous 4.7 BAC68921.1 Non-secretory protein CDS SAVERM_1212 1503492 1504865 phrB putative deoxyribodipyrimidine photolyase PF03441: FAD binding domain of DNA photolyase 8.65 50911 U DNA modification & repair 3.2 BAC68922.1 Non-secretory protein CDS SAVERM_1213 1506178 1504925 putative oxidoreductase PF01593: Flavin containing amine oxidoreductase 8.99 44404 U miscellaneous 4.7 BAC68923.1 Non-secretory protein CDS SAVERM_1214 1507527 1506484 litR putative MerR-family transcriptional regulator probably repressor/activator for carotenoid biosynthesis, PF00376: MerR family regulatory protein 11.07 36320 U regulation 3.5.2 BAC68924.1 Non-secretory protein CDS SAVERM_1215 1507710 1508324 litS putative RNA polymerase ECF-subfamily sigma factor (sig17) probably sigma factor for transcription of carotenoid biosynthesis, PF04542: Sigma-70 region 2 10.61 22571 U RNA initiation 3.5.1 BAC68925.1 Non-secretory protein CDS SAVERM_1216 1508862 1509881 putative membrane protein, ribonuclease BN-like family PF03631: Ribonuclease BN-like family 12.08 35908 U miscellaneous 4.7 BAC68926.1 Signal peptide CDS SAVERM_1217 1510692 1509820 blaB2 putative metallo-beta-lactamase PF00753: Metallo-beta-lactamase superfamily 6.63 32239 U detoxification 4.2 BAC68927.1 Non-secretory protein CDS SAVERM_1218 1510755 1511354 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.68 21468 U regulation 3.5.2 BAC68928.1 Non-secretory protein CDS SAVERM_1219 1511493 1511933 putative membrane protein PF03779: SPW repeat 7.51 15607 U miscellaneous 4.7 BAC68929.1 Non-secretory protein CDS SAVERM_1220 1512151 1513404 hypothetical protein PF01636: Phosphotransferase enzyme family 5.06 44420 U similar to unknown proteins 5 BAC68930.1 Non-secretory protein CDS SAVERM_1221 1515119 1513650 putative amino acid permease PF00324: Amino acid permease 9.26 52769 U transport / binding proteins & lipoproteins 1.2 BAC68931.1 Non-secretory protein CDS SAVERM_1222 1515303 1516502 putative ROK-family transcriptional regulator PF00480: ROK family 9.7 42061 U regulation 3.5.2 BAC68932.1 Non-secretory protein CDS SAVERM_1223 1516617 1519331 csxA exo-beta-D-glucosaminidase, secreted Tat substrate, PF02837: Glycosyl hydrolases family 2, sugar binding domain 7.3 97182 U specific pathways 2.1.1 BAC68933.1 Signal peptide CDS SAVERM_1224 1520858 1519410 putative hydrolase, secreted PF02018: Carbohydrate binding domain 4.11 49436 U miscellaneous 4.7 BAC68934.1 Signal peptide CDS SAVERM_1225 1521090 1521353 putative transglycosylase associated protein PF04226: Transglycosylase associated protein 10.12 8997 U miscellaneous 4.7 BAC68935.1 Non-secretory protein CDS SAVERM_1226 1521511 1522497 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.44 35737 U miscellaneous 4.7 BAC68936.1 Non-secretory protein CDS SAVERM_1227 1523400 1522627 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.83 27706 U miscellaneous 4.7 BAC68937.1 Non-secretory protein CDS SAVERM_1228 1523648 1524178 hypothetical protein possible transporter 10.88 17471 U similar to unknown proteins 5 BAC68938.1 Non-secretory protein CDS SAVERM_1229 1525243 1524392 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.45 29980 U miscellaneous 4.7 BAC68939.1 Non-secretory protein CDS SAVERM_1230 1526181 1525501 putative secreted protein PF03777: Small secreted domain (DUF320) 11.12 21645 U miscellaneous 4.7 BAC68940.1 Signal peptide CDS SAVERM_1231 1526437 1528074 putative secreted tripeptidyl-peptidase C PF08386: TAP-like protein 5.02 57119 U protein modification 3.8 BAC68941.1 Signal peptide CDS SAVERM_1232 1528178 1529773 yerD2 putative glutamate synthase(ferredoxin) Tat substrate, PF01645: Conserved region in glutamate synthase 8.41 56838 U metabolism of amino acids & related molecules 2.2 BAC68942.1 Non-secretory protein CDS SAVERM_1233 1529952 1531049 hypothetical protein PF03465: eRF1 domain 3 5.11 39895 U similar to unknown proteins 5 BAC68943.1 Non-secretory protein CDS SAVERM_1234 1531131 1532162 iolG1 putative myo-inositol 2-dehydrogenase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 5.1 36308 U specific pathways 2.1.1 BAC68944.1 Non-secretory protein CDS SAVERM_1235 1532453 1533922 prpC5 putative magnesium or manganese-dependent protein phosphatase PF00785: PAC motif 5.18 52450 U protein modification 3.8 BAC68945.1 Non-secretory protein CDS SAVERM_1236 1535540 1534044 putative regulatory protein 6.85 54660 U regulation 3.5.2 BAC68946.1 Non-secretory protein CDS SAVERM_1237 1535774 1536916 hypothetical protein PF01636: Phosphotransferase enzyme family 11.04 41137 U similar to unknown proteins 5 BAC68947.1 Non-secretory protein CDS SAVERM_1238 1537201 1539180 putative amidase PF01510: N-acetylmuramoyl-L-alanine amidase 6.51 70219 U miscellaneous 4.7 BAC68948.1 Signal peptide CDS SAVERM_1239 1539740 1539243 hypothetical protein 4.11 17895 U similar to unknown proteins 5 BAC68949.1 Non-secretory protein CDS SAVERM_1240 1540024 1540284 hypothetical protein 12.25 9193 U no similarity 6 BAC68950.1 Non-secretory protein CDS SAVERM_1241 1540710 1540468 hypothetical protein homology to bldB, PF04149: Domain of unknown function (DUF397) 4.41 8783 U similar to unknown proteins 5 BAC68951.1 Non-secretory protein CDS SAVERM_1242 1541960 1540794 putative nonspecific lipid-transfer protein 5.81 41446 U metabolism of lipids 2.4 BAC68952.1 Non-secretory protein CDS SAVERM_1243 1543006 1541957 putative nonspecific lipid-transfer protein 5.38 36829 U metabolism of lipids 2.4 BAC68953.1 Non-secretory protein CDS SAVERM_1244 1543923 1543003 hypothetical protein PF01796: Domain of unknown function DUF35 5.19 33098 U similar to unknown proteins 5 BAC68954.1 Non-secretory protein CDS SAVERM_1245 1544753 1543977 echA4 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 7.05 27617 U metabolism of lipids 2.4 BAC68955.1 Non-secretory protein CDS SAVERM_1246 1544829 1546583 fadD4 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 5.29 62939 U metabolism of lipids 2.4 BAC68956.1 Non-secretory protein CDS SAVERM_1247 1546700 1547473 cpdA putative cyclic nucleotide phosphodiesterase PF00149: Calcineurin-like phosphoesterase 5.82 27128 U metabolism of nucleotides & nucleic acids 2.3 BAC68957.1 Non-secretory protein CDS SAVERM_1248 1548623 1547571 hypothetical protein PF01590: GAF domain 4.83 37799 U similar to unknown proteins 5 BAC68958.1 Non-secretory protein CDS SAVERM_1249 1549424 1551430 putative modular polyketide synthase nrps8 gene cluster 6.12 70925 U antibiotic production 4.3 BAC68959.1 Non-secretory protein CDS SAVERM_1250 1551427 1552974 nrps8 putative non-ribosomal peptide synthetase nrps8 gene cluster, PF00501: AMP-binding enzyme 5.22 55351 U antibiotic production 4.3 BAC68960.1 Non-secretory protein CDS SAVERM_1251 1553040 1554224 putative hydroxylase nrps8 gene cluster 6.68 42499 U miscellaneous 4.7 BAC68961.1 Non-secretory protein CDS SAVERM_1252 1554555 1557221 cvnA1 putative sensor-like histidine kinase multi-component regulatory system-1 6.52 93501 U sensors 1.3 BAC68962.1 Non-secretory protein CDS SAVERM_1253 1557218 1557667 cvnB1 hypothetical protein multi-component regulatory system-1, PF03259: Roadblock/LC7 domain 8.53 16111 U similar to unknown proteins 5 BAC68963.1 Non-secretory protein CDS SAVERM_1254 1557660 1558034 cvnC1 hypothetical protein multi-component regulatory system-1, PF05331: Protein of unknown function (DUF742) 5.16 13782 U similar to unknown proteins 5 BAC68964.1 Non-secretory protein CDS SAVERM_1255 1558015 1558614 cvnD1 putative ATP/GTP-binding protein multi-component regulatory system-1 4.35 21028 U miscellaneous 4.7 BAC68965.1 Non-secretory protein CDS SAVERM_1256 1559469 1558633 putative family S33 peptidase PF00561: alpha/beta hydrolase fold 4.56 29836 U miscellaneous 4.7 BAC68966.1 Non-secretory protein CDS SAVERM_1257 1559656 1560951 paaK putative phenylacetate:CoA ligase PF00501: AMP-binding enzyme 5.41 47853 U specific pathways 2.1.1 BAC68967.1 Non-secretory protein CDS SAVERM_1258 1562499 1561000 fadD5 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 4.96 54396 U metabolism of lipids 2.4 BAC68968.1 Non-secretory protein CDS SAVERM_1259 1564346 1562796 fadD6 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.51 56513 U metabolism of lipids 2.4 BAC68969.1 Non-secretory protein CDS SAVERM_1260 1565452 1564343 putative dioxygenase PF03060: 2-nitropropane dioxygenase 5.28 39128 U detoxification 4.2 BAC68970.1 Non-secretory protein CDS SAVERM_1261 1565622 1567469 blaA1 putative beta-lactamase, secreted Tat substrate, PF00144: Beta-lactamase 6.77 66311 U detoxification 4.2 BAC68971.1 Signal peptide CDS SAVERM_1262 1567506 1568018 hypothetical protein 6.79 18174 U similar to unknown proteins 5 BAC68972.1 Non-secretory protein CDS SAVERM_1263 1569079 1568444 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.06 23083 U regulation 3.5.2 BAC68973.1 Non-secretory protein CDS SAVERM_1264 1570686 1569085 putative oxidoreductase PF01593: Flavin containing amine oxidoreductase 5.49 56855 U miscellaneous 4.7 BAC68974.1 Non-secretory protein CDS SAVERM_1265 1573232 1570968 pkn4 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7.87 82764 U protein modification 3.8 BAC68975.1 Non-secretory protein CDS SAVERM_1266 1574150 1573293 hypothetical protein 10.12 31383 U similar to unknown proteins 5 BAC68976.1 Non-secretory protein CDS SAVERM_1267 1575338 1574160 fadE14 putative acyl-CoA dehydrogenase PF02770: Acyl-CoA dehydrogenase, middle domain 7.77 43840 U metabolism of lipids 2.4 BAC68977.1 Non-secretory protein CDS SAVERM_1268 1576035 1575577 hypothetical protein PF03860: Domain of Unknown Function (DUF326) 5.02 16621 U/P similar to unknown proteins 5 BAC68978.1 Signal peptide CDS SAVERM_1269 1576669 1576268 hypothetical protein 5.21 14354 P similar to unknown proteins 5 BAC68979.1 Non-secretory protein CDS SAVERM_1270 1576753 1577319 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 9.54 21462 P regulation 3.5.2 BAC68980.1 Non-secretory protein CDS SAVERM_1271 1578050 1577424 putative DNA-binding protein PF01381: Helix-turn-helix 4.72 22236 P regulation 3.5.2 BAC68981.1 Non-secretory protein CDS SAVERM_1272 1579200 1578130 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.97 37253 P miscellaneous 4.7 BAC68982.1 Non-secretory protein CDS SAVERM_1273 1581717 1579336 xfp putative xylulose-5-phosphate/fructose-6-phosphate phosphoketolase PF03894: D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase 6.47 88061 P main glycolytic pathways 2.1.2 BAC68983.1 Non-secretory protein CDS SAVERM_1274 1581753 1582556 pvdS putative regulatory protein PF03976: Domain of unknown function (DUF344) 9.76 31414 P regulation 3.5.2 BAC68984.1 Non-secretory protein CDS SAVERM_1275 1583443 1582571 putative stress-inducible protein PF00582: Universal stress protein family 7.75 30727 P adaptation to atypical conditions 4.1 BAC68985.1 Non-secretory protein CDS SAVERM_1276 1583880 1583527 hypothetical protein 12.4 12195 P similar to unknown proteins 5 BAC68986.1 Non-secretory protein CDS SAVERM_1277 1586992 1583840 putative membrane protein PF05729: NACHT domain 10.98 110687 P miscellaneous 4.7 BAC68987.1 Non-secretory protein CDS SAVERM_1278 1587146 1587679 putative CRP-like regulatory protein PF00027: Cyclic nucleotide-binding domain 9.3 19763 P regulation 3.5.2 BAC68988.1 Non-secretory protein CDS SAVERM_1279 1587800 1588627 hypothetical protein PF04672: Protein of unknown function (DUF574) 5.18 30236 P similar to unknown proteins 5 BAC68989.1 Non-secretory protein CDS SAVERM_1280 1589567 1588857 putative dehydrogenase PF00106: short chain dehydrogenase 4.73 24755 P miscellaneous 4.7 BAC68990.1 Non-secretory protein CDS SAVERM_1281 1590874 1589771 putative two-component system sensor kinase PF07730: Histidine kinase 8.27 39192 P sensors 1.3 BAC68991.1 Non-secretory protein CDS SAVERM_1282 1591551 1590871 putative two-component system response regulator PF00072: Response regulator receiver domain 4.7 23988 P regulation 3.5.2 BAC68992.1 Non-secretory protein CDS SAVERM_1283 1591712 1592941 putative membrane protein PF04235: Protein of unknown function (DUF418) 9.53 42491 P miscellaneous 4.7 BAC68993.1 Non-secretory protein CDS SAVERM_1284 1593064 1593717 hypothetical protein PF00300: Phosphoglycerate mutase family 9.17 23189 P similar to unknown proteins 5 BAC68994.1 Non-secretory protein CDS SAVERM_1285 1594134 1595126 dak1 putative dihydroxyacetone kinase subunit 1 PF02733: Dak1 domain 4.47 34466 P specific pathways 2.1.1 BAC68995.1 Non-secretory protein CDS SAVERM_1286 1595172 1595771 dak2 putative dihydroxyacetone kinase subunit 2 PF02734: Dak2 domain 4.36 20454 P specific pathways 2.1.1 BAC68996.1 Non-secretory protein CDS SAVERM_1287 1595764 1596180 putative dihydroxyacetone kinase phosphotransfer protein PF03610: PTS system fructose IIA component 3.88 13176 P transport / binding proteins & lipoproteins 1.2 BAC68997.1 Non-secretory protein CDS SAVERM_1288 1597128 1596355 putative secreted protein PF07335: Fungal chitosanase 5.13 27201 P miscellaneous 4.7 BAC68998.1 Signal peptide CDS SAVERM_1289 1597420 1598451 putative sugar hydrolase, secreted Tat substrate, PF00041: Fibronectin type III domain 10.93 36237 P miscellaneous 4.7 BAC68999.1 Non-secretory protein CDS SAVERM_1290 1598664 1599200 putative secreted protein 11.3 17676 P similar to unknown proteins 5 BAC69000.1 Signal peptide CDS SAVERM_1291 1599819 1599274 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6.64 20727 P regulation 3.5.2 BAC69001.1 Non-secretory protein CDS SAVERM_1292 1601877 1599862 fadH putative 2,4-dienoyl-CoA reductase PF00724: NADH:flavin oxidoreductase / NADH oxidase family 5.98 72234 P metabolism of lipids 2.4 BAC69002.1 Non-secretory protein CDS SAVERM_1293 1602994 1602176 putative methytransferase PF01170: Putative RNA methylase family UPF0020 4.79 28153 P miscellaneous 4.7 BAC69003.1 Signal peptide CDS SAVERM_1294 1604291 1603173 putative secreted protein PF01061: ABC-2 type transporter 7.39 39176 P similar to unknown proteins 5 BAC69004.1 Non-secretory protein CDS SAVERM_1295 1604339 1604869 putative MarR-family transcriptional regulator PF01047: MarR family 6.09 19397 P regulation 3.5.2 BAC69005.1 Non-secretory protein CDS SAVERM_1296 1605814 1604909 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.44 32218 P miscellaneous 4.7 BAC69006.1 Non-secretory protein CDS SAVERM_1297 1606731 1605811 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.92 30988 P miscellaneous 4.7 BAC69007.1 Non-secretory protein CDS SAVERM_1298 1606980 1607585 hypothetical protein PF00174: Oxidoreductase molybdopterin binding domain 5.96 22259 P similar to unknown proteins 5 BAC69008.1 Non-secretory protein CDS SAVERM_1299 1607578 1608333 putative oxidoreductase PF00970: Oxidoreductase FAD-binding domain 6.97 27114 P miscellaneous 4.7 BAC69009.1 Non-secretory protein CDS SAVERM_1300 1609238 1608351 putative stress-inducible protein PF00582: Universal stress protein family 8.78 30890 P adaptation to atypical conditions 4.1 BAC69010.1 Non-secretory protein CDS SAVERM_1301 1609344 1610210 putative membrane protein 11.78 31497 P miscellaneous 4.7 BAC69011.1 Non-secretory protein CDS SAVERM_1302 1610532 1611500 axe1 putative acetyl xylan esterase PF05448: Acetyl xylan esterase (AXE1) 4.94 35067 P detoxification 4.2 BAC69012.1 Non-secretory protein CDS SAVERM_1303 1611497 1611916 hypothetical protein PF02136: Nuclear transport factor 2 (NTF2) domain 5.6 15505 P no similarity 6 BAC69013.1 Non-secretory protein CDS SAVERM_1304 1612092 1613258 putative esterase PF00144: Beta-lactamase 4.96 41446 P miscellaneous 4.7 BAC69014.1 Non-secretory protein CDS SAVERM_1305 1613379 1614131 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 7.02 27334 P regulation 3.5.2 BAC69015.1 Non-secretory protein CDS SAVERM_1306 1615050 1614307 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 8.34 26715 P miscellaneous 4.7 BAC69016.1 Non-secretory protein CDS SAVERM_1307 1615206 1616795 dexA putative oligo-1,6-glucosidase PF00128: Alpha amylase, catalytic domain 4.77 57746 P specific pathways 2.1.1 BAC69017.1 Non-secretory protein CDS SAVERM_1308 1618053 1616797 cyp6 cytochrome P450 hydroxylase CYP154D1 6.2 44854 P metabolism of coenzymes & prosthetic groups 2.5 BAC69018.1 Non-secretory protein CDS SAVERM_1309 1619378 1618155 hypothetical protein PF02771: Acyl-CoA dehydrogenase, N-terminal domain 6.39 43912 P similar to unknown proteins 5 BAC69019.1 Non-secretory protein CDS SAVERM_1310 1619721 1620860 rho2 putative transcription termination factor PF00006: ATP synthase alpha/beta family, nucleotide-binding domain 10.09 40927 P DNA termination 3.5.4 BAC69020.1 Non-secretory protein CDS SAVERM_1311 1620939 1622105 dacA putative D-alanyl-D-alanine carboxypeptidase PF00768: D-alanyl-D-alanine carboxypeptidase 8.46 39453 P cell wall 1.1 BAC69021.1 Signal peptide CDS SAVERM_1312 1623214 1621832 putative membrane protein 11.31 48745 P miscellaneous 4.7 BAC69022.1 Non-secretory protein CDS SAVERM_1313 1624611 1623211 putative secreted protein PF03772: Competence protein 10.8 47065 P similar to unknown proteins 5 BAC69023.1 Non-secretory protein CDS SAVERM_1314 1625687 1624746 glsA putative glutaminase PF04960: Glutaminase 4.86 33299 P metabolism of amino acids & related molecules 2.2 BAC69024.1 Non-secretory protein CDS SAVERM_1315 1627303 1625891 aspA putative L-aspartate ammonia-lyase aspartase, PF00206: Lyase 5.45 49621 P metabolism of amino acids & related molecules 2.2 BAC69025.1 Non-secretory protein CDS SAVERM_1316 1628381 1627395 ansA1 putative L-asparaginase II PF06089: L-asparaginase II 6.51 34221 P metabolism of amino acids & related molecules 2.2 BAC69026.1 Non-secretory protein CDS SAVERM_1317 1629883 1628423 ansP1 putative L-asparagine permease PF00324: Amino acid permease 9.33 51578 P transport / binding proteins & lipoproteins 1.2 BAC69027.1 Non-secretory protein CDS SAVERM_1318 1630647 1629880 putative L-asparagine operon repressor GntR-family transcriptional regulator, PF07729: FCD domain 5.59 28223 P regulation 3.5.2 BAC69028.1 Non-secretory protein CDS SAVERM_1319 1631580 1630747 bacA1 putative undecaprenyl-diphosphatase uppP1, PF02673: Bacitracin resistance protein BacA 8.83 29283 P cell wall 1.1 BAC69029.1 Non-secretory protein CDS SAVERM_1320 1632024 1631650 crcB1 putative camphor resistance protein CrcB PF02537: CrcB-like protein 6.49 12781 P miscellaneous 4.7 BAC69030.1 Non-secretory protein CDS SAVERM_1321 1632263 1632021 hypothetical protein PF02641: Uncharacterized ACR, COG1993 8.52 8601 P miscellaneous 4.7 BAC69031.1 Non-secretory protein CDS SAVERM_1322 1632736 1632260 crcB2 putative camphor resistance protein CrcB PF02537: CrcB-like protein 12.21 16696 P miscellaneous 4.7 BAC69032.1 Non-secretory protein CDS SAVERM_1323 1633446 1633159 hypothetical protein PF01726: LexA DNA binding domain 10.82 10842 P similar to unknown proteins 5 BAC69033.1 Non-secretory protein CDS SAVERM_1324 1635185 1633617 putative arabinogalactan endo-1,4-beta-galactosidase, secreted Tat substrate, PF07745: Glycosyl hydrolase family 53 6.32 55177 P specific pathways 2.1.1 BAC69034.1 Signal peptide CDS SAVERM_1325 1637341 1635320 bga2 putative beta-galactosidase PF02449: Beta-galactosidase 5.28 74389 P specific pathways 2.1.1 BAC69035.1 Non-secretory protein CDS SAVERM_1326 1637527 1638846 putative ABC transporter substrate-binding protein PF00497: Bacterial extracellular solute-binding proteins, family 3 9.27 46795 P transport / binding proteins & lipoproteins 1.2 BAC69036.1 Signal peptide CDS SAVERM_1327 1638843 1639766 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.03 32883 P transport / binding proteins & lipoproteins 1.2 BAC69037.1 Non-secretory protein CDS SAVERM_1328 1639763 1640668 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.55 32502 P transport / binding proteins & lipoproteins 1.2 BAC69038.1 Non-secretory protein CDS SAVERM_1329 1640665 1641696 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.97 36759 P regulation 3.5.2 BAC69039.1 Non-secretory protein CDS SAVERM_1330 1641935 1642291 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.05 12499 P similar to unknown proteins 5 BAC69040.1 Non-secretory protein CDS SAVERM_1331 1642375 1642764 putative MarR-family transcriptional regulator PF01047: MarR family 7.51 14184 P regulation 3.5.2 BAC69041.1 Non-secretory protein CDS SAVERM_1332 1642815 1643843 putative oxidoreductase PF02913: FAD linked oxidases, C-terminal domain 6.18 35144 P miscellaneous 4.7 BAC69042.1 Non-secretory protein CDS SAVERM_1333 1644448 1644029 hypothetical protein 3.7 14300 P similar to unknown proteins 5 BAC69043.1 Non-secretory protein CDS SAVERM_1334 1645153 1646346 prpB6 putative magnesium or manganese-dependent protein phosphatase PF07228: Stage II sporulation protein E (SpoIIE) 6.58 42639 P protein modification 3.8 BAC69044.1 Non-secretory protein CDS SAVERM_1335 1646920 1646423 hypothetical protein PF00583: Acetyltransferase (GNAT) family 11.94 18166 P no similarity 6 BAC69045.1 Non-secretory protein CDS SAVERM_1336 1648022 1647024 sseC putative thiosulfate sulfurtransferase PF00581: Rhodanese-like domain 6.37 35386 P miscellaneous 4.7 BAC69046.1 Non-secretory protein CDS SAVERM_1337 1648366 1649301 putative ABC transporter substrate-binding protein PF09084: NMT1/THI5 like 5.83 34153 P transport / binding proteins & lipoproteins 1.2 BAC69047.1 Non-secretory protein CDS SAVERM_1338 1649428 1650465 ssuA1 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding protein, PF09084: NMT1/THI5 like 8.3 37068 P transport / binding proteins & lipoproteins 1.2 BAC69048.1 Signal peptide CDS SAVERM_1339 1650462 1651235 ssuC1 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 10.7 27770 P transport / binding proteins & lipoproteins 1.2 BAC69049.1 Non-secretory protein CDS SAVERM_1340 1651199 1652026 ssuB1 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein, PF00005: ABC transporter 5.82 29452 P transport / binding proteins & lipoproteins 1.2 BAC69050.1 Non-secretory protein CDS SAVERM_1341 1652023 1653147 hypothetical protein PF01636: Phosphotransferase enzyme family 6.1 41053 P similar to unknown proteins 5 BAC69051.1 Non-secretory protein CDS SAVERM_1342 1653663 1655132 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.71 49473 P transport / binding proteins & lipoproteins 1.2 BAC69052.1 Non-secretory protein CDS SAVERM_1343 1656512 1655307 hypothetical protein PF00923: Transaldolase 7.08 43972 P similar to unknown proteins 5 BAC69053.1 Non-secretory protein CDS SAVERM_1344 1657990 1656575 putative dehydrogenase PF01593: Flavin containing amine oxidoreductase 8.73 49507 P miscellaneous 4.7 BAC69054.1 Non-secretory protein CDS SAVERM_1345 1659725 1657983 putative membrane protein 8.35 63012 P miscellaneous 4.7 BAC69055.1 Non-secretory protein CDS SAVERM_1346 1661201 1659744 putative acyl-CoA synthetase PF00501: AMP-binding enzyme 5.5 50689 P metabolism of lipids 2.4 BAC69056.1 Non-secretory protein CDS SAVERM_1347 1662823 1661612 gcdH2 putative glutaryl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.37 44575 P metabolism of lipids 2.4 BAC69057.1 Non-secretory protein CDS SAVERM_1348 1663776 1662820 fadC7 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 4.89 33986 P metabolism of lipids 2.4 BAC69058.1 Non-secretory protein CDS SAVERM_1349 1664570 1663815 adc putative acetoacetate decarboxylase similar to Adc(NP_149328) of acetone/butanol-producing Clostridium acetobutylicum, PF06314: Acetoacetate decarboxylase (ADC) 5.79 27509 P specific pathways 2.1.1 BAC69059.1 Non-secretory protein CDS SAVERM_1350 1665361 1664591 echA5 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 6.29 26407 P metabolism of lipids 2.4 BAC69060.1 Non-secretory protein CDS SAVERM_1351 1666557 1665388 putative fatty acid-CoA racemase PF02515: CoA-transferase family III 4.91 41325 P miscellaneous 4.7 BAC69061.1 Non-secretory protein CDS SAVERM_1352 1667637 1666726 putative LysR-family transcriptional regulator PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 5.44 33795 P regulation 3.5.2 BAC69062.1 Non-secretory protein CDS SAVERM_1353 1669231 1667828 putative secreted protein PF00754: F5/8 type C domain 6.51 50307 P miscellaneous 4.7 BAC69063.1 Signal peptide CDS SAVERM_1354 1671080 1669689 putative amino acid permease PF00324: Amino acid permease 9.74 48859 P transport / binding proteins & lipoproteins 1.2 BAC69064.1 Non-secretory protein CDS SAVERM_1355 1672004 1671135 putative hydrolase PF00795: Carbon-nitrogen hydrolase 5.03 31349 P miscellaneous 4.7 BAC69065.1 Non-secretory protein CDS SAVERM_1356 1672099 1672869 putative GntR-family transcriptional regulator PF07729: FCD domain 6.51 27554 P regulation 3.5.2 BAC69066.1 Non-secretory protein CDS SAVERM_1357 1673000 1674022 adhA2 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.52 34946 P specific pathways 2.1.1 BAC69067.1 Non-secretory protein CDS SAVERM_1358 1674853 1674152 hypothetical protein PF01370: NAD dependent epimerase/dehydratase family 5.95 24790 P similar to unknown proteins 5 BAC69068.1 Non-secretory protein CDS SAVERM_1359 1674937 1675689 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.31 27234 P regulation 3.5.2 BAC69069.1 Non-secretory protein CDS SAVERM_1360 1675968 1676225 hypothetical protein 10.52 8687 P no similarity 6 BAC69070.1 Non-secretory protein CDS SAVERM_1361 1676443 1677468 hypothetical protein 5.29 37460 P no similarity 6 BAC69071.1 Non-secretory protein CDS SAVERM_1362 1678258 1677776 putative transcriptional regulator PF02082: Transcriptional regulator 5.16 16543 P regulation 3.5.2 BAC69072.1 Non-secretory protein CDS SAVERM_1363 1678404 1679132 putative secreted protein PF01113: Dihydrodipicolinate reductase, N-terminus 4.72 25242 P miscellaneous 4.7 BAC69073.1 Signal peptide CDS SAVERM_1364 1679068 1680150 hypothetical protein 10.21 39444 P similar to unknown proteins 5 BAC69074.1 Non-secretory protein CDS SAVERM_1365 1680689 1680147 hypothetical protein PF08768: Domain of unknown function (DUF1794) 6.23 20008 P similar to unknown proteins 5 BAC69075.1 Non-secretory protein CDS SAVERM_1366 1680974 1683826 putative metalloprotease, secreted PF01447: Thermolysin metallopeptidase, catalytic domain 5.18 99568 P protein modification 3.8 BAC69076.1 Signal peptide CDS SAVERM_1367 1684810 1684007 putative dehydrogenase PF00106: short chain dehydrogenase 5.35 27286 P miscellaneous 4.7 BAC69077.1 Non-secretory protein CDS SAVERM_1368 1685763 1684807 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.62 33799 P miscellaneous 4.7 BAC69078.1 Non-secretory protein CDS SAVERM_1369 1686236 1686775 hypothetical protein PF04341: Protein of unknown function, DUF485 9.41 19957 P similar to unknown proteins 5 BAC69079.1 Non-secretory protein CDS SAVERM_1370 1686772 1688388 putative sodium:solute symporter PF00474: Sodium:solute symporter family 9.02 55991 P transport / binding proteins & lipoproteins 1.2 BAC69080.1 Non-secretory protein CDS SAVERM_1371 1688543 1689622 bdpM putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 7.7 38998 P regulation 3.5.2 BAC69081.1 Non-secretory protein CDS SAVERM_1372 1689619 1691415 ilvB2 putative acetolactate synthase PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.71 61528 P metabolism of amino acids & related molecules 2.2 BAC69082.1 Non-secretory protein CDS SAVERM_1373 1691387 1692040 hypothetical protein 5.82 24941 P no similarity 6 BAC69083.1 Non-secretory protein CDS SAVERM_1374 1692037 1693056 fabH5 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 5.39 36838 P metabolism of lipids 2.4 BAC69084.1 Non-secretory protein CDS SAVERM_1375 1693060 1694154 hisC3 putative histidinol-phosphate aminotransferase EC:2.6.1.9, PF00155: Aminotransferase class I and II 9.57 38839 P metabolism of amino acids & related molecules 2.2 BAC69085.1 Non-secretory protein CDS SAVERM_1376 1695211 1694414 hypothetical protein PF07398: Protein of unknown function (DUF1503) 4.81 29163 P similar to unknown proteins 5 BAC69086.1 Non-secretory protein CDS SAVERM_1377 1695415 1695242 hypothetical protein 5.47 5691 P no similarity 6 BAC69087.1 Non-secretory protein CDS SAVERM_1378 1696991 1695483 putative membrane transport protein PF07690: Major Facilitator Superfamily 9.71 51819 P transport / binding proteins & lipoproteins 1.2 BAC69088.1 Non-secretory protein CDS SAVERM_1379 1697123 1697560 putative MarR-family transcriptional regulator PF01047: MarR family 9.68 15608 P regulation 3.5.2 BAC69089.1 Non-secretory protein CDS SAVERM_1380 1698727 1697945 fabG2 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 5.29 26441 P miscellaneous 4.7 BAC69090.1 Non-secretory protein CDS SAVERM_1381 1699994 1698729 fadE15 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.56 46301 P metabolism of lipids 2.4 BAC69091.1 Non-secretory protein CDS SAVERM_1382 1701167 1700439 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.54 26900 P regulation 3.5.2 BAC69092.1 Non-secretory protein CDS SAVERM_1383 1701881 1701234 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.91 22667 P miscellaneous 4.7 BAC69093.1 Non-secretory protein CDS SAVERM_1384 1703210 1702011 fadA5 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase atoB: acetyl-CoA C-acetyltransferase, PF00108: Thiolase, N-terminal domain 5.17 42231 P metabolism of lipids 2.4 BAC69094.1 Non-secretory protein CDS SAVERM_1385 1705092 1703980 hypothetical protein 6.13 41697 P similar to unknown proteins 5 BAC69095.1 Non-secretory protein CDS SAVERM_1386 1708142 1706772 glcD1 putative (S)-2-hydroxy-acid oxidase similar to glycolate oxidase: PF01565: FAD binding domain 4.86 46876 P specific pathways 2.1.1 BAC69096.1 Non-secretory protein CDS SAVERM_1387 1708849 1708139 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 4.89 24624 P regulation 3.5.2 BAC69097.1 Non-secretory protein CDS SAVERM_1388 1708859 1709566 dhbB1 putative isochorismatase PF00857: Isochorismatase family 6.24 25069 P metabolism of coenzymes & prosthetic groups 2.5 BAC69098.1 Non-secretory protein CDS SAVERM_1389 1709632 1710909 hypothetical protein 7.21 46435 P similar to unknown proteins 5 BAC69099.1 Non-secretory protein CDS SAVERM_1390 1711093 1712622 putative aromatic-ring hydroxylase PF00743: Flavin-binding monooxygenase-like 7.01 57014 P specific pathways 2.1.1 BAC69100.1 Non-secretory protein CDS SAVERM_1391 1717072 1714511 prpJ5 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain, PF01590: GAF domain 6.33 92006 P protein modification 3.8 BAC69101.1 Non-secretory protein CDS SAVERM_1392 1719070 1717280 putative transcriptional regulator PF01590: GAF domain 9.02 65277 P RNA initiation 3.5.1 BAC69102.1 Non-secretory protein CDS SAVERM_1393 1719247 1720272 adhA3 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.34 35569 P specific pathways 2.1.1 BAC69103.1 Non-secretory protein CDS SAVERM_1394 1720293 1721894 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 8.32 59036 P transport / binding proteins & lipoproteins 1.2 BAC69104.1 Signal peptide CDS SAVERM_1395 1721916 1722854 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 10.51 34406 P transport / binding proteins & lipoproteins 1.2 BAC69105.1 Non-secretory protein CDS SAVERM_1396 1722851 1723696 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.42 30853 P transport / binding proteins & lipoproteins 1.2 BAC69106.1 Non-secretory protein CDS SAVERM_1397 1723693 1724781 glpS putative multiple sugar ABC transporter ATP-binding protein malK, PF00005: ABC transporter 6.43 39639 P transport / binding proteins & lipoproteins 1.2 BAC69107.1 Non-secretory protein CDS SAVERM_1398 1724783 1725862 glpT putative multiple sugar ABC transporter ATP-binding protein malK, PF00005: ABC transporter 7.7 39706 P transport / binding proteins & lipoproteins 1.2 BAC69108.1 Non-secretory protein CDS SAVERM_1399 1726146 1728530 hypothetical protein PF00350: Dynamin family 5.27 87184 P similar to unknown proteins 5 BAC69109.1 Non-secretory protein CDS SAVERM_1400 1728527 1729672 hypothetical protein 6.79 42294 P no similarity 6 BAC69110.1 Non-secretory protein CDS SAVERM_1401 1729690 1730592 hypothetical protein 6.95 31597 P no similarity 6 BAC69111.1 Non-secretory protein CDS SAVERM_1402 1730649 1731056 hypothetical protein 5.04 15528 P no similarity 6 BAC69112.1 Non-secretory protein CDS SAVERM_1403 1731053 1731502 hypothetical protein 11.87 15616 P no similarity 6 BAC69113.1 Non-secretory protein CDS SAVERM_1404 1732691 1731705 putative oxidoreductase PF00248: Aldo/keto reductase family 6.51 34747 P miscellaneous 4.7 BAC69114.1 Non-secretory protein CDS SAVERM_1405 1733521 1732688 putative amidohydrolase PF04909: Amidohydrolase 4.34 30110 P miscellaneous 4.7 BAC69115.1 Non-secretory protein CDS SAVERM_1406 1734129 1734905 putative GntR-family transcriptional regulator PF07729: FCD domain 5.18 27488 C regulation 3.5.2 BAC69116.1 Non-secretory protein CDS SAVERM_1407 1734993 1738382 hypothetical protein PF00041: Fibronectin type III domain 5.56 120355 C similar to unknown proteins 5 BAC69117.1 Non-secretory protein CDS SAVERM_1408 1738439 1739536 putative racemase PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain 5.11 39976 C miscellaneous 4.7 BAC69118.1 Non-secretory protein CDS SAVERM_1409 1739569 1740954 putative ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 7.88 49924 C transport / binding proteins & lipoproteins 1.2 BAC69119.1 Signal peptide CDS SAVERM_1410 1740951 1741883 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.02 34021 C transport / binding proteins & lipoproteins 1.2 BAC69120.1 Non-secretory protein CDS SAVERM_1411 1741880 1742794 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.77 33502 C transport / binding proteins & lipoproteins 1.2 BAC69121.1 Non-secretory protein CDS SAVERM_1412 1742840 1744534 hypothetical protein PF07883: Cupin domain 5.04 62217 C similar to unknown proteins 5 BAC69122.1 Non-secretory protein CDS SAVERM_1413 1744531 1745499 glkA2 putative glucokinase (very low transcription) PF00480: ROK family 5.9 32827 C main glycolytic pathways 2.1.2 BAC69123.1 Non-secretory protein CDS SAVERM_1414 1747186 1746233 hypothetical protein 8.08 32435 C no similarity 6 BAC69124.1 Non-secretory protein CDS SAVERM_1415 1747778 1747548 putative protease 4.09 8061 C protein modification 3.8 BAC69125.1 Non-secretory protein CDS SAVERM_1416 1748025 1748549 hypothetical protein 4.45 18493 C no similarity 6 BAC69126.1 Non-secretory protein CDS SAVERM_1417 1748916 1749656 hypothetical protein 10.18 27393 C no similarity 6 BAC69127.1 Non-secretory protein CDS SAVERM_1418 1750041 1751474 putative transporter PF00083: Sugar (and other) transporter 9.38 49844 C transport / binding proteins & lipoproteins 1.2 BAC69128.1 Non-secretory protein CDS SAVERM_1419 1753476 1751539 hypothetical protein PF01590: GAF domain 5.93 69083 C similar to unknown proteins 5 BAC69129.1 Non-secretory protein CDS SAVERM_1420 1754346 1753546 bdhA putative 3-hydroxybutyrate dehydrogenase PF00106: short chain dehydrogenase 5.84 27536 C specific pathways 2.1.1 BAC69130.1 Non-secretory protein CDS SAVERM_1421 1754880 1754407 putative MutT-like protein PF00293: NUDIX domain 4.18 17364 C miscellaneous 4.7 BAC69131.1 Non-secretory protein CDS SAVERM_1422 1756548 1754929 ppm1 putative polyprenol-phosphate-mannosyl transferase PF00795: Carbon-nitrogen hydrolase 10.14 57178 C specific pathways 2.1.1 BAC69132.1 Non-secretory protein CDS SAVERM_1423 1756680 1757813 hypothetical protein PF04932: O-Antigen Polymerase 8.58 36860 C similar to unknown proteins 5 BAC69133.1 Non-secretory protein CDS SAVERM_1424 1758407 1757862 hypothetical protein 8.02 19582 C similar to unknown proteins 5 BAC69134.1 Non-secretory protein CDS SAVERM_1425 1759331 1758546 murI putative glutamate racemase PF01177: Asp/Glu/Hydantoin racemase 5.33 26646 C transport / binding proteins & lipoproteins 1.2 BAC69135.1 Non-secretory protein CDS SAVERM_1426 1759390 1760565 putative glycosyltransferase PF00535: Glycosyl transferase 9.18 42459 C specific pathways 2.1.1 BAC69136.1 Non-secretory protein CDS SAVERM_1427 1761915 1760590 terA putative tellurium resistance protein PF02342: Bacterial stress protein 8.45 46960 C detoxification 4.2 BAC69137.1 Non-secretory protein CDS SAVERM_1428 1762252 1762692 hypothetical protein 9.09 15415 C similar to unknown proteins 5 BAC69138.1 Non-secretory protein CDS SAVERM_1429 1762737 1763561 hypothetical protein PF03473: MOSC domain, PF03476: MOSC N-terminal beta barrel domain 5.86 29641 C similar to unknown proteins 5 BAC69139.1 Non-secretory protein CDS SAVERM_1430 1763811 1764416 putative membrane protein 11.73 21976 C miscellaneous 4.7 BAC69140.1 Non-secretory protein CDS SAVERM_1431 1764524 1766962 spoVK putative sporulation protein K-like protein ATPases of the AAA+ class, PF00004: ATPase family associated with various cellular activities (AAA) 4.95 85577 C sporulation 1.8 BAC69141.1 Non-secretory protein CDS SAVERM_1432 1769265 1766932 putative membrane protein 10.9 82999 C miscellaneous 4.7 BAC69142.1 Non-secretory protein CDS SAVERM_1433 1769668 1770498 putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 5.86 28930 C regulation 3.5.2 BAC69143.1 Non-secretory protein CDS SAVERM_1434 1770611 1771090 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 10.94 17291 C similar to unknown proteins 5 BAC69144.1 Non-secretory protein CDS SAVERM_1435 1772267 1771143 cysK1 cysteine synthase/cystathionine beta-synthase family PF00291: Pyridoxal-phosphate dependent enzyme 5.29 41241 C metabolism of amino acids & related molecules 2.2 BAC69145.1 Non-secretory protein CDS SAVERM_1436 1772634 1772957 hypothetical protein 11.37 11530 C similar to unknown proteins 5 BAC69146.1 Non-secretory protein CDS SAVERM_1437 1773206 1773721 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.1 18669 C regulation 3.5.2 BAC69147.1 Non-secretory protein CDS SAVERM_1438 1774243 1773932 putative membrane protein 10.38 11036 C miscellaneous 4.7 BAC69148.1 Non-secretory protein CDS SAVERM_1439 1774392 1774967 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.96 20731 C regulation 3.5.2 BAC69149.1 Non-secretory protein CDS SAVERM_1440 1775061 1775645 hypothetical protein 6.9 21564 C similar to unknown proteins 5 BAC69150.1 Non-secretory protein CDS SAVERM_1441 1775639 1776550 putative phosphotriesterase-family protein PF02126: Phosphotriesterase family 7.12 31972 C miscellaneous 4.7 BAC69151.1 Non-secretory protein CDS SAVERM_1442 1777880 1776636 putative ROK-family transcriptional regulator PF00480: ROK family 6.45 42076 C regulation 3.5.2 BAC69152.1 Non-secretory protein CDS SAVERM_1443 1778682 1778014 putative DNA repair protein alkylation damage repair 7.04 24092 C DNA modification & repair 3.2 BAC69153.1 Non-secretory protein CDS SAVERM_1444 1778763 1779905 rsmC putative ribosomal RNA small subunit methyltransferase PF05175: Methyltransferase small domain 9.14 41277 C RNA modification 3.6 BAC69154.1 Non-secretory protein CDS SAVERM_1445 1780800 1779895 gatY putative tagatose-bisphosphate aldolase (=iolJ?) PF01116: Fructose-bisphosphate aldolase class-II 6.12 30504 C specific pathways 2.1.1 BAC69155.1 Non-secretory protein CDS SAVERM_1446 1781784 1780834 putave phosphosugar isomerase PF01380: SIS domain 5.43 33618 C miscellaneous 4.7 BAC69156.1 Non-secretory protein CDS SAVERM_1447 1781851 1782630 putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 5.43 27338 C regulation 3.5.2 BAC69157.1 Non-secretory protein CDS SAVERM_1448 1782944 1783813 putative MoxR-like ATPase PF07728: ATPase family associated with various cellular activities (AAA) 4.51 31579 C miscellaneous 4.7 BAC69158.1 Non-secretory protein CDS SAVERM_1449 1783810 1785183 hypothetical protein PF05762: VWA domain containing CoxE-like protein 10.74 49831 C similar to unknown proteins 5 BAC69159.1 Non-secretory protein CDS SAVERM_1450 1785294 1787336 putative alpha-glucuronidase PF07488: Glycosyl hydrolase family 67 middle domain 6.78 74941 C detoxification 4.2 BAC69160.1 Non-secretory protein CDS SAVERM_1451 1789421 1787385 bga3 putative beta-galactosidase PF02449: Beta-galactosidase 6.27 75136 C specific pathways 2.1.1 BAC69161.1 Non-secretory protein CDS SAVERM_1452 1790179 1789418 hypothetical protein PF06055: Exopolysaccharide synthesis, ExoD 8.51 26546 C no similarity 6 BAC69162.1 Non-secretory protein CDS SAVERM_1453 1791654 1790131 xynB1 putative xylan 1,4-beta-xylosidase PF01229: Glycosyl hydrolases family 39 6.48 57658 C specific pathways 2.1.1 BAC69163.1 Non-secretory protein CDS SAVERM_1454 1793300 1791651 lplA1 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 8.23 60614 C transport / binding proteins & lipoproteins 1.2 BAC69164.1 Signal peptide CDS SAVERM_1455 1794262 1793336 lplC1 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 10.02 33583 C transport / binding proteins & lipoproteins 1.2 BAC69165.1 Non-secretory protein CDS SAVERM_1456 1795254 1794256 lplB1 putative multiple sugar ABC transport permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 10.36 37469 C transport / binding proteins & lipoproteins 1.2 BAC69166.1 Non-secretory protein CDS SAVERM_1457 1795541 1796542 axe2 putative acetyl xylan esterase PF05448: Acetyl xylan esterase (AXE1) 6.65 35550 C specific pathways 2.1.1 BAC69167.1 Non-secretory protein CDS SAVERM_1458 1797810 1796587 putative glycosyltransferase PF00534: Glycosyl transferases group 1 9.59 46002 C specific pathways 2.1.1 BAC69168.1 Non-secretory protein CDS SAVERM_1459 1800043 1797842 putative glycogen debranching enzyme PF06202: Amylo-alpha-1,6-glucosidase 6.92 79806 C specific pathways 2.1.1 BAC69169.1 Non-secretory protein CDS SAVERM_1460 1800284 1803319 putative ATP/GTP-binding protein PF07719: Tetratricopeptide repeat 7.04 111015 C miscellaneous 4.7 BAC69170.1 Non-secretory protein CDS SAVERM_1461 1803393 1804592 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 9.38 40447 C transport / binding proteins & lipoproteins 1.2 BAC69171.1 Non-secretory protein CDS SAVERM_1462 1805240 1806721 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.35 51272 C transport / binding proteins & lipoproteins 1.2 BAC69173.1 Non-secretory protein CDS SAVERM_1463 1805259 1804744 putative MarR-family transcriptional regulator PF01047: MarR family 6.78 18385 C regulation 3.5.2 BAC69172.1 Non-secretory protein CDS SAVERM_1464 1807488 1806823 putative two-component system response regulator PF00072: Response regulator receiver domain 5.01 23977 C regulation 3.5.2 BAC69174.1 Non-secretory protein CDS SAVERM_1465 1808822 1807485 putative two-component system sensor kinase PF07730: Histidine kinase 9.06 47851 C sensors 1.3 BAC69175.1 Non-secretory protein CDS SAVERM_1466 1809578 1808928 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.26 23179 C regulation 3.5.2 BAC69176.1 Non-secretory protein CDS SAVERM_1467 1809764 1810807 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 10.5 37006 C miscellaneous 4.7 BAC69177.1 Non-secretory protein CDS SAVERM_1468 1811595 1810861 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.83 25929 C regulation 3.5.2 BAC69178.1 Non-secretory protein CDS SAVERM_1469 1811682 1812233 hypothetical protein PF04075: Domain of unknown function (DUF385) 10.75 20303 C similar to unknown proteins 5 BAC69179.1 Non-secretory protein CDS SAVERM_1470 1813522 1812317 putative hydrogenase PF01266: FAD dependent oxidoreductase 9.17 42833 C miscellaneous 4.7 BAC69180.1 Non-secretory protein CDS SAVERM_1471 1813707 1815062 putative peptidase PF01546: Peptidase family M20/M25/M40 4.44 47551 C protein modification 3.8 BAC69181.1 Non-secretory protein CDS SAVERM_1472 1815103 1815852 putative metallo-beta-lactamase-like protein PF00753: Metallo-beta-lactamase superfamily 5.72 26057 C detoxification 4.2 BAC69182.1 Non-secretory protein CDS SAVERM_1473 1817014 1815974 putative ATP/GTP-binding protein PF00293: NUDIX domain 4.49 37975 C miscellaneous 4.7 BAC69183.1 Non-secretory protein CDS SAVERM_1474 1817361 1817167 putative secreted protein 4.76 6536 C miscellaneous 4.7 BAC69184.1 Signal peptide CDS SAVERM_1475 1817779 1819827 agaB2 putative alpha-galactosidase, secreted Tat substrate, PF02065: Melibiase 6.74 72330 C specific pathways 2.1.1 BAC69185.1 Signal peptide CDS SAVERM_1476 1820817 1819858 putative ROK-family transcriptional regulator PF00480: ROK family 5.07 31301 C regulation 3.5.2 BAC69186.1 Non-secretory protein CDS SAVERM_1477 1821069 1822106 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.42 36976 C regulation 3.5.2 BAC69187.1 Non-secretory protein CDS SAVERM_1478 1823641 1822322 hypothetical protein PF03328: HpcH/HpaI aldolase/citrate lyase family 4.82 46735 C similar to unknown proteins 5 BAC69188.1 Non-secretory protein CDS SAVERM_1479 1823751 1824662 putative secreted protein PF03372: Endonuclease/Exonuclease/phosphatase family 9.61 33299 C similar to unknown proteins 5 BAC69189.1 Signal peptide CDS SAVERM_1480 1825745 1824783 fixB putative electron transfer flavoprotein, alpha subunit PF00766: Electron transfer flavoprotein FAD-binding domain 4.82 32532 C membrane bioenergetics 1.4 BAC69190.1 Non-secretory protein CDS SAVERM_1481 1826594 1825800 fixA putative electron transfer flavoprotein, beta subunit PF01012: Electron transfer flavoprotein domain 4.01 27883 C membrane bioenergetics 1.4 BAC69191.1 Non-secretory protein CDS SAVERM_1482 1827292 1826786 thiX1 putative flavin-dependent reductase PF01613: Flavin reductase like domain 6.51 17351 C metabolism of coenzymes & prosthetic groups 2.5 BAC69192.1 Non-secretory protein CDS SAVERM_1483 1827912 1827499 trxA4 putative thioredoxin PF00085: Thioredoxin 9.52 14588 C membrane bioenergetics 1.4 BAC69193.1 Non-secretory protein CDS SAVERM_1484 1828015 1828431 putative secreted protein 9.3 14422 C similar to unknown proteins 5 BAC69194.1 Non-secretory protein CDS SAVERM_1485 1828617 1829345 plsC1 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 10.43 26891 C metabolism of lipids 2.4 BAC69195.1 Non-secretory protein CDS SAVERM_1486 1830042 1829350 hypothetical protein PF03483: B3/4 domain 5.01 24656 C similar to unknown proteins 5 BAC69196.1 Non-secretory protein CDS SAVERM_1487 1830656 1830057 hypothetical protein 5.71 21767 C similar to unknown proteins 5 BAC69197.1 Non-secretory protein CDS SAVERM_1488 1831787 1830717 ltaA putative L-threonine aldolase PF01212: Beta-eliminating lyase 6.26 38926 C metabolism of amino acids & related molecules 2.2 BAC69198.1 Non-secretory protein CDS SAVERM_1489 1832530 1831784 putative dehydrogenase PF00106: short chain dehydrogenase 5.37 26134 C miscellaneous 4.7 BAC69199.1 Non-secretory protein CDS SAVERM_1490 1833966 1832569 hypothetical protein 4.75 52962 C similar to unknown proteins 5 BAC69200.1 Non-secretory protein CDS SAVERM_1491 1834539 1834048 hypothetical protein 9.31 16596 C no similarity 6 BAC69201.1 Non-secretory protein CDS SAVERM_1492 1834659 1835342 glpQ5 putative glycerophosphoryl diester phosphodiesterase PF03009: Glycerophosphoryl diester phosphodiesterase family 5.97 24745 C metabolism of lipids 2.4 BAC69202.1 Non-secretory protein CDS SAVERM_1493 1835885 1835346 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.59 19477 C miscellaneous 4.7 BAC69203.1 Non-secretory protein CDS SAVERM_1494 1835957 1836349 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.22 14385 C similar to unknown proteins 5 BAC69204.1 Non-secretory protein CDS SAVERM_1495 1836411 1837175 putative hydroxylase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.08 26798 C miscellaneous 4.7 BAC69205.1 Non-secretory protein CDS SAVERM_1496 1837690 1837172 hypothetical protein PF00190: Cupin 6.07 18383 C similar to unknown proteins 5 BAC69206.1 Non-secretory protein CDS SAVERM_1497 1838404 1837808 putative MarR-family transcriptional regulator PF01047: MarR family 6.53 20842 C regulation 3.5.2 BAC69207.1 Non-secretory protein CDS SAVERM_1498 1840062 1838401 putative integral membrane protein PF05976: Bacterial membrane protein of unknown function (DUF893) 9.99 57173 C miscellaneous 4.7 BAC69208.1 Non-secretory protein CDS SAVERM_1499 1840223 1840771 putative integral membrane protein 9.64 18703 C miscellaneous 4.7 BAC69209.1 Non-secretory protein CDS SAVERM_1500 1840948 1841883 putative integral membrane protein PF01435: Peptidase family M48 10.34 33213 C miscellaneous 4.7 BAC69210.1 Non-secretory protein CDS SAVERM_1501 1841987 1842670 putative secreted protein PF01569: PAP2 superfamily 11.09 24227 C similar to unknown proteins 5 BAC69211.1 Non-secretory protein CDS SAVERM_1502 1842744 1843442 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 5.84 24874 C miscellaneous 4.7 BAC69212.1 Non-secretory protein CDS SAVERM_1503 1843601 1844320 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 8.69 26396 C regulation 3.5.2 BAC69213.1 Non-secretory protein CDS SAVERM_1504 1845810 1844308 putative secreted protein 6.14 53592 C miscellaneous 4.7 BAC69214.1 Signal peptide CDS SAVERM_1505 1845876 1846595 putative lipoprotein PF03713: Domain of unknown function (DUF305) 6.4 25493 C transport / binding proteins & lipoproteins 1.2 BAC69215.1 Non-secretory protein CDS SAVERM_1506 1847069 1846605 hypothetical protein 5.05 16752 C similar to unknown proteins 5 BAC69216.1 Non-secretory protein CDS SAVERM_1507 1847273 1848619 fprB putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 7.35 47754 C membrane bioenergetics 1.4 BAC69217.1 Non-secretory protein CDS SAVERM_1508 1848745 1850100 pbuX1 putative xanthine/uracil permease PF00860: Permease family 7.5 45902 C transport / binding proteins & lipoproteins 1.2 BAC69218.1 Non-secretory protein CDS SAVERM_1509 1850445 1850086 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 7.68 12985 C regulation 3.5.2 BAC69219.1 Non-secretory protein CDS SAVERM_1510 1850562 1851641 putative oxidoreductase PF00724: NADH:flavin oxidoreductase / NADH oxidase family 6.09 38590 C miscellaneous 4.7 BAC69220.1 Non-secretory protein CDS SAVERM_1511 1852749 1851838 putative carbohydrate kinase PF00294: pfkB family carbohydrate kinase 5.03 31840 C miscellaneous 4.7 BAC69221.1 Non-secretory protein CDS SAVERM_1512 1853459 1852830 putative secreted protein 12.34 23299 C similar to unknown proteins 5 BAC69222.1 Non-secretory protein CDS SAVERM_1513 1853697 1854839 hypothetical protein PF02012: BNR/Asp-box repeat 5.12 41151 C similar to unknown proteins 5 BAC69223.1 Non-secretory protein CDS SAVERM_1514 1855017 1856780 maeA1 putative malate dehydrogenase (oxaloacetate-decarboxylating; NAD-requiring) malS1, sfcA, PF03949: Malic enzyme, NAD binding domain 4.86 63260 C TCA cycle 2.1.3 BAC69224.1 Non-secretory protein CDS SAVERM_1515 1856893 1857978 putative transport integral membrane protein PF03547: Auxin Efflux Carrier 10.56 36613 C transport / binding proteins & lipoproteins 1.2 BAC69225.1 Non-secretory protein CDS SAVERM_1516 1858078 1859835 putative integral membrane protein PF05976: Bacterial membrane protein of unknown function (DUF893) 11.1 61170 C transport / binding proteins & lipoproteins 1.2 BAC69226.1 Non-secretory protein CDS SAVERM_1517 1859956 1860894 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 9.1 34192 C regulation 3.5.2 BAC69227.1 Non-secretory protein CDS SAVERM_1518 1861248 1860949 hypothetical protein 9.83 11138 C similar to unknown proteins 5 BAC69228.1 Non-secretory protein CDS SAVERM_1519 1861569 1862282 putative dehydrogenase PF00106: short chain dehydrogenase 5.52 24618 C miscellaneous 4.7 BAC69229.1 Non-secretory protein CDS SAVERM_1520 1862701 1863681 putative 1-aminocyclopropane-1-carboxylate deaminase PF00291: Pyridoxal-phosphate dependent enzyme 6.04 33573 C metabolism of amino acids & related molecules 2.2 BAC69230.1 Non-secretory protein CDS SAVERM_1521 1863707 1864315 hypothetical protein PF07336: Protein of unknown function (DUF1470) 8.11 22112 C similar to unknown proteins 5 BAC69231.1 Non-secretory protein CDS SAVERM_1522 1864635 1865171 putative epoxide hydrolase 5.25 20113 C specific pathways 2.1.1 BAC69232.1 Non-secretory protein CDS SAVERM_1523 1865337 1865780 putative lyase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.44 15903 C miscellaneous 4.7 BAC69233.1 Non-secretory protein CDS SAVERM_1524 1866458 1865838 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.75 22791 C regulation 3.5.2 BAC69234.1 Non-secretory protein CDS SAVERM_1525 1867412 1866759 putative muconolactone delta-isomerase PF02426: Muconolactone delta-isomerase 8.05 23251 C metabolism of coenzymes & prosthetic groups 2.5 BAC69235.1 Non-secretory protein CDS SAVERM_1526 1867505 1868419 putative LysR-family transcriptional regulator PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 7.76 33450 C regulation 3.5.2 BAC69236.1 Non-secretory protein CDS SAVERM_1527 1869773 1869096 ung1 putative uracil-DNA glycosylase PF03167: Uracil DNA glycosylase superfamily 9.84 24410 C DNA modification & repair 3.2 BAC69237.1 Non-secretory protein CDS SAVERM_1528 1870024 1871082 hypothetical protein PF01869: BadF/BadG/BcrA/BcrD ATPase family 6.94 34947 C similar to unknown proteins 5 BAC69238.1 Non-secretory protein CDS SAVERM_1529 1871275 1872198 hypothetical protein PF01903: CbiX 4.78 31459 C similar to unknown proteins 5 BAC69239.1 Non-secretory protein CDS SAVERM_1530 1873361 1872321 putative secreted protein Tat substrate 5.99 35694 C miscellaneous 4.7 BAC69240.1 Non-secretory protein CDS SAVERM_1531 1875013 1873463 nos putative nitric oxide synthase PF02898: Nitric oxide synthase, oxygenase domain 7.2 65534 C detoxification 4.2 BAC69241.1 Non-secretory protein CDS SAVERM_7579 1877058 1875451 putative membrane protein PF01027: Uncharacterised protein family UPF0005 10.75 56237 C miscellaneous 4.7 BAC69242.1 Non-secretory protein CDS SAVERM_1532 1877224 1877448 hypothetical protein 4.59 7960 C similar to unknown proteins 5 BAC69243.1 Non-secretory protein CDS SAVERM_1533 1877823 1877473 hypothetical protein PF03861: ANTAR domain 4.64 12886 C similar to unknown proteins 5 BAC69244.1 Non-secretory protein CDS SAVERM_1534 1878051 1878527 putative AsnC-family transcriptional regulator PF01037: AsnC family 6.36 17044 C regulation 3.5.2 BAC69245.1 Non-secretory protein CDS SAVERM_1535 1878548 1879243 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.25 24580 C miscellaneous 4.7 BAC69246.1 Non-secretory protein CDS SAVERM_1536 1880507 1879347 hypothetical protein PF02625: XdhC and CoxI family 5.14 40194 C similar to unknown proteins 5 BAC69247.1 Non-secretory protein CDS SAVERM_1537 1881987 1880500 putative oxidoreductase frameshift, PF02738: Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain 7.25 52067 C miscellaneous 4.7 BAC69249.1 Non-secretory protein CDS SAVERM_1538 1882642 1880483 putative oxidoreductase frameshift 12.44 76997 C miscellaneous 4.7 BAC69248.1 Non-secretory protein CDS SAVERM_1539 1883631 1882639 putative oxidoreductase molybdopterin binding subunit PF00941: FAD binding domain in molybdopterin dehydrogenase 6.1 34678 C miscellaneous 4.7 BAC69250.1 Non-secretory protein CDS SAVERM_1540 1884200 1883628 pucE putative xanthine dehydrogenase PF01799: [2Fe-2S] binding domain 4.83 19707 C metabolism of nucleotides & nucleic acids 2.3 BAC69251.1 Non-secretory protein CDS SAVERM_1541 1884456 1885052 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 8.48 21481 C regulation 3.5.2 BAC69252.1 Non-secretory protein CDS SAVERM_1542 1886015 1885125 putative dehydrogenase PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 4.87 30626 C miscellaneous 4.7 BAC69253.1 Non-secretory protein CDS SAVERM_1543 1887933 1886233 putative secreted protein Tat substrate 6.87 59956 C similar to unknown proteins 5 BAC69254.1 Non-secretory protein CDS SAVERM_1544 1889335 1888040 putative membrane protein PF01757: Acyltransferase family 9.95 47490 C miscellaneous 4.7 BAC69255.1 Non-secretory protein CDS SAVERM_1545 1890109 1889510 hypothetical protein PF11139: Protein of unknown function (DUF2910) 11.34 20457 C similar to unknown proteins 5 BAC69256.1 Non-secretory protein CDS SAVERM_1546 1890755 1890201 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 6.35 19721 C similar to unknown proteins 5 BAC69257.1 Non-secretory protein CDS SAVERM_1547 1891254 1890784 rpiB1 putative ribose-5-phosphate isomerase PF02502: Ribose/Galactose Isomerase 4.8 16343 C main glycolytic pathways 2.1.2 BAC69258.1 Non-secretory protein CDS SAVERM_1548 1892069 1891269 putative hydrolase PF00561: alpha/beta hydrolase fold 6.51 29371 C miscellaneous 4.7 BAC69259.1 Non-secretory protein CDS SAVERM_1549 1893269 1892133 putative esterase/lipase PF04083: ab-hydrolase associated lipase region 7.75 42079 C miscellaneous 4.7 BAC69260.1 Non-secretory protein CDS SAVERM_1550 1895794 1893266 foxBIII putative modular polyketide synthase (PCP-TE) gene cluster for foxicin biosynthesis (pks2 gene cluster) 6.02 89413 C antibiotic production 4.3 BAC69261.1 Non-secretory protein CDS SAVERM_1551 1910257 1895828 foxBII putative modular polyketide synthase (ACP-KS-AT-DH-KR-ACP-KS-AT-DH-KR-ACP-C) gene cluster for foxicin biosynthesis (pks2 gene cluster) 4.93 507425 C antibiotic production 4.3 BAC69262.1 Non-secretory protein CDS SAVERM_1552 1912282 1910558 foxBI putative non-ribosomal peptide synthetase (A domain) gene cluster for foxicin biosynthesis (pks2 gene cluster) 6.1 61801 C antibiotic production 4.3 BAC69263.1 Non-secretory protein CDS SAVERM_1553 1912604 1913284 putative methyltransferase pks2 gene cluster, PF01209: ubiE/COQ5 methyltransferase family 4.55 24638 C miscellaneous 4.7 BAC69264.1 Non-secretory protein CDS SAVERM_1554 1913338 1915320 prpE1 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.95 70233 C protein modification 3.8 BAC69265.1 Non-secretory protein CDS SAVERM_1555 1916745 1915333 putative integral membrane protein PF07690: Major Facilitator Superfamily 10.73 49778 C miscellaneous 4.7 BAC69266.1 Non-secretory protein CDS SAVERM_1556 1916763 1917722 bdpK putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 8.24 34705 C regulation 3.5.2 BAC69267.1 Non-secretory protein CDS SAVERM_1557 1919771 1919349 hypothetical protein PF01894: Uncharacterised protein family UPF0047 5.4 14960 C similar to unknown proteins 5 BAC69268.1 Non-secretory protein CDS SAVERM_1558 1920171 1920977 ssuC2 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein 10.37 28795 C transport / binding proteins & lipoproteins 1.2 BAC69269.1 Non-secretory protein CDS SAVERM_1559 1920950 1921732 ssuB2 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein 6.54 28224 C transport / binding proteins & lipoproteins 1.2 BAC69270.1 Non-secretory protein CDS SAVERM_1560 1921845 1922873 ssuA2 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding, PF03180: NLPA lipoprotein 10.29 35949 C transport / binding proteins & lipoproteins 1.2 BAC69271.1 Signal peptide CDS SAVERM_1561 1922873 1924027 ssuD2 putative alkanesulfonate monooxygenase PF00296: Luciferase-like monooxygenase 6.35 41566 C metabolism of sulfur 2.7 BAC69272.1 Non-secretory protein CDS SAVERM_1562 1924069 1925157 putative oxidoreductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 9.93 39583 C miscellaneous 4.7 BAC69273.1 Non-secretory protein CDS SAVERM_1563 1926019 1925174 pabC1 putative aminodeoxychorismate lyase PF02618: Aminodeoxychorismate lyase 10.41 30521 C metabolism of coenzymes & prosthetic groups 2.5 BAC69274.1 Non-secretory protein CDS SAVERM_1564 1927862 1926063 msbA putative ABC transporter ATP-binding protein (bacterial ATP-binding cassette, subfamily B) PF00005: ABC transporter 8.72 64983 C transport / binding proteins & lipoproteins 1.2 BAC69275.1 Non-secretory protein CDS SAVERM_1565 1927957 1928412 putative MarR-family transcriptional regulator PF01047: MarR family 10.08 16852 C regulation 3.5.2 BAC69276.1 Non-secretory protein CDS SAVERM_1566 1928997 1928740 hypothetical protein 4.32 9064 C similar to unknown proteins 5 BAC69277.1 Non-secretory protein CDS SAVERM_1567 1930644 1929019 putative secreted protein 6.2 58587 C similar to unknown proteins 5 BAC69278.1 Signal peptide CDS SAVERM_1568 1931663 1930839 putative lipoprotein 9.08 28659 C transport / binding proteins & lipoproteins 1.2 BAC69279.1 Signal peptide CDS SAVERM_1569 1931874 1933736 putative ABC transporter permease protein PF00664: ABC transporter transmembrane region 5 65573 C transport / binding proteins & lipoproteins 1.2 BAC69280.1 Non-secretory protein CDS SAVERM_1570 1933733 1935514 mdlB putative ABC transporter ATP-binding protein (bacterial ATP-binding cassette, subfamily C) PF00005: ABC transporter 6.88 63425 C transport / binding proteins & lipoproteins 1.2 BAC69281.1 Non-secretory protein CDS SAVERM_1571 1936091 1936561 hypothetical protein 3.52 16341 C similar to unknown proteins 5 BAC69282.1 Non-secretory protein CDS SAVERM_1572 1936716 1936991 rpmE1 putative ribosomal protein L31 PF01197: Ribosomal protein L31 4.6 9992 C ribosomal protein 3.7.1 BAC69283.1 Non-secretory protein CDS SAVERM_1573 1937865 1940525 putative ATP-dependent helicase PF00270: DEAD/DEAH box helicase 4.96 98482 C DNA modification & repair 3.2 BAC69285.1 Signal peptide CDS SAVERM_1574 1937866 1937072 putative integral membrane protein PF04307: Predicted membrane-bound metal-dependent hydrolase (DUF457) 10.05 27751 C miscellaneous 4.7 BAC69284.1 Non-secretory protein CDS SAVERM_1575 1940545 1941411 tesB1 putative acyl-CoA thioesterase PF02551: Acyl-CoA thioesterase 5.67 32596 C metabolism of lipids 2.4 BAC69286.1 Non-secretory protein CDS SAVERM_1576 1942481 1941471 hypothetical protein 10.2 36988 C similar to unknown proteins 5 BAC69287.1 Non-secretory protein CDS SAVERM_1577 1943024 1942608 hypothetical protein PF03259: Roadblock/LC7 domain 5.17 14646 C similar to unknown proteins 5 BAC69288.1 Non-secretory protein CDS SAVERM_1578 1943111 1943548 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 5.04 16154 C similar to unknown proteins 5 BAC69289.1 Non-secretory protein CDS SAVERM_1579 1944173 1943568 cvnD2 putative ATP/GTP-binding protein multi-component regulatory system-2 4.57 21812 C miscellaneous 4.7 BAC69290.1 Non-secretory protein CDS SAVERM_1580 1944618 1944205 cvnC2 hypothetical protein multi-component regulatory system-2, PF05331: Protein of unknown function (DUF742) 4.45 14520 C similar to unknown proteins 5 BAC69291.1 Non-secretory protein CDS SAVERM_1581 1945075 1944638 cvnB2 hypothetical protein multi-component regulatory system-2, PF03259: Roadblock/LC7 domain 5.55 15247 C similar to unknown proteins 5 BAC69292.1 Non-secretory protein CDS SAVERM_1582 1947624 1945072 cvnA2 putative sensor-like histidine kinase multi-component regulatory system-2 7.08 90459 C sensors 1.3 BAC69293.1 Non-secretory protein CDS SAVERM_1583 1948419 1947688 putative integral membrane protein Tat substrate, PF03707: Bacterial signalling protein N terminal repeat 10.22 25050 C miscellaneous 4.7 BAC69294.1 Non-secretory protein CDS SAVERM_1584 1948605 1949213 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 6.24 21217 C miscellaneous 4.7 BAC69295.1 Non-secretory protein CDS SAVERM_1585 1949998 1949240 hypothetical protein PF00561: alpha/beta hydrolase fold 5.98 26745 C similar to unknown proteins 5 BAC69296.1 Non-secretory protein CDS SAVERM_1586 1950129 1950671 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 9.93 20360 C regulation 3.5.2 BAC69297.1 Non-secretory protein CDS SAVERM_1587 1951553 1950648 hypothetical protein PF0995: Uncharacterized protein conserved in bacteria (DUF2236) 9.71 34698 C similar to unknown proteins 5 BAC69298.1 Non-secretory protein CDS SAVERM_1588 1951608 1951949 hypothetical protein 9.49 12415 C similar to unknown proteins 5 BAC69299.1 Non-secretory protein CDS SAVERM_1589 1952105 1952986 hypothetical protein 3.92 30984 C similar to unknown proteins 5 BAC69300.1 Non-secretory protein CDS SAVERM_1590 1953348 1953112 hypothetical protein 12.08 8637 C similar to unknown proteins 5 BAC69301.1 Non-secretory protein CDS SAVERM_1591 1954480 1953419 fadS1 putative fatty acid desaturase PF00487: Fatty acid desaturase 10.29 39197 C metabolism of lipids 2.4 BAC69302.1 Non-secretory protein CDS SAVERM_1592 1954746 1957685 helZ2 putative SNF2/RAD54 family helicase PF00176: SNF2 family N-terminal domain 6.6 104344 C DNA modification & repair 3.2 BAC69303.1 Non-secretory protein CDS SAVERM_1593 1957682 1958959 hypothetical protein PF04434: SWIM zinc finger 4.61 45419 C similar to unknown proteins 5 BAC69304.1 Non-secretory protein CDS SAVERM_1594 1960367 1959084 hypothetical protein 4.08 45365 C similar to unknown proteins 5 BAC69305.1 Non-secretory protein CDS SAVERM_1595 1962097 1960490 putative 3-ketosteroid-delta-1-dehydrogenase PF00890: FAD binding domain 6.95 55773 C specific pathways 2.1.1 BAC69306.1 Signal peptide CDS SAVERM_1596 1962456 1962950 hypothetical protein PF05122: Mobile element transfer protein 4.31 17323 C no similarity 6 BAC69307.1 Non-secretory protein CDS SAVERM_1597 1964003 1963035 putative oxidoreductase PF00248: Aldo/keto reductase family 5.64 36023 C specific pathways 2.1.1 BAC69308.1 Non-secretory protein CDS SAVERM_1598 1964411 1965265 hypothetical protein PF00656: Caspase domain 4.56 31798 C similar to unknown proteins 5 BAC69309.1 Non-secretory protein CDS SAVERM_1599 1965484 1966050 hypothetical protein PF03745: Domain of unknown function (DUF309) 6.97 20190 C similar to unknown proteins 5 BAC69310.1 Non-secretory protein CDS SAVERM_1600 1966110 1966880 cobF putative methyltransferase cobalamin biosynthesis, PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 4.65 28522 C miscellaneous 4.7 BAC69311.1 Non-secretory protein CDS SAVERM_1601 1968402 1967656 cobK putative precorrin-6X reductase cobalamin biosynthesis, PF02571: Precorrin-6x reductase CbiJ/CobK 10.57 25474 C metabolism of coenzymes & prosthetic groups 2.5 BAC69312.1 Non-secretory protein CDS SAVERM_1602 1969197 1968424 putative integral membrane protein PF01925: Domain of unknown function DUF81 11.78 27238 C miscellaneous 4.7 BAC69313.1 Non-secretory protein CDS SAVERM_1603 1970811 1969300 fadD7 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 5.63 53598 C metabolism of lipids 2.4 BAC69314.1 Non-secretory protein CDS SAVERM_1604 1972128 1970941 pcaF1 putative beta-ketoadipyl-CoA thiolase PF00108: Thiolase, N-terminal domain 5.18 41657 C metabolism of lipids 2.4 BAC69315.1 Non-secretory protein CDS SAVERM_1605 1972321 1972803 mrgA1 putative starvation-induced DNA protecting protein PF00210: ferritin-like domain 4.58 17553 C adaptation to atypical conditions 4.1 BAC69316.1 Non-secretory protein CDS SAVERM_1606 1972823 1973470 putative endonuclease III-like protein PF00730: HhH-GPD superfamily base excision DNA repair protein 9.74 23776 C DNA modification & repair 3.2 BAC69317.1 Non-secretory protein CDS SAVERM_1607 1973812 1975050 putative integral membrane protein PF01594: Domain of unknown function DUF20 12.09 42854 C miscellaneous 4.7 BAC69318.1 Non-secretory protein CDS SAVERM_1608 1975818 1975282 putative MarR-family transcriptional regulator PF01047: MarR family 6.69 19649 C regulation 3.5.2 BAC69319.1 Signal peptide CDS SAVERM_1609 1977057 1975840 fprC putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.49 43309 C membrane bioenergetics 1.4 BAC69320.1 Non-secretory protein CDS SAVERM_1610 1977251 1977054 fdxB putative ferredoxin 4.03 6858 C membrane bioenergetics 1.4 BAC69321.1 Non-secretory protein CDS SAVERM_1611 1978527 1977286 cyp7 putative cytochrome P450 CYP105Q1, fdxB and fprC are located at downstream 6.2 45071 C metabolism of coenzymes & prosthetic groups 2.5 BAC69322.1 Non-secretory protein CDS SAVERM_1612 1979575 1978871 putative two-component system response regulator PF00486: Transcriptional regulatory protein, C terminal 9.7 26368 C regulation 3.5.2 BAC69323.1 Non-secretory protein CDS SAVERM_1613 1979878 1980648 putative dehydrogenase PF00106: short chain dehydrogenase 7.08 26175 C miscellaneous 4.7 BAC69324.1 Non-secretory protein CDS SAVERM_1614 1982277 1980949 putative benzoate transport protein PF07690: Major Facilitator Superfamily 9.69 46373 C transport / binding proteins & lipoproteins 1.2 BAC69325.1 Non-secretory protein CDS SAVERM_1615 1983482 1982532 xylE putative catechol 2,3-dioxygenase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.36 35157 C metabolism of lipids 2.4 BAC69326.1 Non-secretory protein CDS SAVERM_1616 1984566 1983493 putative transmenmbrane protein 5.64 36658 C miscellaneous 4.7 BAC69327.1 Non-secretory protein CDS SAVERM_1617 1985300 1984590 menG putative dimethylmenaquinone methyltransferase family protein PF03737: Demethylmenaquinone methyltransferase 4.85 24790 C metabolism of coenzymes & prosthetic groups 2.5 BAC69328.1 Non-secretory protein CDS SAVERM_1618 1986046 1985297 hypothetical protein PF02585: Uncharacterised LmbE-like protein, COG2120 6.1 27137 C similar to unknown proteins 5 BAC69329.1 Non-secretory protein CDS SAVERM_1619 1986742 1986092 putative GntR-family transcriptional regulator PF07729: FCD domain 6.1 23781 C regulation 3.5.2 BAC69330.1 Non-secretory protein CDS SAVERM_1620 1988569 1987073 putative amino acid permease PF00324: Amino acid permease 7.78 52911 C transport / binding proteins & lipoproteins 1.2 BAC69331.1 Non-secretory protein CDS SAVERM_1621 1990113 1988569 putative oxidoreductase PF00732: GMC oxidoreductase 5.24 56206 C miscellaneous 4.7 BAC69332.1 Non-secretory protein CDS SAVERM_1622 1991611 1990145 gbsA1 putative glycine betaine aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.94 52978 C adaptation to atypical conditions 4.1 BAC69333.1 Non-secretory protein CDS SAVERM_1623 1992287 1992997 putative transketolase A subunit PF00456: Transketolase, thiamine diphosphate binding domain 5.89 25008 C miscellaneous 4.7 BAC69334.1 Non-secretory protein CDS SAVERM_1624 1993096 1994007 putative transketolase B subunit PF02779: Transketolase, pyridine binding domain 5.96 32457 C miscellaneous 4.7 BAC69335.1 Non-secretory protein CDS SAVERM_1625 1994535 1994047 hypothetical protein PF04944: Uncharacterised BCR (COG3801) 8.23 18250 C similar to unknown proteins 5 BAC69336.1 Signal peptide CDS SAVERM_1626 1995481 1994576 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.78 31655 C regulation 3.5.2 BAC69337.1 Non-secretory protein CDS SAVERM_1627 1996963 1995767 kbl putative 2-amino-3-oxobutyrate:CoA ligase PF00155: Aminotransferase class I and II 5.07 42972 C metabolism of amino acids & related molecules 2.2 BAC69338.1 Non-secretory protein CDS SAVERM_1628 1998008 1996980 tdh putative threonine 3-dehydrogenase PF08240: Alcohol dehydrogenase GroES-like domain 5.42 36710 C metabolism of amino acids & related molecules 2.2 BAC69339.1 Non-secretory protein CDS SAVERM_1629 1998839 1998258 hypothetical protein PF01590: GAF domain 5.4 21177 C similar to unknown proteins 5 BAC69340.1 Non-secretory protein CDS SAVERM_1630 1999416 1998868 cvnD3 putative ATP/GTP-binding protein multi-component regulatory system-3 4.41 19605 C miscellaneous 4.7 BAC69341.1 Non-secretory protein CDS SAVERM_1631 1999765 1999445 cvnC3 hypothetical protein multi-component regulatory system-3, PF05331: Protein of unknown function (DUF742) 7.51 11420 C similar to unknown proteins 5 BAC69342.1 Non-secretory protein CDS SAVERM_1632 2000253 1999819 cvnB3 hypothetical protein multi-component regulatory system-3, PF03259: Roadblock/LC7 domain 5.52 14894 C similar to unknown proteins 5 BAC69343.1 Non-secretory protein CDS SAVERM_1633 2002077 2000524 cvnA3 putative sensor-like histidine kinase multi-component regulatory system-3 11.56 54494 C sensors 1.3 BAC69344.1 Non-secretory protein CDS SAVERM_1634 2003665 2002445 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 6.51 43659 C similar to unknown proteins 5 BAC69345.1 Non-secretory protein CDS SAVERM_1635 2003675 2004457 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 8.62 29026 C similar to unknown proteins 5 BAC69346.1 Non-secretory protein CDS SAVERM_1636 2004635 2005813 gdhA2 putative NADP-specific glutamate dehydrogenase rocG, PF00208: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase 4.63 41874 C metabolism of amino acids & related molecules 2.2 BAC69347.1 Non-secretory protein CDS SAVERM_1637 2005912 2006532 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.99 22560 C regulation 3.5.2 BAC69348.1 Non-secretory protein CDS SAVERM_1638 2007396 2006611 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 5.66 28698 C similar to unknown proteins 5 BAC69349.1 Non-secretory protein CDS SAVERM_1639 2008260 2007541 putative secreted protein Tat substrate 9.18 26392 C no similarity 6 BAC69350.1 Signal peptide CDS SAVERM_1640 2009617 2008712 putative zoocin A (secreted peptidase) PF01551: Peptidase family M23 10.5 30081 C protein modification 3.8 BAC69351.1 Signal peptide CDS SAVERM_1641 2012185 2010083 agaB3 putative alpha-galactosidase PF02065: Melibiase 5.19 77791 C specific pathways 2.1.1 BAC69352.1 Non-secretory protein CDS SAVERM_1642 2012323 2013120 ptpA2 putative conventional protein tyrosine phosphatase 5.1 29402 C protein modification 3.8 BAC69353.1 Non-secretory protein CDS SAVERM_1643 2013295 2013146 putative small hydrophobic secreted protein 9.12 5757 C miscellaneous 4.7 BAC69354.1 Non-secretory protein CDS SAVERM_1644 2013918 2013292 putative regulatory protein PF01381: Helix-turn-helix 6.8 21985 C regulation 3.5.2 BAC69355.1 Non-secretory protein CDS SAVERM_1645 2015436 2014006 putative aminotransferase PF00202: Aminotransferase class-III 6.94 51738 C metabolism of amino acids & related molecules 2.2 BAC69356.1 Non-secretory protein CDS SAVERM_1646 2017331 2015433 dxs1 putative 1-deoxy-D-xylulose 5-phosphate synthase MEP pathway, EC 4.1.3.37 5.92 67786 C specific pathways 2.1.1 BAC69357.1 Non-secretory protein CDS SAVERM_1647 2018517 2017360 ispG2 putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase gcpE, MEP pathway 5.18 40815 C specific pathways 2.1.1 BAC69358.1 Non-secretory protein CDS SAVERM_1648 2019544 2018522 hypothetical protein PF04055: Radical SAM superfamily 7.42 38474 C similar to unknown proteins 5 BAC69359.1 Non-secretory protein CDS SAVERM_1649 2020191 2019550 hypothetical protein PF01048: Phosphorylase family 8.7 22238 C similar to unknown proteins 5 BAC69360.1 Non-secretory protein CDS SAVERM_1650 2022191 2020191 hopA squalene-hopene cyclase squalene/hopene gene cluster, shc, PF00432: Prenyltransferase and squalene oxidase repeat 4.87 73664 C metabolism of lipids 2.4 BAC69361.1 Non-secretory protein CDS SAVERM_1651 2023436 2022306 hopB farnesyl diphosphate synthase squalene/hopene gene cluster, PF00348: Polyprenyl synthetase 4.78 40037 C antibiotic production 4.3 BAC69362.1 Non-secretory protein CDS SAVERM_1652 2024860 2023433 hopC squalene/phytoene dehydrogenase squalene/hopene gene cluster, sqd, PF01593: Flavin containing amine oxidoreductase 7.31 50232 C metabolism of lipids 2.4 BAC69363.1 Non-secretory protein CDS SAVERM_1653 2025947 2024997 hopD squalene/phytoene synthase squalene/hopene gene cluster, sqs1, PF00494: Squalene/phytoene synthase 7.41 34633 C metabolism of lipids 2.4 BAC69364.1 Non-secretory protein CDS SAVERM_1654 2026846 2025944 hopE squalene/phytoene synthase squalene/hopene gene cluster, sqs2, PF00494: Squalene/phytoene synthase 4.98 32519 C metabolism of lipids 2.4 BAC69365.1 Non-secretory protein CDS SAVERM_1655 2027986 2027207 tagH1 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10 28493 C transport / binding proteins & lipoproteins 1.2 BAC69366.1 Non-secretory protein CDS SAVERM_1656 2028908 2027979 tagG1 putative ABC transporter permease protein PF01061: ABC-2 type transporter 9.72 33671 C transport / binding proteins & lipoproteins 1.2 BAC69367.1 Non-secretory protein CDS SAVERM_1657 2029890 2029006 putative glycosyltransferase PF00535: Glycosyl transferase 9.13 32379 C specific pathways 2.1.1 BAC69368.1 Non-secretory protein CDS SAVERM_1658 2030570 2029887 pgsA5 putative phosphatidylglycerophosphate synthase PF01066: CDP-alcohol phosphatidyltransferase 9.78 24126 C metabolism of lipids 2.4 BAC69369.1 Non-secretory protein CDS SAVERM_1659 2031705 2030644 gldA putative glycerol 1-phosphate dehydrogenase PF01761: 3-dehydroquinate synthase 5.2 37025 C metabolism of lipids 2.4 BAC69370.1 Non-secretory protein CDS SAVERM_1660 2032445 2031693 putative nucleotide sugar-1-phosphate transferase PF00483: Nucleotidyl transferase 4.44 27327 C metabolism of nucleotides & nucleic acids 2.3 BAC69371.1 Non-secretory protein CDS SAVERM_1661 2034163 2032442 putative transferase PF01066: CDP-alcohol phosphatidyltransferase 9.23 60651 C miscellaneous 4.7 BAC69372.1 Non-secretory protein CDS SAVERM_1662 2034577 2035557 galE6 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 5.79 34476 C specific pathways 2.1.1 BAC69373.1 Non-secretory protein CDS SAVERM_1663 2035914 2036507 idi putative isopentenyl-diphosphate delta-isomerase (type 2 idi) MEP pathway, EC 5.3.3.2, PF00293: NUDIX domain 5.03 21178 C metabolism of coenzymes & prosthetic groups 2.5 BAC69374.1 Non-secretory protein CDS SAVERM_1664 2037156 2036581 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.02 20491 C regulation 3.5.2 BAC69375.1 Non-secretory protein CDS SAVERM_1665 2037350 2038099 echA6 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.71 26287 C metabolism of lipids 2.4 BAC69376.1 Non-secretory protein CDS SAVERM_1666 2038721 2038086 thiJ putative 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme PF01965: DJ-1/PfpI family 4.58 22159 C metabolism of coenzymes & prosthetic groups 2.5 BAC69377.1 Non-secretory protein CDS SAVERM_1667 2039751 2038747 bdpL putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 7.16 36043 C regulation 3.5.2 BAC69378.1 Non-secretory protein CDS SAVERM_1668 2039912 2040679 hypothetical alanine-rich protein 6.44 26677 C miscellaneous 4.7 BAC69379.1 Non-secretory protein CDS SAVERM_1669 2040961 2043393 putative transcription accessory protein PF00575: S1 RNA binding domain 6.68 87264 C regulation 3.5.2 BAC69380.1 Non-secretory protein CDS SAVERM_1670 2045190 2043550 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.04 59071 C transport / binding proteins & lipoproteins 1.2 BAC69381.1 Non-secretory protein CDS SAVERM_1671 2046285 2045266 putative oxidoreductase PF03808: Glycosyl transferase WecB/TagA/CpsF family 5.04 36811 C miscellaneous 4.7 BAC69382.1 Non-secretory protein CDS SAVERM_1672 2046352 2047305 dao putative D-amino acid oxidase PF01266: FAD dependent oxidoreductase 6.53 33794 C metabolism of amino acids & related molecules 2.2 BAC69383.1 Non-secretory protein CDS SAVERM_1673 2048605 2047310 putative secreted zinc-binding carboxypeptidase PF00246: Zinc carboxypeptidase 6.45 46510 C protein modification 3.8 BAC69384.1 Signal peptide CDS SAVERM_1674 2050563 2048602 putative X-Pro dipeptidyl-peptidase, secreted PF02129: X-Pro dipeptidyl-peptidase (S15 family) 8.13 70143 C protein modification 3.8 BAC69385.1 Signal peptide CDS SAVERM_1675 2050745 2052238 putative metallopeptidase, secreted Tat substrate, PF01433: Peptidase family M1 5.27 53743 C protein modification 3.8 BAC69386.1 Signal peptide CDS SAVERM_1676 2052954 2052475 hypothetical protein PF01661: Appr-1-p processing enzyme family 6.94 17400 C similar to unknown proteins 5 BAC69387.1 Non-secretory protein CDS SAVERM_1677 2054461 2052998 ansP2 putative L-asparagine permease PF00324: Amino acid permease 9.21 51996 C transport / binding proteins & lipoproteins 1.2 BAC69388.1 Non-secretory protein CDS SAVERM_1678 2054785 2055480 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 6.35 25375 C regulation 3.5.2 BAC69389.1 Non-secretory protein CDS SAVERM_1679 2056229 2055588 putative dehydrogenase PF00106: short chain dehydrogenase 4.61 22374 C miscellaneous 4.7 BAC69390.1 Non-secretory protein CDS SAVERM_1680 2058635 2056428 fadB1 putative fatty acid oxidation complex alpha-subunit similar to glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a: including enoyl-CoA hydratase; 3-2-trans-enoyl-CoA isomerase; 3-hydroxybutyryl-CoA epimerase; 3-hydroxyacyl-CoA dehydrogenase 5.49 78109 C metabolism of lipids 2.4 BAC69391.1 Non-secretory protein CDS SAVERM_1681 2059902 2058688 fadA4 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF02803: Thiolase, C-terminal domain 5.04 42198 C metabolism of lipids 2.4 BAC69392.1 Non-secretory protein CDS SAVERM_1682 2061247 2060054 mcr putative fatty acid-CoA racemase PF02515: CoA-transferase family III 6.01 41395 C metabolism of lipids 2.4 BAC69393.1 Non-secretory protein CDS SAVERM_1683 2061478 2062653 hypothetical protein PF03435: Saccharopine dehydrogenase 9.38 42006 C similar to unknown proteins 5 BAC69394.1 Non-secretory protein CDS SAVERM_1684 2063386 2062697 nfi putative endonuclease V PF04493: Endonuclease V 5.32 23988 C DNA modification & repair 3.2 BAC69395.1 Non-secretory protein CDS SAVERM_1685 2063747 2063421 hypothetical protein 10.97 12005 C similar to unknown proteins 5 BAC69396.1 Non-secretory protein CDS SAVERM_1686 2064913 2063861 putative oxidoreductase PF02012: BNR/Asp-box repeat 7.24 36136 C miscellaneous 4.7 BAC69397.1 Signal peptide CDS SAVERM_1687 2065246 2065662 ssgD putative cell division protein PF04686: Streptomyces sporulation and cell division protein, SsgA 4.83 15419 C regulation 3.5.2 BAC69398.1 Non-secretory protein CDS SAVERM_1688 2066678 2065923 hypothetical protein PF05719: Golgi phosphoprotein 3 (GPP34) 10.01 26876 C similar to unknown proteins 5 BAC69399.1 Non-secretory protein CDS SAVERM_1689 2066918 2068537 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.84 58768 C transport / binding proteins & lipoproteins 1.2 BAC69400.1 Non-secretory protein CDS SAVERM_1690 2068821 2069597 ddh putative dimethylarginine dimethylaminohydrolase PF02274: Amidinotransferase 4.9 27691 C metabolism of amino acids & related molecules 2.2 BAC69401.1 Non-secretory protein CDS SAVERM_1691 2069818 2070792 desA putative fatty acid desaturase PF03405: Fatty acid desaturase 6.02 36671 C metabolism of lipids 2.4 BAC69402.1 Non-secretory protein CDS SAVERM_1692 2071630 2070860 hypothetical protein PF06188: HrpE protein 11.11 27946 C no similarity 6 BAC69403.1 Non-secretory protein CDS SAVERM_1693 2072004 2071759 whmD putative WhiB-family transcriptional regulator (wblH) PF02467: Transcription factor WhiB 4.63 9150 C regulation 3.5.2 BAC69404.1 Non-secretory protein CDS SAVERM_1694 2072296 2073087 putative hydroxylase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.01 27601 C miscellaneous 4.7 BAC69405.1 Non-secretory protein CDS SAVERM_1695 2074217 2073171 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.18 36981 C regulation 3.5.2 BAC69406.1 Non-secretory protein CDS SAVERM_1696 2075428 2074412 putative DNA primase, small subunit PF01896: Eukaryotic and archaeal DNA primase small subunit 6.1 38297 C similar to unknown proteins 5 BAC69407.1 Non-secretory protein CDS SAVERM_1697 2075503 2076573 ligC putative DNA ligase PF01068: ATP dependent DNA ligase domain 6.08 39971 C DNA replication 3.1 BAC69408.1 Non-secretory protein CDS SAVERM_1698 2076901 2077878 putative secreted protein Tat substrate 10.18 34636 C similar to unknown proteins 5 BAC69409.1 Signal peptide CDS SAVERM_1699 2078392 2077925 putative MarR-family transcriptional regulator PF01047: MarR family 10.08 17380 C regulation 3.5.2 BAC69410.1 Non-secretory protein CDS SAVERM_1700 2078649 2079431 pcaI putative 3-oxoadipate succinyl-CoA transferase alpha subunit PF01144: Coenzyme A transferase 4.95 26770 C specific pathways 2.1.1 BAC69411.1 Non-secretory protein CDS SAVERM_1701 2079431 2080078 pcaJ putative 3-oxoadipate succinyl-CoA transferase beta subunit PF01144: Coenzyme A transferase 4.4 22313 C specific pathways 2.1.1 BAC69412.1 Non-secretory protein CDS SAVERM_1702 2080075 2080491 pcaF2 putative 3-oxoadipyl-CoA thiolase PF00108: Thiolase, N-terminal domain 8.75 14241 C metabolism of lipids 2.4 BAC69413.1 Non-secretory protein CDS SAVERM_1703 2080504 2081274 pcaH putative protocatechuate 3,4-dioxygenase beta subunit PF00775: Dioxygenase 6.37 28536 C specific pathways 2.1.1 BAC69414.1 Non-secretory protein CDS SAVERM_1704 2081220 2081840 pcaG putative protocatechuate 3,4-dioxygenase alpha subunit PF00775: Dioxygenase 6.86 22148 C specific pathways 2.1.1 BAC69415.1 Non-secretory protein CDS SAVERM_1705 2081837 2083174 pcaB putative 3-carboxy-cis,cis-muconate cycloisomerase PF00206: Lyase 4.97 45682 C specific pathways 2.1.1 BAC69416.1 Non-secretory protein CDS SAVERM_1706 2083171 2084310 pcaL1 putative 3-oxoadipate enol-lactone hydrolase PF02627: Carboxymuconolactone decarboxylase family 6.36 40270 C specific pathways 2.1.1 BAC69417.1 Non-secretory protein CDS SAVERM_1707 2087101 2084414 putative regulatory protein PF07721: Tetratricopeptide repeat 4.88 95552 C regulation 3.5.2 BAC69418.1 Non-secretory protein CDS SAVERM_1708 2087282 2088634 putative integral membrane transport protein PF00083: Sugar (and other) transporter 10.25 46869 C transport / binding proteins & lipoproteins 1.2 BAC69419.1 Non-secretory protein CDS SAVERM_1709 2088639 2089793 hypothetical protein PF03702: Uncharacterised protein family (UPF0075) 5.87 39554 C similar to unknown proteins 5 BAC69420.1 Non-secretory protein CDS SAVERM_1710 2089889 2090881 putative membrane protein 4.95 32513 C miscellaneous 4.7 BAC69421.1 Non-secretory protein CDS SAVERM_1711 2091643 2091029 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.67 22471 C regulation 3.5.2 BAC69422.1 Non-secretory protein CDS SAVERM_1712 2091875 2092885 hypothetical protein PF01794: Ferric reductase like transmembrane component 9.31 34835 C similar to unknown proteins 5 BAC69423.1 Non-secretory protein CDS SAVERM_1713 2092882 2093826 putative integral membrane protein PF05231: MASE1 6.68 31032 C miscellaneous 4.7 BAC69424.1 Signal peptide CDS SAVERM_1714 2094774 2093917 hypothetical protein PF03803: Scramblase 7.91 31279 C similar to unknown proteins 5 BAC69425.1 Non-secretory protein CDS SAVERM_1715 2096878 2094827 plcA putative non-hemolytic phospholipase C, secreted Tat substrate, PF04185: Phosphoesterase family 6.47 74330 C metabolism of lipids 2.4 BAC69426.1 Non-secretory protein CDS SAVERM_1716 2097869 2097186 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.61 24371 C regulation 3.5.2 BAC69427.1 Non-secretory protein CDS SAVERM_1717 2098342 2097860 hypothetical protein PF00174: Oxidoreductase molybdopterin binding domain 6.63 16975 C no similarity 6 BAC69428.1 Non-secretory protein CDS SAVERM_1718 2098481 2098867 putative substrate-binding protein PF03459: TOBE domain 9.91 13624 C transport / binding proteins & lipoproteins 1.2 BAC69429.1 Non-secretory protein CDS SAVERM_1719 2098919 2099743 modA putative ABC transporter substrate-binding protein molybdate transport system substrate-binding protein 7.35 28063 C transport / binding proteins & lipoproteins 1.2 BAC69430.1 Signal peptide CDS SAVERM_1720 2099740 2100609 modB putative ABC transporter permease protein molybdate transport system permease protein 10.8 30129 C transport / binding proteins & lipoproteins 1.2 BAC69431.1 Non-secretory protein CDS SAVERM_1721 2100606 2101700 modC putative ABC transporter ATP-binding protein molybdate transport system ATP-binding protein 6.76 38348 C transport / binding proteins & lipoproteins 1.2 BAC69432.1 Non-secretory protein CDS SAVERM_1722 2101766 2102668 hypothetical protein PF03473: MOSC domain 7.31 32346 C similar to unknown proteins 5 BAC69433.1 Non-secretory protein CDS SAVERM_1723 2105156 2102982 putative mycodextranase, secreted PF00754: F5/8 type C domain 5.79 75015 C miscellaneous 4.7 BAC69434.1 Signal peptide CDS SAVERM_1724 2106815 2105214 aglA1 putative alpha-glucosidase PF00128: Alpha amylase, catalytic domain 4.88 58950 C specific pathways 2.1.1 BAC69435.1 Non-secretory protein CDS SAVERM_1725 2107722 2106847 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 10.02 31894 C transport / binding proteins & lipoproteins 1.2 BAC69436.1 Non-secretory protein CDS SAVERM_1726 2108675 2107719 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.94 34815 C transport / binding proteins & lipoproteins 1.2 BAC69437.1 Non-secretory protein CDS SAVERM_1727 2110021 2108681 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.92 48121 C transport / binding proteins & lipoproteins 1.2 BAC69438.1 Signal peptide CDS SAVERM_1728 2111160 2110168 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.4 34919 C regulation 3.5.2 BAC69439.1 Non-secretory protein CDS SAVERM_1729 2111935 2111207 putative GntR-family transcriptional regulator PF07729: FCD domain 7.97 25857 C regulation 3.5.2 BAC69440.1 Non-secretory protein CDS SAVERM_1730 2112949 2111948 putative proline racemase PF05544: Proline racemase 6.32 35532 C metabolism of amino acids & related molecules 2.2 BAC69441.1 Non-secretory protein CDS SAVERM_1731 2113854 2112964 dapA1 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 5.62 31720 C metabolism of amino acids & related molecules 2.2 BAC69442.1 Non-secretory protein CDS SAVERM_1732 2115350 2113851 putative oxidoreductase PF07992: Pyridine nucleotide-disulphide oxidoreductase 8.33 51619 C miscellaneous 4.7 BAC69443.1 Non-secretory protein CDS SAVERM_1733 2115639 2115340 hypothetical protein PF00111: 2Fe-2S iron-sulfur cluster binding domain 9.12 10399 C similar to unknown proteins 5 BAC69444.1 Non-secretory protein CDS SAVERM_1734 2116883 2115636 putative oxidoreductase PF01266: FAD dependent oxidoreductase 6.14 42979 C miscellaneous 4.7 BAC69445.1 Non-secretory protein CDS SAVERM_1735 2117837 2116980 potC1 putative polyamine ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.24 29993 C transport / binding proteins & lipoproteins 1.2 BAC69446.1 Non-secretory protein CDS SAVERM_1736 2118711 2117818 potB1 putative polyamine ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 11.17 32349 C transport / binding proteins & lipoproteins 1.2 BAC69447.1 Non-secretory protein CDS SAVERM_1737 2119963 2118719 potD1 putative polyamine ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 5.29 44742 C transport / binding proteins & lipoproteins 1.2 BAC69448.1 Signal peptide CDS SAVERM_1738 2121026 2119989 potA1 putative polyamine ABC transporter ATP-binding protein PF00005: ABC transporter 9.28 37670 C transport / binding proteins & lipoproteins 1.2 BAC69449.1 Non-secretory protein CDS SAVERM_1739 2121131 2121886 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.3 26980 C regulation 3.5.2 BAC69450.1 Non-secretory protein CDS SAVERM_1740 2121925 2122722 putative secreted protein PF02743: Cache domain 6.16 28164 C similar to unknown proteins 5 BAC69451.1 Non-secretory protein CDS SAVERM_1741 2123445 2122777 hypothetical protein PF00989: PAS domain 7.82 24572 C similar to unknown proteins 5 BAC69452.1 Non-secretory protein CDS SAVERM_1742 2123698 2124354 putative transcriptional regulator PF01381: Helix-turn-helix 6.37 24060 C regulation 3.5.2 BAC69453.1 Non-secretory protein CDS SAVERM_1743 2124387 2124917 hypothetical protein PF02178: AT hook motif 7.11 19151 C similar to unknown proteins 5 BAC69454.1 Non-secretory protein CDS SAVERM_1744 2124930 2126135 putative integral membrane protein 8.55 43448 C miscellaneous 4.7 BAC69455.1 Non-secretory protein CDS SAVERM_1745 2126119 2127579 putative monooxygenase PF01360: Monooxygenase 9.87 51264 C miscellaneous 4.7 BAC69456.1 Non-secretory protein CDS SAVERM_1746 2128686 2127643 putative hydrolase PF00561: alpha/beta hydrolase fold 9.41 38176 C miscellaneous 4.7 BAC69457.1 Non-secretory protein CDS SAVERM_1747 2128854 2129156 hypothetical protein 4.81 10691 C similar to unknown proteins 5 BAC69458.1 Non-secretory protein CDS SAVERM_1748 2129888 2129199 pptA2 putative 4’-phosphopantetheinyl transferase PF01648: 4'-phosphopantetheinyl transferase superfamily 6.25 25014 C metabolism of lipids 2.4 BAC69459.1 Non-secretory protein CDS SAVERM_1749 2130757 2129885 putative phosphoesterase (SimX4 homolog) PF00149: Calcineurin-like phosphoesterase 6.27 33146 C miscellaneous 4.7 BAC69460.1 Non-secretory protein CDS SAVERM_1750 2131075 2132220 hypothetical protein PF02222: ATP-grasp domain 5.6 40909 C similar to unknown proteins 5 BAC69461.1 Non-secretory protein CDS SAVERM_1751 2132343 2134028 chiD putative secreted chitinase I Tat substrate, PF02018: Carbohydrate binding domain 6.35 57677 C specific pathways 2.1.1 BAC69462.1 Signal peptide CDS SAVERM_1752 2135324 2134074 putative glycosyl hydrolase PF01120: Alpha-L-fucosidase 5.01 46650 C miscellaneous 4.7 BAC69463.1 Non-secretory protein CDS SAVERM_1753 2138499 2135431 ama1 putative alpha-mannosidase PF07748: Glycosyl hydrolases family 38 C-terminal domain 5.53 112842 C specific pathways 2.1.1 BAC69464.1 Non-secretory protein CDS SAVERM_1754 2139901 2138564 bglA1 putative 6-phospho-beta-glucosidase PF02056: Family 4 glycosyl hydrolase 5.54 47774 C specific pathways 2.1.1 BAC69465.1 Non-secretory protein CDS SAVERM_1755 2140683 2139898 putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 4.94 28004 C regulation 3.5.2 BAC69466.1 Non-secretory protein CDS SAVERM_1756 2140789 2141826 putative carbohydrate kinase PF00294: pfkB family carbohydrate kinase 4.73 36483 C miscellaneous 4.7 BAC69467.1 Non-secretory protein CDS SAVERM_1757 2141900 2143195 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.02 46991 C transport / binding proteins & lipoproteins 1.2 BAC69468.1 Signal peptide CDS SAVERM_1758 2143197 2144159 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.73 35167 C transport / binding proteins & lipoproteins 1.2 BAC69469.1 Non-secretory protein CDS SAVERM_1759 2144172 2145008 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.68 30471 C transport / binding proteins & lipoproteins 1.2 BAC69470.1 Non-secretory protein CDS SAVERM_1760 2145008 2147932 bga4 putative beta-galactosidase PF02836: Glycosyl hydrolases family 2, TIM barrel domain 5.36 106500 C specific pathways 2.1.1 BAC69471.1 Non-secretory protein CDS SAVERM_1761 2148133 2149821 hypothetical protein PF02231: PHP domain N-terminal region 6.86 61335 C similar to unknown proteins 5 BAC69472.1 Non-secretory protein CDS SAVERM_1762 2152782 2150017 hypothetical protein similar to StaR of Streptomyces toyocaensis NRRL15009, PF07721: Tetratricopeptide repeat 9.86 97799 C similar to unknown proteins 5 BAC69473.1 Non-secretory protein CDS SAVERM_1763 2153091 2154362 putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 6 44220 C transport / binding proteins & lipoproteins 1.2 BAC69474.1 Signal peptide CDS SAVERM_1764 2155064 2156464 lamA1 putative endo-1,3-beta-glucanase, secreted Tat substrate, PF03422: Carbohydrate binding module (family 6) 4.61 48281 C specific pathways 2.1.1 BAC69475.1 Signal peptide CDS SAVERM_1765 2157453 2156557 putative AraC-family transcriptional regulator PF02311: AraC-like ligand binding domain 8.15 33227 C regulation 3.5.2 BAC69476.1 Non-secretory protein CDS SAVERM_1766 2157594 2159675 tkt1 putative transketolase PF00456: Transketolase, thiamine diphosphate binding domain 5.01 74569 C main glycolytic pathways 2.1.2 BAC69477.1 Non-secretory protein CDS SAVERM_1767 2159695 2160831 tal1 putative transaldolase PF00923: Transaldolase 4.5 40308 C main glycolytic pathways 2.1.2 BAC69478.1 Non-secretory protein CDS SAVERM_1768 2160828 2162474 zwf1 putative glucose-6-phosphate 1-dehydrogenase PF02781: Glucose-6-phosphate dehydrogenase, C-terminal domain 5.02 61202 C main glycolytic pathways 2.1.2 BAC69479.1 Non-secretory protein CDS SAVERM_1769 2162471 2163406 opcA1 putative oxppcycle protein 4.83 33487 C miscellaneous 4.7 BAC69480.1 Non-secretory protein CDS SAVERM_1770 2163399 2165048 pgi1 putative glucose-6-phosphate isomerase PF00342: Phosphoglucose isomerase 5.16 60210 C main glycolytic pathways 2.1.2 BAC69481.1 Non-secretory protein CDS SAVERM_1771 2165064 2165942 gnd1 putative 6-phosphogluconate dehydrogenase PF03446: NAD binding domain of 6-phosphogluconate dehydrogenase 4.59 31438 C main glycolytic pathways 2.1.2 BAC69482.1 Non-secretory protein CDS SAVERM_1772 2165949 2166560 putative mutase PF00300: Phosphoglycerate mutase family 6.37 22218 C miscellaneous 4.7 BAC69483.1 Non-secretory protein CDS SAVERM_1773 2166642 2167097 terB putative tellurium resistance protein PF05099: Tellurite resistance protein TerB 4.71 16484 C detoxification 4.2 BAC69484.1 Non-secretory protein CDS SAVERM_1774 2167468 2170362 putative peroxidase PF03098: animal haem peroxidase 7.3 107605 C miscellaneous 4.7 BAC69485.1 Non-secretory protein CDS SAVERM_1775 2170472 2171929 hypothetical protein 8.33 53053 C similar to unknown proteins 5 BAC69486.1 Non-secretory protein CDS SAVERM_1776 2173741 2171936 putative sugar phosphate isomerase/epimerase PF01261: Xylose isomerase-like TIM barrel 5.96 64969 C miscellaneous 4.7 BAC69487.1 Non-secretory protein CDS SAVERM_1777 2174642 2173767 aroE2 putative shikimate 5-dehydrogenase EC:1.1.1.25 6.23 30129 C metabolism of amino acids & related molecules 2.2 BAC69488.1 Non-secretory protein CDS SAVERM_1778 2174818 2175483 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.81 24541 C regulation 3.5.2 BAC69489.1 Non-secretory protein CDS SAVERM_1779 2175736 2177088 putative 3-(2-hydroxyphenyl) propionic acid transporter PF00083: Sugar (and other) transporter 8.08 47431 C transport / binding proteins & lipoproteins 1.2 BAC69490.1 Non-secretory protein CDS SAVERM_1780 2177702 2177265 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 8.87 16668 C similar to unknown proteins 5 BAC69491.1 Non-secretory protein CDS SAVERM_1781 2177771 2178355 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.09 20564 C regulation 3.5.2 BAC69492.1 Non-secretory protein CDS SAVERM_1782 2178352 2179725 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.26 45401 C transport / binding proteins & lipoproteins 1.2 BAC69493.1 Non-secretory protein CDS SAVERM_1783 2179785 2181011 putative beta-lactamase PF00144: Beta-lactamase 6.3 44325 C detoxification 4.2 BAC69494.1 Non-secretory protein CDS SAVERM_1784 2181445 2181020 hypothetical protein PF07366: Protein of unknown function (DUF1486) 4.92 15625 C similar to unknown proteins 5 BAC69495.1 Non-secretory protein CDS SAVERM_1785 2182337 2181486 hypothetical protein 11.69 30169 C similar to unknown proteins 5 BAC69496.1 Non-secretory protein CDS SAVERM_1786 2183068 2182334 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 4.7 26205 C regulation 3.5.2 BAC69497.1 Non-secretory protein CDS SAVERM_1787 2184347 2183193 putative saccharopine dehydrogenase PF03435: Saccharopine dehydrogenase 4.74 40920 C metabolism of amino acids & related molecules 2.2 BAC69498.1 Non-secretory protein CDS SAVERM_1788 2185449 2184340 putative saccharopine dehydrogenase PF05222: Alanine dehydrogenase/PNT, N-terminal domain 4.87 40267 C metabolism of amino acids & related molecules 2.2 BAC69499.1 Non-secretory protein CDS SAVERM_1789 2186591 2185446 putative sarcosine oxidase subunit beta PF01266: FAD dependent oxidoreductase 5.97 40727 C metabolism of amino acids & related molecules 2.2 BAC69500.1 Non-secretory protein CDS SAVERM_1790 2187568 2186588 arcB1 putative ornithine cyclodeaminase PF02423: Ornithine cyclodeaminase/mu-crystallin family 5.18 33575 C metabolism of amino acids & related molecules 2.2 BAC69501.1 Non-secretory protein CDS SAVERM_1791 2188505 2187813 ribA2 putative GTP cyclohydrolase II PF00925: GTP cyclohydrolase II 6.34 24671 C metabolism of coenzymes & prosthetic groups 2.5 BAC69502.1 Non-secretory protein CDS SAVERM_1792 2188543 2189343 hypothetical protein PF02633: Creatinine amidohydrolase 5.27 28047 C similar to unknown proteins 5 BAC69503.1 Non-secretory protein CDS SAVERM_1793 2190674 2189175 hypothetical protein PF03706: Uncharacterised protein family (UPF0104) 11.47 52048 C similar to unknown proteins 5 BAC69504.1 Non-secretory protein CDS SAVERM_1794 2191627 2190671 putative secreted protein PF08241: Methyltransferase domain 5.17 33229 C similar to unknown proteins 5 BAC69505.1 Non-secretory protein CDS SAVERM_1795 2192766 2191624 putative glycosyltransferase PF00534: Glycosyl transferases group 1 6.29 39865 C specific pathways 2.1.1 BAC69506.1 Non-secretory protein CDS SAVERM_1796 2193257 2192859 hypothetical protein PF01242: 6-pyruvoyl tetrahydropterin synthase 5.49 14500 C similar to unknown proteins 5 BAC69507.1 Non-secretory protein CDS SAVERM_1797 2194412 2193432 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.95 34466 C miscellaneous 4.7 BAC69508.1 Non-secretory protein CDS SAVERM_1798 2194521 2195243 hypothetical protein PF01066: CDP-alcohol phosphatidyltransferase 11.23 25006 C similar to unknown proteins 5 BAC69509.1 Non-secretory protein CDS SAVERM_1799 2197470 2195380 fusA3 putative translation elongation factor G PF00009: Elongation factor Tu GTP binding domain 7 74070 C elongation 3.7.4 BAC69510.1 Non-secretory protein CDS SAVERM_1800 2199811 2197922 putative endo-1,4-beta-glucanase PF00754: F5/8 type C domain 5.51 68374 C miscellaneous 4.7 BAC69511.1 Signal peptide CDS SAVERM_1801 2201374 2200016 bglC1 putative beta-glucosidase PF00232: Glycosyl hydrolase family 1 6.29 49737 C specific pathways 2.1.1 BAC69512.1 Non-secretory protein CDS SAVERM_1802 2202276 2201404 putative multiple sugar ABC transporter permease protein malG, Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 10.02 31323 C transport / binding proteins & lipoproteins 1.2 BAC69513.1 Non-secretory protein CDS SAVERM_1803 2203267 2202269 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.89 36854 C transport / binding proteins & lipoproteins 1.2 BAC69514.1 Non-secretory protein CDS SAVERM_1804 2204598 2203282 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 8.35 45699 C transport / binding proteins & lipoproteins 1.2 BAC69515.1 Signal peptide CDS SAVERM_1805 2204780 2206078 putative ROK-family transcriptional regulator PF00480: ROK family 5.91 45177 C regulation 3.5.2 BAC69516.1 Non-secretory protein CDS SAVERM_1806 2206416 2208215 putative secreted protein Tat substrate 7.46 63280 C miscellaneous 4.7 BAC69517.1 Signal peptide CDS SAVERM_1807 2209414 2208269 putative NLP/P60-family secreted protein (PgpA peptidase) Tat substrate, PF00877: NlpC/P60 family 6.22 39461 C similar to unknown proteins 5 BAC69518.1 Signal peptide CDS SAVERM_1808 2210155 2209514 sig18 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 9.22 23477 C RNA initiation 3.5.1 BAC69519.1 Non-secretory protein CDS SAVERM_1809 2210961 2210275 putative dipeptidase PF01427: D-ala-D-ala dipeptidase 5.15 24856 C protein modification 3.8 BAC69520.1 Non-secretory protein CDS SAVERM_1810 2212124 2211087 putative regulatory protein frameshift 9.6 38500 C miscellaneous 4.7 BAC69521.1 Non-secretory protein CDS SAVERM_1811 2214322 2212064 putative regulatory protein frameshift 9.7 81571 C miscellaneous 4.7 BAC69522.1 Non-secretory protein CDS SAVERM_1812 2214722 2215747 putative secreted protein 10.48 37753 C no similarity 6 BAC69523.1 Non-secretory protein CDS SAVERM_1813 2215992 2216453 putative secreted protein 4.99 15847 C no similarity 6 BAC69524.1 Signal peptide CDS SAVERM_1814 2219466 2217271 putative ATP/GTP-binding protein PF05707: Zonular occludens toxin (Zot) 7.5 81642 C miscellaneous 4.7 BAC69525.1 Non-secretory protein CDS SAVERM_1815 2222168 2220285 putative ATP/GTP-binding protein PF09848: Uncharacterized conserved protein (DUF2075) 6.18 69306 C miscellaneous 4.7 BAC69526.1 Non-secretory protein CDS SAVERM_1816 2225155 2223614 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.65 55364 C specific pathways 2.1.1 BAC69527.1 Non-secretory protein CDS SAVERM_1817 2226183 2225284 sucD1 putative succinyl-CoA synthetase alpha subunit PF02629: CoA binding domain 6.17 30629 C TCA cycle 2.1.3 BAC69528.1 Non-secretory protein CDS SAVERM_1818 2227325 2226195 sucC1 putative succinyl-CoA synthetase beta subunit PF00549: CoA-ligase 4.94 39078 C TCA cycle 2.1.3 BAC69529.1 Non-secretory protein CDS SAVERM_1819 2227504 2229198 ilvB3 putative TPP-requiring enzyme (acetolactate synthase II) PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.75 60333 C metabolism of amino acids & related molecules 2.2 BAC69530.1 Non-secretory protein CDS SAVERM_1820 2229211 2230440 frc putative formyl-coenzyme A transferase PF02515: CoA-transferase family III 4.71 44360 C miscellaneous 4.7 BAC69531.1 Non-secretory protein CDS SAVERM_1821 2230442 2232589 acdA1 putative acyl-CoA synthetase (NDP forming type) PF02629: CoA binding domain 4.74 75676 C metabolism of lipids 2.4 BAC69532.1 Non-secretory protein CDS SAVERM_1822 2232616 2234097 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 9.52 52757 C transport / binding proteins & lipoproteins 1.2 BAC69533.1 Non-secretory protein CDS SAVERM_1823 2234099 2235505 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 8.82 50108 C transport / binding proteins & lipoproteins 1.2 BAC69534.1 Non-secretory protein CDS SAVERM_1824 2236741 2235737 putative sugar phosphate isomerases/epimerase PF01261: Xylose isomerase-like TIM barrel 4.59 37573 C specific pathways 2.1.1 BAC69535.1 Non-secretory protein CDS SAVERM_1825 2237962 2236754 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 6.51 43286 C miscellaneous 4.7 BAC69536.1 Non-secretory protein CDS SAVERM_1826 2239063 2238014 rbsB1 putative simple sugar ABC transporter substrate-binding protein Tat substrate, PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 8.18 36891 C transport / binding proteins & lipoproteins 1.2 BAC69537.1 Signal peptide CDS SAVERM_1827 2240100 2239081 rbsC1 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.18 34960 C transport / binding proteins & lipoproteins 1.2 BAC69538.1 Non-secretory protein CDS SAVERM_1828 2241635 2240097 rbsA1 putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 7.12 54352 C transport / binding proteins & lipoproteins 1.2 BAC69539.1 Non-secretory protein CDS SAVERM_1829 2242962 2241772 putative ROK-family transcriptional regulator PF00480: ROK family 6.24 40441 C regulation 3.5.2 BAC69540.1 Non-secretory protein CDS SAVERM_1830 2244009 2243335 putative GntR-family transcriptional regulator PF07729: FCD domain 6.1 24933 C regulation 3.5.2 BAC69541.1 Non-secretory protein CDS SAVERM_1831 2245107 2244160 fabH2 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 5.61 32371 C metabolism of lipids 2.4 BAC69542.1 Non-secretory protein CDS SAVERM_1832 2246739 2245408 putative integral membrane transporter PF07690: Major Facilitator Superfamily 8.31 46760 C transport / binding proteins & lipoproteins 1.2 BAC69543.1 Non-secretory protein CDS SAVERM_1833 2247042 2248013 apbA putative 2-dehydropantoate 2-reductase PF02558: Ketopantoate reductase PanE/ApbA 6.58 34192 C miscellaneous 4.7 BAC69544.1 Non-secretory protein CDS SAVERM_1834 2248010 2249935 fdnG putative formate dehydrogenase, major subunit (formate dehydrogenase alpha subunit) PF00384: Molybdopterin oxidoreductase 6.15 70818 C membrane bioenergetics 1.4 BAC69545.1 Non-secretory protein CDS SAVERM_1835 2249944 2251767 nuoF2 putative NADH dehydrogenase I chain F (complex I) PF01512: Respiratory-chain NADH dehydrogenase 51 Kd subunit 5.02 64134 C membrane bioenergetics 1.4 BAC69546.1 Non-secretory protein CDS SAVERM_1836 2251764 2252624 nuoG2 putative NADH dehydrogenase I chain G (complex I) PF04879: Molybdopterin oxidoreductase Fe4S4 domain 4.95 31177 C membrane bioenergetics 1.4 BAC69547.1 Non-secretory protein CDS SAVERM_1837 2252632 2253480 fdhD putative protein associated with oxidoreductase activity PF02634: FdhD/NarQ family 5.44 29767 C membrane bioenergetics 1.4 BAC69548.1 Non-secretory protein CDS SAVERM_1838 2254159 2253602 dhbB2 putative isochorismatase 2,3-dihydroxy-2,3-dihydrobenzoate synthase, PF00857: Isochorismatase family 4.44 19060 C metabolism of coenzymes & prosthetic groups 2.5 BAC69549.1 Non-secretory protein CDS SAVERM_1839 2254613 2254179 putative MarR-family transcriptional regulator PF01047: MarR family 9.41 15307 C regulation 3.5.2 BAC69550.1 Non-secretory protein CDS SAVERM_1840 2254913 2255629 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 8.45 24535 C miscellaneous 4.7 BAC69551.1 Non-secretory protein CDS SAVERM_1841 2255652 2256032 hypothetical protein 9.75 13428 C no similarity 6 BAC69552.1 Non-secretory protein CDS SAVERM_1842 2256926 2258803 neuA1 putative neuraminidase, secreted PF02012: BNR/Asp-box repeat 5.04 67137 C specific pathways 2.1.1 BAC69553.1 Signal peptide CDS SAVERM_1843 2258814 2260046 putative secreted protein 8.09 43863 C no similarity 6 BAC69554.1 Non-secretory protein CDS SAVERM_1844 2261025 2259985 putative transmembrane protein PF01758: Sodium Bile acid symporter family 11.43 36388 C miscellaneous 4.7 BAC69555.1 Non-secretory protein CDS SAVERM_1845 2261159 2262028 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 10.37 31865 C regulation 3.5.2 BAC69556.1 Non-secretory protein CDS SAVERM_1846 2263026 2262049 putative AsnC-family transcriptional regulator PF01037: AsnC family 6.52 34825 C regulation 3.5.2 BAC69557.1 Non-secretory protein CDS SAVERM_1847 2263141 2264625 putative integral membrane efflux protein PF07690: Major Facilitator Superfamily 11.24 49434 C transport / binding proteins & lipoproteins 1.2 BAC69558.1 Non-secretory protein CDS SAVERM_1848 2264965 2266791 fadD8 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.37 66754 C metabolism of lipids 2.4 BAC69559.1 Non-secretory protein CDS SAVERM_1849 2267015 2267851 putative oxidoreductase PF00248: Aldo/keto reductase family 4.92 30570 C miscellaneous 4.7 BAC69560.1 Non-secretory protein CDS SAVERM_1850 2268155 2268856 putative secreted protein PF07335: Fungal chitosanase 4.62 23814 C miscellaneous 4.7 BAC69561.1 Signal peptide CDS SAVERM_1851 2269635 2268934 putative dehydrogenase PF00106: short chain dehydrogenase 4.89 24211 C miscellaneous 4.7 BAC69562.1 Non-secretory protein CDS SAVERM_1852 2270690 2269812 hypothetical protein PF08242: Methyltransferase domain 5.07 31835 C similar to unknown proteins 5 BAC69563.1 Non-secretory protein CDS SAVERM_1853 2272616 2270907 guxA2 putative secreted cellulose 1,4-beta-cellobiosidase PF01341: Glycosyl hydrolases family 6 5.01 59116 C specific pathways 2.1.1 BAC69564.1 Signal peptide CDS SAVERM_1854 2274108 2272630 celA2 putative secreted endo-1,4-beta-glucanase PF00553: Cellulose binding domain 4.94 51955 C specific pathways 2.1.1 BAC69565.1 Signal peptide CDS SAVERM_1855 2274373 2277294 guxA3 putative secreted cellulose 1,4-beta-cellobiosidase PF02011: Glycosyl hydrolase family 48 5.28 103158 C specific pathways 2.1.1 BAC69566.1 Signal peptide CDS SAVERM_1856 2277394 2280042 celA3 putative secreted endo-1,4-beta-glucanase PF00553: Cellulose binding domain 5.15 92152 C specific pathways 2.1.1 BAC69567.1 Signal peptide CDS SAVERM_1857 2283006 2281132 guxA3 putative secreted glycosyl hydrolase Tat substrate, PF01839: FG-GAP repeat 5.03 66723 C specific pathways 2.1.1 BAC69568.1 Signal peptide CDS SAVERM_1858 2283653 2283348 dcoH putative pterin-4-alpha-carbinolamine dehydratase PF01329: Pterin 4 alpha carbinolamine dehydratase 5.07 10985 C metabolism of coenzymes & prosthetic groups 2.5 BAC69569.1 Non-secretory protein CDS SAVERM_1859 2284779 2283712 draG1 putative ADP-ribosylglycohydrolase PF03747: ADP-ribosylglycohydrolase 6.32 37363 C specific pathways 2.1.1 BAC69570.1 Non-secretory protein CDS SAVERM_1860 2284808 2285665 putative DNA-binding protein PF01381: Helix-turn-helix 5.62 31171 C regulation 3.5.2 BAC69571.1 Non-secretory protein CDS SAVERM_1861 2285819 2286682 putative DNA-binding protein PF01381: Helix-turn-helix 6.53 32755 C regulation 3.5.2 BAC69572.1 Non-secretory protein CDS SAVERM_1862 2287413 2286988 osmC putative osmotically inducible protein PF02566: OsmC-like protein 4.77 14303 C miscellaneous 4.7 BAC69573.1 Non-secretory protein CDS SAVERM_1863 2287656 2288348 putative secreted protein PF07721: Tetratricopeptide repeat 9.86 25292 C no similarity 6 BAC69574.1 Non-secretory protein CDS SAVERM_1864 2289461 2290849 hypothetical protein PF00092: von Willebrand factor type A domain 5.44 50246 C similar to unknown proteins 5 BAC69575.1 Non-secretory protein CDS SAVERM_1865 2291254 2290934 hypothetical protein 10.12 11576 C similar to unknown proteins 5 BAC69576.1 Non-secretory protein CDS SAVERM_1866 2293855 2291726 putative membrane protein PF01663: Type I phosphodiesterase / nucleotide pyrophosphatase 9.89 75718 C miscellaneous 4.7 BAC69577.1 Non-secretory protein CDS SAVERM_1867 2294419 2293994 hypothetical protein 8.07 15545 C similar to unknown proteins 5 BAC69578.1 Non-secretory protein CDS SAVERM_1868 2294521 2295288 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 9.68 27506 C similar to unknown proteins 5 BAC69579.1 Non-secretory protein CDS SAVERM_1869 2295335 2295958 putative integral membrane protein PF00597: DedA family 11.18 22231 C miscellaneous 4.7 BAC69580.1 Non-secretory protein CDS SAVERM_1870 2297234 2296065 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 8.71 43180 C similar to unknown proteins 5 BAC69581.1 Non-secretory protein CDS SAVERM_1871 2298556 2297231 hypothetical protein PF05726: Pirin C-terminal cupin domain 12.36 47709 C similar to unknown proteins 5 BAC69582.1 Non-secretory protein CDS SAVERM_1872 2299712 2298642 putative secreted protein 3.81 34560 C similar to unknown proteins 5 BAC69583.1 Signal peptide CDS SAVERM_1873 2300895 2300101 sig19 putative RNA polymerase sigma factor similar to SCO6520, RNA polymerase alternative sigma factor, PF04545: Sigma-70, region 4 5.68 29941 C RNA initiation 3.5.1 BAC69584.1 Non-secretory protein CDS SAVERM_1874 2301229 2301639 hypothetical protein PF11387: Protein of unknown function (DUF2795) 5.23 14623 C similar to unknown proteins 5 BAC69585.1 Non-secretory protein CDS SAVERM_1875 2301742 2302188 putative oxidoreductase PF00571: CBS domain 4.14 15436 C miscellaneous 4.7 BAC69586.1 Non-secretory protein CDS SAVERM_1876 2302227 2302772 pfpI1 putative intracellular protease/amidase PF01965: DJ-1/PfpI family 4.28 19503 C protein modification 3.8 BAC69587.1 Non-secretory protein CDS SAVERM_1877 2303285 2302968 hypothetical protein 10.37 11747 C similar to unknown proteins 5 BAC69588.1 Non-secretory protein CDS SAVERM_1878 2305034 2303415 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.12 60193 C transport / binding proteins & lipoproteins 1.2 BAC69589.1 Non-secretory protein CDS SAVERM_1879 2305147 2306640 hypothetical protein PF01569: PAP2 superfamily 11.6 52373 C similar to unknown proteins 5 BAC69590.1 Non-secretory protein CDS SAVERM_1880 2306776 2307597 putative methyltransferase-UbiE family PF01209: ubiE/COQ5 methyltransferase family 6.96 30194 C miscellaneous 4.7 BAC69591.1 Non-secretory protein CDS SAVERM_1881 2307895 2307611 gvpK2 putative gas vesicle synthesis protein PF05121: Gas vesicle protein K 4.3 10816 C gas vesicle 4.7.1 BAC69592.1 Non-secretory protein CDS SAVERM_1882 2308086 2307892 gvpS2 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 3.94 7023 C gas vesicle 4.7.1 BAC69593.1 Non-secretory protein CDS SAVERM_1883 2308850 2308083 gvpL2 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 5.25 28508 C gas vesicle 4.7.1 BAC69594.1 Non-secretory protein CDS SAVERM_1884 2309173 2308847 gvpJ2 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 4.5 11825 C gas vesicle 4.7.1 BAC69595.1 Non-secretory protein CDS SAVERM_1885 2310306 2309170 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 4.3 41373 C similar to unknown proteins 5 BAC69596.1 Non-secretory protein CDS SAVERM_1886 2310985 2310299 hypothetical protein 10.47 24388 C similar to unknown proteins 5 BAC69597.1 Non-secretory protein CDS SAVERM_1887 2311245 2310982 gvpG2 putative gas vesicle synthesis protein PF05120: Gas vesicle protein G 4.02 9565 C gas vesicle 4.7.1 BAC69598.1 Non-secretory protein CDS SAVERM_1888 2312053 2311286 gvpF2 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 4.76 27118 C gas vesicle 4.7.1 BAC69599.1 Non-secretory protein CDS SAVERM_1889 2312475 2312050 gvpA2 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 5.31 14970 C gas vesicle 4.7.1 BAC69600.1 Non-secretory protein CDS SAVERM_1890 2312879 2312532 gvpO2 putative gas vesicle synthesis protein PF05800: Gas vesicle synthesis protein GvpO 4.98 12887 C gas vesicle 4.7.1 BAC69601.1 Non-secretory protein CDS SAVERM_1891 2314933 2313083 tkt3 putative transketolase PF00456: Transketolase, thiamine diphosphate binding domain 4.97 65642 C main glycolytic pathways 2.1.2 BAC69602.1 Non-secretory protein CDS SAVERM_1892 2316291 2314930 ndh1 putative NADH dehydrogenase (complex I) PF00070: Pyridine nucleotide-disulphide oxidoreductase 8.33 48493 C membrane bioenergetics 1.4 BAC69603.1 Non-secretory protein CDS SAVERM_1893 2317171 2316560 putative membrane protein PF07332: Protein of unknown function (DUF1469) 11.39 21526 C miscellaneous 4.7 BAC69604.1 Non-secretory protein CDS SAVERM_1894 2317239 2317592 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.68 12362 C similar to unknown proteins 5 BAC69605.1 Non-secretory protein CDS SAVERM_1895 2318566 2317670 argI putative arginase PF00491: Arginase family 4.38 31587 C metabolism of amino acids & related molecules 2.2 BAC69606.1 Non-secretory protein CDS SAVERM_1896 2319135 2318593 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.51 19619 C miscellaneous 4.7 BAC69607.1 Non-secretory protein CDS SAVERM_1897 2320119 2319187 putative LD-carboxypeptidase (murein tetrapeptidase) PF02016: LD-carboxypeptidase 5.19 32743 C protein modification 3.8 BAC69608.1 Non-secretory protein CDS SAVERM_1898 2322116 2320116 putative acyl-peptide hydrolase PF00326: Prolyl oligopeptidase family 4.79 71727 C metabolism of lipids 2.4 BAC69609.1 Non-secretory protein CDS SAVERM_1899 2323452 2322130 putative peptidase PF01546: Peptidase family M20/M25/M40 4.75 47423 C protein modification 3.8 BAC69610.1 Non-secretory protein CDS SAVERM_1900 2324278 2323445 dppA2 putative D-aminopeptidase PF04951: D-aminopeptidase 4.65 29432 C protein modification 3.8 BAC69611.1 Non-secretory protein CDS SAVERM_1901 2325108 2324383 hypothetical protein PF05724: Thiopurine S-methyltransferase (TPMT) 4.85 25682 C similar to unknown proteins 5 BAC69612.1 Non-secretory protein CDS SAVERM_1902 2327708 2325246 hypothetical protein PF07228: Stage II sporulation protein E (SpoIIE) 4.83 88595 C similar to unknown proteins 5 BAC69613.1 Non-secretory protein CDS SAVERM_1903 2330284 2327906 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 6.74 82257 C transport / binding proteins & lipoproteins 1.2 BAC69614.1 Non-secretory protein CDS SAVERM_1904 2330881 2330438 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 4.64 16034 C similar to unknown proteins 5 BAC69615.1 Non-secretory protein CDS SAVERM_1905 2331042 2332082 hypothetical protein PF04055: Radical SAM superfamily 7.97 38811 C similar to unknown proteins 5 BAC69616.1 Non-secretory protein CDS SAVERM_1906 2332219 2333796 putative secreted peptidase PF00561: alpha/beta hydrolase fold 9.69 56057 C protein modification 3.8 BAC69617.1 Signal peptide CDS SAVERM_1907 2333984 2334619 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.48 23104 C miscellaneous 4.7 BAC69618.1 Non-secretory protein CDS SAVERM_1908 2335139 2334531 prpL2 putative magnesium or manganese-dependent protein phosphatase PF03130: PBS lyase HEAT-like repeat 10.03 21988 C protein modification 3.8 BAC69619.1 Non-secretory protein CDS SAVERM_1909 2335501 2337306 fadC1 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 5.56 63407 C metabolism of lipids 2.4 BAC69620.1 Non-secretory protein CDS SAVERM_1910 2337443 2338258 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.87 29610 C regulation 3.5.2 BAC69621.1 Non-secretory protein CDS SAVERM_1911 2338670 2340007 ccrA2 putative crotonyl-CoA reductase PF00107: Zinc-binding dehydrogenase 6.16 49160 C metabolism of lipids 2.4 BAC69622.1 Non-secretory protein CDS SAVERM_1912 2340018 2342066 meaA1 putative methylmalonyl-CoA mutase, coenzyme B12-dependent alpha subunit PF01642: Methylmalonyl-CoA mutase, PF02310: B12 binding domain 5.29 74658 C metabolism of coenzymes & prosthetic groups 2.5 BAC69623.1 Non-secretory protein CDS SAVERM_1913 2342063 2343028 citE2 putative citrate lyase beta chain PF03328: HpcH/HpaI aldolase/citrate lyase family 4.86 35197 C miscellaneous 4.7 BAC69624.1 Non-secretory protein CDS SAVERM_1914 2343034 2343561 putative MaoC-like dehydratase PF01575: MaoC like domain 6.89 19750 C similar to unknown proteins 5 BAC69625.1 Non-secretory protein CDS SAVERM_1915 2343564 2344769 fadE5 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.5 44127 C metabolism of lipids 2.4 BAC69626.1 Non-secretory protein CDS SAVERM_1916 2344940 2345587 psd putative phosphatidylserine decarboxylase PF02666: Phosphatidylserine decarboxylase 10.42 23337 C metabolism of lipids 2.4 BAC69627.1 Non-secretory protein CDS SAVERM_1917 2345646 2346428 pssA putative phosphatidylserine synthase PF01066: CDP-alcohol phosphatidyltransferase 8.97 27713 C metabolism of lipids 2.4 BAC69628.1 Non-secretory protein CDS SAVERM_1918 2347678 2346527 glxK putative glycerate kinase PF02595: Glycerate kinase family 4.49 37985 C main glycolytic pathways 2.1.2 BAC69629.1 Non-secretory protein CDS SAVERM_1919 2347825 2348958 hypothetical protein PF03747: ADP-ribosylglycohydrolase 4.81 40208 C similar to unknown proteins 5 BAC69630.1 Non-secretory protein CDS SAVERM_1920 2349134 2349628 hypothetical protein PF00293: NUDIX domain 4.24 17632 C similar to unknown proteins 5 BAC69631.1 Non-secretory protein CDS SAVERM_1921 2350196 2350636 putative integral membrane protein PF07681: DoxX 6.5 15699 C miscellaneous 4.7 BAC69632.1 Non-secretory protein CDS SAVERM_1922 2350818 2351657 gdh putative glucose 1-dehydrogenase PF00106: short chain dehydrogenase 5.14 29699 C specific pathways 2.1.1 BAC69633.1 Non-secretory protein CDS SAVERM_1923 2352169 2353203 cydA2 putative cytochrome bd-I oxidase subunit I (cytochrome bd complex) frameshift, PF01654: Bacterial Cytochrome Ubiquinol Oxidase 8.6 37362 C membrane bioenergetics 1.4 BAC69634.1 Non-secretory protein CDS SAVERM_1924 2353200 2354249 cydB2 putative cytochrome bd-I oxidase subunit II (cytochrome bd complex) PF02322: Cytochrome oxidase subunit II 10.1 36739 C membrane bioenergetics 1.4 BAC69635.1 Non-secretory protein CDS SAVERM_1925 2354246 2354812 gntK putative gluconokinase PF01202: Shikimate kinase 6.12 19686 C specific pathways 2.1.1 BAC69636.1 Non-secretory protein CDS SAVERM_1926 2355419 2354964 hypothetical protein PF01839: FG-GAP repeat 3.69 15655 C similar to unknown proteins 5 BAC69637.1 Non-secretory protein CDS SAVERM_1927 2355609 2356976 putative integral membrane protein PF03631: Ribonuclease BN-like family 10.22 47355 C miscellaneous 4.7 BAC69638.1 Non-secretory protein CDS SAVERM_1928 2357916 2356960 putative integral membrane protein PF04087: Domain of unknown function (DUF389) 7.9 33736 C miscellaneous 4.7 BAC69639.1 Non-secretory protein CDS SAVERM_1929 2358051 2358983 putative cyclase PF04199: Putative cyclase 5.69 32524 C similar to unknown proteins 5 BAC69640.1 Non-secretory protein CDS SAVERM_1930 2359062 2360699 chd putative choline dehydrogenase PF00732: GMC oxidoreductase 6.33 59774 C miscellaneous 4.7 BAC69641.1 Non-secretory protein CDS SAVERM_1931 2360696 2362114 hypothetical protein PF10009: Uncharacterized protein conserved in bacteria (DUF2252) 9.66 52654 C similar to unknown proteins 5 BAC69642.1 Non-secretory protein CDS SAVERM_1932 2362140 2363957 putative glycosyl hydrolase PF00723: Glycosyl hydrolases family 15 4.85 67401 C similar to unknown proteins 5 BAC69643.1 Non-secretory protein CDS SAVERM_1933 2364458 2363976 ogt1 putative methylated-DNA--protein-cysteine S-methyltransferase PF01035: 6-O-methylguanine DNA methyltransferase, DNA binding domain 6.79 17438 C DNA modification & repair 3.2 BAC69644.1 Non-secretory protein CDS SAVERM_1934 2365934 2364468 alkA1 putative ADA-like regulatory protein PF06029: AlkA N-terminal domain 9.12 53033 C regulation 3.5.2 BAC69645.1 Non-secretory protein CDS SAVERM_1935 2367722 2366193 putative iron-sulfur binding oxidoreductase PF00355: Rieske [2Fe-2S] domain 6.31 54779 C miscellaneous 4.7 BAC69646.1 Non-secretory protein CDS SAVERM_1936 2369790 2368372 putative dehydrogenase PF01593: Flavin containing amine oxidoreductase 9.56 50294 C miscellaneous 4.7 BAC69647.1 Non-secretory protein CDS SAVERM_1937 2370799 2369954 putative inositol monophosphatase PF00459: Inositol monophosphatase family 4.59 29777 C specific pathways 2.1.1 BAC69648.1 Non-secretory protein CDS SAVERM_1938 2372822 2370885 ggt1 putative gamma-glutamyltranspeptidase PF01019: Gamma-glutamyltranspeptidase 5.4 68752 C metabolism of amino acids & related molecules 2.2 BAC69649.1 Non-secretory protein CDS SAVERM_1939 2373040 2373903 hypothetical protein PF07754: Domain of unknown function (DUF1610) 6.02 29178 C similar to unknown proteins 5 BAC69650.1 Non-secretory protein CDS SAVERM_1940 2374411 2373980 hypothetical protein 6.7 15937 C no similarity 6 BAC69651.1 Non-secretory protein CDS SAVERM_1941 2375866 2374703 fdh putative NAD-dependent formate dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.89 42061 C membrane bioenergetics 1.4 BAC69652.1 Non-secretory protein CDS SAVERM_1942 2376076 2376690 crcB3 putative camphor resistance protein CrcB PF02537: CrcB-like protein 11.57 21754 C miscellaneous 4.7 BAC69653.1 Non-secretory protein CDS SAVERM_7580 2376687 2377058 crcB4 putative camphor resistance protein CrcB PF02537: CrcB-like protein 9.03 12809 C miscellaneous 4.7 BAF64419.1 Non-secretory protein CDS SAVERM_1943 2377711 2378349 amiS putative acetamide transporter protein PF02293: AmiS/UreI family transporter 9.71 22967 C transport / binding proteins & lipoproteins 1.2 BAC69654.1 Non-secretory protein CDS SAVERM_1944 2378374 2379624 amiE putative acetamidase PF03069: Acetamidase/Formamidase family 4.71 44987 C miscellaneous 4.7 BAC69655.1 Non-secretory protein CDS SAVERM_1945 2380619 2379723 hypothetical protein PF06604: Bacterial outer membrane lipoprotein omp19 10.36 31285 C similar to unknown proteins 5 BAC69656.1 Non-secretory protein CDS SAVERM_1946 2380833 2381501 putative secreted protein 9.02 23117 C similar to unknown proteins 5 BAC69657.1 Signal peptide CDS SAVERM_1947 2383102 2381561 putative cytosine/uracil/thiamine/allantoin permease PF02133: Permease for cytosine/purines, uracil, thiamine, allantoin 9.09 55372 C transport / binding proteins & lipoproteins 1.2 BAC69658.1 Non-secretory protein CDS SAVERM_1948 2384284 2383259 putative coenzyme F420-dependent N5,N10-methylene-tetrahydromethanopterin reductase PF00296: Luciferase-like monooxygenase 5.1 37261 C specific pathways 2.1.1 BAC69659.1 Non-secretory protein CDS SAVERM_1949 2385696 2384296 dht putative dihydropyrimidinase PF01979: Amidohydrolase family 5.31 50714 C metabolism of nucleotides & nucleic acids 2.3 BAC69660.1 Non-secretory protein CDS SAVERM_1950 2386642 2385800 putative hydrolase PF00795: Carbon-nitrogen hydrolase 4.66 31553 C miscellaneous 4.7 BAC69661.1 Non-secretory protein CDS SAVERM_1951 2388350 2386791 putative regulatory protein PF07905: Purine catabolism regulatory protein-like family 6.57 55511 C regulation 3.5.2 BAC69662.1 Non-secretory protein CDS SAVERM_1952 2389688 2388408 putative aminotransferase PF00202: Aminotransferase class-III 6.09 45442 C metabolism of amino acids & related molecules 2.2 BAC69663.1 Non-secretory protein CDS SAVERM_1953 2390527 2389685 putative hydrolase PF00795: Carbon-nitrogen hydrolase 4.94 31897 C miscellaneous 4.7 BAC69664.1 Non-secretory protein CDS SAVERM_1954 2392417 2390738 hypothetical protein PF01391: Collagen triple helix repeat (20 copies) 5.53 59519 C similar to unknown proteins 5 BAC69665.1 Non-secretory protein CDS SAVERM_1955 2392760 2392503 putative DNA-binding protein PF01381: Helix-turn-helix 8.55 9035 C regulation 3.5.2 BAC69666.1 Non-secretory protein CDS SAVERM_1956 2392839 2393624 map1 putative methionyl aminopeptidase PF00557: metallopeptidase family M24 5.76 26870 C protein modification 3.8 BAC69667.1 Non-secretory protein CDS SAVERM_1957 2395619 2393820 ggt2 putative gamma-glutamyltranspeptidase, secreted PF01019: Gamma-glutamyltranspeptidase 8.52 62486 C metabolism of coenzymes & prosthetic groups 2.5 BAC69668.1 Signal peptide CDS SAVERM_1958 2395725 2396480 putative secreted protein 9.9 27301 C miscellaneous 4.7 BAC69669.1 Non-secretory protein CDS SAVERM_1959 2396597 2398165 putative acyl esterase, secreted PF02129: X-Pro dipeptidyl-peptidase (S15 family) 5.71 55438 C detoxification 4.2 BAC69670.1 Signal peptide CDS SAVERM_1960 2399104 2398214 gluD1 putative glutamate ABC transporter permease gltK, PF00528: Binding-protein-dependent transport system inner membrane component 9.92 32571 C transport / binding proteins & lipoproteins 1.2 BAC69671.1 Non-secretory protein CDS SAVERM_1961 2399745 2399101 gluC1 putative glutamate ABC transporter permease gltK, PF00528: Binding-protein-dependent transport system inner membrane component 9.85 23074 C transport / binding proteins & lipoproteins 1.2 BAC69672.1 Non-secretory protein CDS SAVERM_1962 2400674 2399757 gluB1 putative glutamate ABC transporter substrate-binding protein gltI, PF01547: Bacterial extracellular solute-binding protein 7.85 33060 C transport / binding proteins & lipoproteins 1.2 BAC69673.1 Signal peptide CDS SAVERM_1963 2401454 2400693 gluA1 putative glutamate ABC transporter ATP-binding protein gltL, PF00005: ABC transporter 7.67 27977 C transport / binding proteins & lipoproteins 1.2 BAC69674.1 Non-secretory protein CDS SAVERM_1964 2401992 2401552 hypothetical protein 4.03 15835 C similar to unknown proteins 5 BAC69675.1 Non-secretory protein CDS SAVERM_1965 2402200 2403963 putative secreted protein Tat substrate, PF00657: GDSL-like Lipase/Acylhydrolase 7.12 60879 C miscellaneous 4.7 BAC69676.1 Signal peptide CDS SAVERM_1966 2404758 2403970 xthA putative exonuclease PF03372: Endonuclease/Exonuclease/phosphatase family 5.03 28845 C DNA modification & repair 3.2 BAC69677.1 Non-secretory protein CDS SAVERM_1967 2405474 2404839 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 5.83 22960 C similar to unknown proteins 5 BAC69678.1 Non-secretory protein CDS SAVERM_1968 2406842 2405547 pcaL2 putative 3-oxoadipate enol-lactone hydrolase PF02627: Carboxymuconolactone decarboxylase family 5.82 46011 C specific pathways 2.1.1 BAC69679.1 Non-secretory protein CDS SAVERM_1969 2407447 2406875 putative IS110 family ISLxx2-like transposase IS110 family 11.42 21349 C transposon & IS 4.5 BAC69680.1 Non-secretory protein CDS SAVERM_1970 2408478 2407717 putative dehydrogenase PF00106: short chain dehydrogenase 4.63 26602 C miscellaneous 4.7 BAC69681.1 Non-secretory protein CDS SAVERM_1971 2408669 2409541 putative DNA-binding protein PF01381: Helix-turn-helix 10.33 32463 C regulation 3.5.2 BAC69682.1 Non-secretory protein CDS SAVERM_1972 2409863 2409621 hypothetical protein PF00159: Pancreatic hormone peptide 4.52 8969 C similar to unknown proteins 5 BAC69683.1 Non-secretory protein CDS SAVERM_1973 2410929 2410108 putative hydrolase PF00561: alpha/beta hydrolase fold 6.34 30731 C miscellaneous 4.7 BAC69684.1 Non-secretory protein CDS SAVERM_1974 2412089 2411322 map2 putative methionyl aminopeptidase PF00557: metallopeptidase family M24 6.68 26727 C protein modification 3.8 BAC69685.1 Non-secretory protein CDS SAVERM_1975 2412155 2412460 putative DNA-binding protein PF01381: Helix-turn-helix 8.56 10895 C regulation 3.5.2 BAC69686.1 Non-secretory protein CDS SAVERM_1976 2412787 2412485 hypothetical protein PF06906: Protein of unknown function (DUF1272) 7.39 10334 C no similarity 6 BAC69687.1 Non-secretory protein CDS SAVERM_1977 2415392 2413020 hypothetical protein PF04434: SWIM zinc finger 4.99 83437 C similar to unknown proteins 5 BAC69688.1 Non-secretory protein CDS SAVERM_1978 2418277 2415389 helZ3 putative SNF2/RAD54 family helicase PF00176: SNF2 family N-terminal domain 6.26 102583 C DNA modification & repair 3.2 BAC69689.1 Non-secretory protein CDS SAVERM_1979 2418957 2418373 hypothetical protein 9.75 21784 C similar to unknown proteins 5 BAC69690.1 Non-secretory protein CDS SAVERM_1980 2420099 2418954 putative carbohydrate kinase PF00480: ROK family 8.72 41393 C miscellaneous 4.7 BAC69691.1 Non-secretory protein CDS SAVERM_1981 2420991 2420149 putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 6.58 30294 C transport / binding proteins & lipoproteins 1.2 BAC69692.1 Non-secretory protein CDS SAVERM_1982 2422019 2420988 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.88 36161 C transport / binding proteins & lipoproteins 1.2 BAC69693.1 Non-secretory protein CDS SAVERM_1983 2423020 2422016 putative simple sugar ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 8.06 35222 C transport / binding proteins & lipoproteins 1.2 BAC69694.1 Signal peptide CDS SAVERM_1984 2423921 2423172 putative GntR-family transcriptional regulator PF07702: UTRA domain 6.25 26908 C regulation 3.5.2 BAC69695.1 Non-secretory protein CDS SAVERM_1985 2424038 2425048 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 4.7 35715 C miscellaneous 4.7 BAC69696.1 Non-secretory protein CDS SAVERM_1986 2425492 2425067 paaI putative phenylacetic acid degradation protein PF03061: Thioesterase superfamily 5.51 14414 C specific pathways 2.1.1 BAC69697.1 Non-secretory protein CDS SAVERM_1987 2426744 2425563 cyp8 cytochrome P450 hydroxylase CYP107L2, adjacent to paaI 4.78 43126 C metabolism of coenzymes & prosthetic groups 2.5 BAC69698.1 Non-secretory protein CDS SAVERM_1988 2427457 2426786 putative two-component system response regulator PF00072: Response regulator receiver domain 5.09 23552 C regulation 3.5.2 BAC69699.1 Non-secretory protein CDS SAVERM_1989 2427604 2428632 putative aryl-alcohol dehydrogenase similar to norsolorinic acid reductase, PF00248: Aldo/keto reductase family 5 36964 C specific pathways 2.1.1 BAC69700.1 Non-secretory protein CDS SAVERM_1990 2430174 2428735 putative two-component system sensor kinase PF07730: Histidine kinase 10.32 50644 C sensors 1.3 BAC69701.1 Non-secretory protein CDS SAVERM_1991 2430785 2430390 putative guanyl-specific ribonuclease Sa3 precursor (RNase Sa3), secreted PF00545: ribonuclease 4.54 14147 C RNA modification 3.6 BAC69702.1 Signal peptide CDS SAVERM_1992 2431777 2430872 hypothetical protein PF00892: Integral membrane protein DUF6 12.11 30888 C similar to unknown proteins 5 BAC69703.1 Non-secretory protein CDS SAVERM_1993 2432511 2431903 hypothetical protein PF01872: RibD C-terminal domain 6.36 21645 C similar to unknown proteins 5 BAC69704.1 Non-secretory protein CDS SAVERM_1994 2432709 2433716 putative cation transporter PF01544: CorA-like Mg2+ transporter protein 6.01 37861 C transport / binding proteins & lipoproteins 1.2 BAC69705.1 Non-secretory protein CDS SAVERM_1995 2434884 2433754 alc putative allantoicase PF03561: Allantoicase repeat 6.24 41075 C metabolism of nucleotides & nucleic acids 2.3 BAC69706.1 Non-secretory protein CDS SAVERM_1996 2436291 2434954 pucH putative allantoinase PF01979: Amidohydrolase family 5.57 47581 C metabolism of nucleotides & nucleic acids 2.3 BAC69707.1 Non-secretory protein CDS SAVERM_1997 2436542 2437345 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 5.42 28130 C regulation 3.5.2 BAC69708.1 Non-secretory protein CDS SAVERM_1998 2438168 2437674 hypothetical protein 12.35 17694 C similar to unknown proteins 5 BAC69709.1 Non-secretory protein CDS SAVERM_1999 2438198 2438797 hypothetical protein PF01128: Uncharacterized protein family UPF0007 6.63 20414 C similar to unknown proteins 5 BAC69710.1 Non-secretory protein CDS SAVERM_2000 2439019 2440644 aceB1 putative malate synthase PF01274: Malate synthase 4.85 59998 C TCA cycle 2.1.3 BAC69711.1 Non-secretory protein CDS SAVERM_2001 2440948 2440649 hypothetical protein PF05169: Selenoprotein W-related family 7.52 11355 C similar to unknown proteins 5 BAC69712.1 Non-secretory protein CDS SAVERM_2002 2441841 2440927 hypothetical protein 5.09 33406 C similar to unknown proteins 5 BAC69713.1 Non-secretory protein CDS SAVERM_2003 2443400 2441883 putative siderophore biosynthesis protein/iron transport protein PF04183: IucA / IucC family 6.25 54974 C miscellaneous 4.7 BAC69714.1 Non-secretory protein CDS SAVERM_2004 2443486 2444994 putative siderophore biosynthesis protein/iron transport protein PF04183: IucA / IucC family 6.84 53397 C miscellaneous 4.7 BAC69715.1 Non-secretory protein CDS SAVERM_2005 2445049 2446311 putative secreted protein PF00092: von Willebrand factor type A domain 4.81 44322 C similar to unknown proteins 5 BAC69716.1 Signal peptide CDS SAVERM_2006 2446311 2447156 putative secreted protein 4.72 28891 C similar to unknown proteins 5 BAC69717.1 Signal peptide CDS SAVERM_2007 2448187 2447531 putative transcriptional regulator PF01638: Transcriptional regulator 7.06 23963 C regulation 3.5.2 BAC69718.1 Non-secretory protein CDS SAVERM_2008 2448255 2449463 aspB1 putative aspartate aminotransferase PF00155: Aminotransferase class I and II 5.77 44554 C metabolism of amino acids & related molecules 2.2 BAC69719.1 Non-secretory protein CDS SAVERM_2009 2449575 2450174 putative mutase PF00300: Phosphoglycerate mutase family 6.68 21523 C miscellaneous 4.7 BAC69720.1 Non-secretory protein CDS SAVERM_2010 2450817 2450191 putative secreted protein 12.32 20876 C no similarity 6 BAC69721.1 Signal peptide CDS SAVERM_2011 2450999 2451421 hypothetical protein PF03061: Thioesterase superfamily 5.26 15457 C similar to unknown proteins 5 BAC69722.1 Non-secretory protein CDS SAVERM_2012 2451875 2451474 putative transcriptional regulator PF01638: Transcriptional regulator 8.54 14724 C regulation 3.5.2 BAC69723.1 Non-secretory protein CDS SAVERM_2013 2451977 2453437 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.68 49625 C transport / binding proteins & lipoproteins 1.2 BAC69724.1 Non-secretory protein CDS SAVERM_2014 2453633 2455819 putative alpha-N-acetylglucosaminidase, secreted Tat substrate, PF05089: Alpha-N-acetylglucosaminidase (NAGLU) 10 80764 C cell wall 1.1 BAC69725.1 Signal peptide CDS SAVERM_2015 2455947 2456762 csn1 putative chitosanase, secreted Tat substrate, PF01374: Glycosyl hydrolase family 46 5.63 29349 C specific pathways 2.1.1 BAC69726.1 Signal peptide CDS SAVERM_2016 2458329 2456869 pbuX2 putative xanthine/uracil permease PF00860: Permease family 7.18 49543 C transport / binding proteins & lipoproteins 1.2 BAC69727.1 Non-secretory protein CDS SAVERM_2017 2459906 2458527 putative hydrolase PF01979: Amidohydrolase family 5.63 48808 C miscellaneous 4.7 BAC69728.1 Non-secretory protein CDS SAVERM_2018 2460988 2460041 pucL putative uricase PF01014: Uricase 6.24 36168 C metabolism of nucleotides & nucleic acids 2.3 BAC69729.1 Non-secretory protein CDS SAVERM_2019 2461402 2460995 hypothetical protein PF00576: Transthyretin precursor (formerly prealbumin) 6.51 14140 C similar to unknown proteins 5 BAC69730.1 Non-secretory protein CDS SAVERM_2020 2461917 2461399 hypothetical protein PF09349: OHCU decarboxylase 6.02 18620 C similar to unknown proteins 5 BAC69731.1 Non-secretory protein CDS SAVERM_2021 2462482 2462114 putative DNA-binding protein PF02796: Helix-turn-helix domain of resolvase 4.77 13216 C regulation 3.5.2 BAC69732.1 Non-secretory protein CDS SAVERM_2022 2462730 2462479 hypothetical protein 4.04 8688 C similar to unknown proteins 5 BAC69733.1 Non-secretory protein CDS SAVERM_2023 2463053 2464564 putative secreted protein Tat substrate 6.81 53121 C similar to unknown proteins 5 BAC69734.1 Signal peptide CDS SAVERM_2024 2464761 2465618 gip putative hydroxypyruvate isomerase PF01261: Xylose isomerase-like TIM barrel 4.42 30391 C specific pathways 2.1.1 BAC69735.1 Non-secretory protein CDS SAVERM_2025 2465738 2466655 garR putative 2-hydroxy-3-oxopropionate reductase PF03446: NAD binding domain of 6-phosphogluconate dehydrogenase 5.15 31138 C specific pathways 2.1.1 BAC69736.1 Non-secretory protein CDS SAVERM_2026 2466817 2468274 katA3 putative catalase PF00199: Catalase 6.3 53973 C detoxification 4.2 BAC69737.1 Non-secretory protein CDS SAVERM_2027 2468588 2468824 hypothetical protein 4.05 8607 C similar to unknown proteins 5 BAC69738.1 Non-secretory protein CDS SAVERM_2028 2470980 2469196 gcl putative glyoxylate carboligase PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.7 64017 C specific pathways 2.1.1 BAC69739.1 Non-secretory protein CDS SAVERM_2029 2471145 2472263 hypothetical protein 8.02 38774 C similar to unknown proteins 5 BAC69740.1 Non-secretory protein CDS SAVERM_2030 2473905 2472283 putative acyl-CoA synthetase PF00501: AMP-binding enzyme 5.01 58879 C metabolism of lipids 2.4 BAC69741.1 Non-secretory protein CDS SAVERM_2031 2475581 2473902 acsA4 putative acetyl-CoA synthetase PF00501: AMP-binding enzyme 5.23 61920 C specific pathways 2.1.1 BAC69742.1 Non-secretory protein CDS SAVERM_2032 2475684 2476523 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 9.32 28893 C regulation 3.5.2 BAC69743.1 Non-secretory protein CDS SAVERM_2033 2476757 2479567 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 7.78 99698 C regulation 3.5.2 BAC69744.1 Non-secretory protein CDS SAVERM_2034 2480500 2481291 putative trypsin-like protease, secreted PF00089: Trypsin 5.05 26378 C protein modification 3.8 BAC69745.1 Signal peptide CDS SAVERM_2035 2482710 2481442 putative secreted protein 10.24 45760 C similar to unknown proteins 5 BAC69746.1 Signal peptide CDS SAVERM_2036 2482828 2483988 corA4 putative metal-transport protein PF01544: CorA-like Mg2+ transporter protein 4.76 42776 C transport / binding proteins & lipoproteins 1.2 BAC69747.1 Non-secretory protein CDS SAVERM_2037 2484477 2484187 hypothetical protein PF07731: Multicopper oxidase 6.68 10960 C similar to unknown proteins 5 BAC69748.1 Non-secretory protein CDS SAVERM_2038 2484862 2484587 hypothetical protein 10.56 9822 C no similarity 6 BAC69749.1 Non-secretory protein CDS SAVERM_2039 2485130 2486941 mcmB putative methylmalonyl-CoA mutase, beta subunit PF01642: Methylmalonyl-CoA mutase 4.94 63116 C metabolism of coenzymes & prosthetic groups 2.5 BAC69750.1 Non-secretory protein CDS SAVERM_2040 2486941 2489115 meaA2 putative methylmalonyl-CoA mutase, coenzyme B12-dependent alpha subunit PF01642: Methylmalonyl-CoA mutase, PF02310: B12 binding domain 4.96 78726 C metabolism of coenzymes & prosthetic groups 2.5 BAC69751.1 Non-secretory protein CDS SAVERM_2041 2489130 2490116 argK1 putative lysine arginine ornithine transport system kinase PF03308: ArgK protein 7.81 34877 C transport / binding proteins & lipoproteins 1.2 BAC69752.1 Non-secretory protein CDS SAVERM_2042 2491605 2490199 putative DNA-binding protein PF06114: Domain of unknown function (DUF955) 8.75 52384 C regulation 3.5.2 BAC69753.1 Non-secretory protein CDS SAVERM_2043 2491982 2493265 aceA putative isocitrate lyase PF00463: Isocitrate lyase family 4.99 46550 C TCA cycle 2.1.3 BAC69754.1 Non-secretory protein CDS SAVERM_2044 2493411 2495003 aceB2 putative malate synthase glcB, PF01274: Malate synthase 6.36 59224 C TCA cycle 2.1.3 BAC69755.1 Non-secretory protein CDS SAVERM_2045 2495000 2495869 fadC2 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 5.72 30837 C metabolism of lipids 2.4 BAC69756.1 Non-secretory protein CDS SAVERM_2046 2496389 2498707 metE putative 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase PF01717: Methionine synthase, vitamin-B12 independent 5 83151 C metabolism of amino acids & related molecules 2.2 BAC69757.1 Non-secretory protein CDS SAVERM_2047 2498826 2499458 hypothetical protein PF00300: Phosphoglycerate mutase family 5.06 21847 C similar to unknown proteins 5 BAC69758.1 Non-secretory protein CDS SAVERM_2048 2499997 2499563 hypothetical protein 9.65 15280 C no similarity 6 BAC69759.1 Non-secretory protein CDS SAVERM_2049 2500935 2500177 putative secreted protein PF09490: Probable cobalt transporter subunit (CbtA) 9.33 26621 C similar to unknown proteins 5 BAC69760.1 Non-secretory protein CDS SAVERM_2050 2501176 2500955 hypothetical protein 6.5 7764 C similar to unknown proteins 5 BAC69761.1 Non-secretory protein CDS SAVERM_2051 2501942 2501322 putative hydrolase PF00144: Beta-lactamase 5.7 21694 C miscellaneous 4.7 BAC69762.1 Non-secretory protein CDS SAVERM_2052 2502254 2503138 hypothetical protein PF04138: GtrA-like protein 11.93 30573 C similar to unknown proteins 5 BAC69763.1 Non-secretory protein CDS SAVERM_2053 2503388 2503894 ogt2 putative methylated-DNA--protein-cysteine S-methyltransferase PF01035: 6-O-methylguanine DNA methyltransferase, DNA binding domain 5.78 17778 C DNA modification & repair 3.2 BAC69764.1 Non-secretory protein CDS SAVERM_2054 2504022 2504753 hypothetical protein PF09859: Uncharacterized protein conserved in bacteria (DUF2086) 7.02 27092 C similar to unknown proteins 5 BAC69765.1 Non-secretory protein CDS SAVERM_2055 2505988 2504984 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 9.89 36029 C miscellaneous 4.7 BAC69766.1 Non-secretory protein CDS SAVERM_2056 2506218 2506607 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.68 14117 C regulation 3.5.2 BAC69767.1 Non-secretory protein CDS SAVERM_2057 2507261 2506932 hypothetical protein PF09339: IclR helix-turn-helix domain 7.78 12126 C similar to unknown proteins 5 BAC69768.1 Non-secretory protein CDS SAVERM_2058 2507392 2508177 hypothetical protein PF03861: ANTAR domain 5.31 27750 C similar to unknown proteins 5 BAC69769.1 Non-secretory protein CDS SAVERM_2059 2509550 2508252 putative two-component system sensor kinase PF07730: Histidine kinase 10.82 45789 C sensors 1.3 BAC69770.1 Non-secretory protein CDS SAVERM_2060 2509863 2510627 putative polysaccharide deacetylase, secreted PF01522: Polysaccharide deacetylase 9.95 27809 C cell wall 1.1 BAC69771.1 Signal peptide CDS SAVERM_2061 2511890 2510664 cyp9 cytochrome P450 hydroxylase CYP179A1 6.94 44778 C metabolism of coenzymes & prosthetic groups 2.5 BAC69772.1 Non-secretory protein CDS SAVERM_2062 2513007 2512000 hypothetical protein PF10042: Uncharacterized conserved protein (DUF2278) 5.07 36325 C similar to unknown proteins 5 BAC69773.1 Non-secretory protein CDS SAVERM_2063 2513146 2513595 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 10.36 16119 C similar to unknown proteins 5 BAC69774.1 Non-secretory protein CDS SAVERM_2064 2513783 2514493 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 5.51 25698 C miscellaneous 4.7 BAC69775.1 Non-secretory protein CDS SAVERM_2065 2515653 2514502 hypothetical protein PF02625: XdhC and CoxI family 5.42 39980 C similar to unknown proteins 5 BAC69776.1 Non-secretory protein CDS SAVERM_2066 2517183 2515726 putative xanthine/uracil permease PF00860: Permease family 8.09 50164 C transport / binding proteins & lipoproteins 1.2 BAC69777.1 Non-secretory protein CDS SAVERM_2067 2519729 2517348 pucB putative xanthine dehydrogenase PF02738: Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain 5.55 84527 C metabolism of nucleotides & nucleic acids 2.3 BAC69778.1 Non-secretory protein CDS SAVERM_2068 2520322 2519732 putative oxidoreductase PF01799: [2Fe-2S] binding domain 4.29 20746 C miscellaneous 4.7 BAC69779.1 Non-secretory protein CDS SAVERM_2069 2521221 2520322 putative dehydrogenase PF00941: FAD binding domain in molybdopterin dehydrogenase 6.72 31945 C miscellaneous 4.7 BAC69780.1 Non-secretory protein CDS SAVERM_2070 2521609 2523282 putative regulatory protein PF07905: Purine catabolism regulatory protein-like family 5.83 59658 C regulation 3.5.2 BAC69781.1 Non-secretory protein CDS SAVERM_2071 2523435 2524208 hypothetical protein 7.61 27311 C similar to unknown proteins 5 BAC69782.1 Non-secretory protein CDS SAVERM_2072 2524564 2524283 hypothetical protein 12.14 10401 C no similarity 6 BAC69783.1 Non-secretory protein CDS SAVERM_2073 2525588 2524698 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 9.29 31747 C regulation 3.5.2 BAC69784.1 Non-secretory protein CDS SAVERM_2074 2525772 2526599 hypothetical protein putative IdeR-binding site: TAAGGTAAGCCTTACCTGT(2525725:2525743) 5.05 29787 C similar to unknown proteins 5 BAC69785.1 Non-secretory protein CDS SAVERM_2075 2526922 2527974 putative transmembrane protein 9.84 38644 C miscellaneous 4.7 BAC69786.1 Non-secretory protein CDS SAVERM_2076 2528463 2528041 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.93 15325 C regulation 3.5.2 BAC69787.1 Non-secretory protein CDS SAVERM_2077 2529568 2529077 putative secreted protein 10.3 17435 C no similarity 6 BAC69788.1 Signal peptide CDS SAVERM_2078 2530509 2529637 hypothetical protein 8.21 30571 C similar to unknown proteins 5 BAC69789.1 Non-secretory protein CDS SAVERM_2079 2532463 2530721 poxB2 putative pyruvate dehydrogenase/oxidase FAD and thiamine PPi cofactors PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 7.4 62535 C main glycolytic pathways 2.1.2 BAC69790.1 Non-secretory protein CDS SAVERM_2080 2534542 2532518 hypothetical protein 4.95 68653 C similar to unknown proteins 5 BAC69791.1 Non-secretory protein CDS SAVERM_2081 2535097 2536080 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 4.91 34794 C regulation 3.5.2 BAC69792.1 Non-secretory protein CDS SAVERM_2082 2536117 2536599 putative secreted protein PF04306: Protein of unknown function (DUF456) 12.1 16840 C similar to unknown proteins 5 BAC69793.1 Non-secretory protein CDS SAVERM_2083 2538014 2536749 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 11.11 43861 C miscellaneous 4.7 BAC69794.1 Signal peptide CDS SAVERM_2084 2538106 2538507 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 6.68 14708 C similar to unknown proteins 5 BAC69795.1 Non-secretory protein CDS SAVERM_2085 2539989 2538571 alkA2 putative ADA-like regulatory protein PF06029: AlkA N-terminal domain 9.61 50548 C regulation 3.5.2 BAC69796.1 Non-secretory protein CDS SAVERM_2086 2541288 2540161 engC putative ribosome-associated GTPase PF03193: Protein of unknown function, DUF258 5.94 39990 C miscellaneous 4.7 BAC69797.1 Non-secretory protein CDS SAVERM_2087 2544659 2543124 putative cellulose-binding protein PF00553: Cellulose binding domain 6.1 53687 C specific pathways 2.1.1 BAC69798.1 Non-secretory protein CDS SAVERM_2088 2546384 2545065 hypothetical protein PF04055: Radical SAM superfamily 5.06 49269 C similar to unknown proteins 5 BAC69799.1 Non-secretory protein CDS SAVERM_2089 2547617 2546610 putative 2-hydroxyacid-family dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.9 35716 C miscellaneous 4.7 BAC69800.1 Non-secretory protein CDS SAVERM_2090 2547752 2549020 putative alditol oxidase PF01565: FAD binding domain 6.09 44939 C miscellaneous 4.7 BAC69801.1 Non-secretory protein CDS SAVERM_2091 2549143 2550417 putative ROK-family transcriptional regulator repressor for sugar metabolism, PF00480: ROK family 6.01 44289 C regulation 3.5.2 BAC69802.1 Non-secretory protein CDS SAVERM_2092 2550619 2551920 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.01 47128 C transport / binding proteins & lipoproteins 1.2 BAC69803.1 Non-secretory protein CDS SAVERM_2093 2551959 2552921 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.67 35549 C transport / binding proteins & lipoproteins 1.2 BAC69804.1 Non-secretory protein CDS SAVERM_2094 2552918 2553808 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 8.05 32715 C transport / binding proteins & lipoproteins 1.2 BAC69805.1 Non-secretory protein CDS SAVERM_2095 2553836 2556883 bga5 putative beta-galactosidase PF02836: Glycosyl hydrolases family 2, TIM barrel domain 4.76 111765 C specific pathways 2.1.1 BAC69806.1 Non-secretory protein CDS SAVERM_2096 2557028 2558104 xynA1 putative endo-1,4-beta xylanase, secreted PF00331: Glycosyl hydrolase family 10 6.61 38259 C specific pathways 2.1.1 BAC69807.1 Signal peptide CDS SAVERM_2097 2560583 2558196 uvrA2 putative excinuclease ABC subunit A PF00005: ABC transporter 6.41 84030 C DNA modification & repair 3.2 BAC69808.1 Non-secretory protein CDS SAVERM_2098 2560900 2561484 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.33 21320 C regulation 3.5.2 BAC69809.1 Non-secretory protein CDS SAVERM_2099 2561477 2562298 putative hydrolase PF00561: alpha/beta hydrolase fold 4.84 28291 C miscellaneous 4.7 BAC69810.1 Non-secretory protein CDS SAVERM_2100 2562322 2563719 hypothetical protein 8.5 49845 C no similarity 6 BAC69811.1 Non-secretory protein CDS SAVERM_2101 2563757 2564527 hypothetical protein 6.96 27813 C no similarity 6 BAC69812.1 Non-secretory protein CDS SAVERM_2102 2564933 2564514 hypothetical protein PF00293: NUDIX domain 4.54 15725 C similar to unknown proteins 5 BAC69813.1 Non-secretory protein CDS SAVERM_2103 2565795 2565010 hypothetical protein 4.91 26659 C similar to unknown proteins 5 BAC69814.1 Non-secretory protein CDS SAVERM_2104 2566313 2565792 hypothetical protein 4.6 19143 C similar to unknown proteins 5 BAC69815.1 Non-secretory protein CDS SAVERM_2105 2566572 2567558 ephB putative epoxide hydrolase PF00561: alpha/beta hydrolase fold 5.36 35755 C specific pathways 2.1.1 BAC69816.1 Non-secretory protein CDS SAVERM_2106 2569253 2567544 hypothetical protein PF10022: Uncharacterized protein conserved in bacteria (DUF2264) 5.06 61301 C similar to unknown proteins 5 BAC69817.1 Non-secretory protein CDS SAVERM_2107 2570378 2569356 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 5.86 35786 C similar to unknown proteins 5 BAC69818.1 Signal peptide CDS SAVERM_2108 2570591 2572267 putative rhamnogalacturonase B precursor, secreted Tat substrate, PF09284: Rhamnogalacturonase B, N-terminal 9.18 58419 C specific pathways 2.1.1 BAC69819.1 Signal peptide CDS SAVERM_2109 2573674 2572280 putative beta-xylosidase, secreted PF00652: QXW lectin repeat 5.62 49786 C specific pathways 2.1.1 BAC69820.1 Signal peptide CDS SAVERM_2110 2574066 2574395 hypothetical protein 12.51 11541 C no similarity 6 BAC69821.1 Non-secretory protein CDS SAVERM_2111 2574586 2575527 mmuM putative homocysteine S-methyltransferase (S-methylmethionine-dependent) PF02574: Homocysteine S-methyltransferase 4.46 32575 C metabolism of amino acids & related molecules 2.2 BAC69822.1 Non-secretory protein CDS SAVERM_2112 2576834 2575584 putative hydrolase PF03747: ADP-ribosylglycohydrolase 6.31 44676 C miscellaneous 4.7 BAC69823.1 Non-secretory protein CDS SAVERM_2113 2578756 2577155 putative carboxylesterase, secreted PF00135: Carboxylesterase 10.05 57790 C detoxification 4.2 BAC69824.1 Non-secretory protein CDS SAVERM_2114 2579136 2580185 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 9.45 37646 C regulation 3.5.2 BAC69825.1 Non-secretory protein CDS SAVERM_2115 2580182 2582632 putative membrane protein 4.66 86399 C miscellaneous 4.7 BAC69826.1 Signal peptide CDS SAVERM_2116 2583333 2582629 putative glycosyl hydrolase PF06283: Trehalose utilisation 5.76 25452 C miscellaneous 4.7 BAC69827.1 Non-secretory protein CDS SAVERM_2117 2584100 2583441 putative secreted protein 7.35 22241 C similar to unknown proteins 5 BAC69828.1 Signal peptide CDS SAVERM_2118 2584256 2584654 putative quinone binding protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.34 14221 C metabolism of coenzymes & prosthetic groups 2.5 BAC69829.1 Non-secretory protein CDS SAVERM_2119 2585353 2584640 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 10.82 25358 C regulation 3.5.2 BAC69830.1 Non-secretory protein CDS SAVERM_2120 2586424 2585462 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.15 34583 C regulation 3.5.2 BAC69831.1 Non-secretory protein CDS SAVERM_2121 2586505 2587338 putative secreted protein PF01113: Dihydrodipicolinate reductase, N-terminus 4.93 29472 C similar to unknown proteins 5 BAC69832.1 Non-secretory protein CDS SAVERM_2122 2588443 2587406 putative integral membrane protein, ribonuclease BN-like family PF03631: Ribonuclease BN-like family 4.96 37261 C miscellaneous 4.7 BAC69833.1 Non-secretory protein CDS SAVERM_2123 2588694 2590343 fadE23 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.39 58933 C metabolism of lipids 2.4 BAC69834.1 Non-secretory protein CDS SAVERM_2124 2590650 2591975 putative regulatory protein PF01590: GAF domain 9.38 47372 C regulation 3.5.2 BAC69835.1 Non-secretory protein CDS SAVERM_2125 2592140 2593543 putative secreted protein 6.39 49800 C miscellaneous 4.7 BAC69836.1 Signal peptide CDS SAVERM_2126 2593623 2594195 cysE putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.08 21264 C metabolism of amino acids & related molecules 2.2 BAC69837.1 Non-secretory protein CDS SAVERM_2127 2594566 2596260 nirA putative ferredoxin-nitrite reductase PF01077: Nitrite and sulphite reductase 4Fe-4S domain 6.27 62754 C metabolism of amino acids & related molecules 2.2 BAC69838.1 Non-secretory protein CDS SAVERM_2128 2596328 2596507 hypothetical protein 4.35 6453 C similar to unknown proteins 5 BAC69839.1 Non-secretory protein CDS SAVERM_2129 2596504 2597241 cysH putative phosphoadenosine phosphosulfate reductase PF01507: Phosphoadenosine phosphosulfate reductase family 4.83 26936 C metabolism of amino acids & related molecules 2.2 BAC69840.1 Non-secretory protein CDS SAVERM_2130 2597283 2597819 cysC1 putative adenylylsulfate kinase PF01583: Adenylylsulphate kinase 5.59 19029 C metabolism of amino acids & related molecules 2.2 BAC69841.1 Non-secretory protein CDS SAVERM_2131 2597816 2598751 cysD1 putative sulfate adenylyltransferase subunit 2 completely same as SAV2313, PF01507: Phosphoadenosine phosphosulfate reductase family 6.06 35382 C metabolism of sulfur 2.7 BAC69842.1 Non-secretory protein CDS SAVERM_2132 2598754 2600109 cysN1 putative sulfate adenylyltransferase large subunit PF00009: Elongation factor Tu GTP binding domain 4.68 48148 C miscellaneous 4.7 BAC69843.1 Non-secretory protein CDS SAVERM_2134 2600310 2601458 ssuA3 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding protein, Tat substrate, PF09084: NMT1/THI5 like 9.75 39754 C transport / binding proteins & lipoproteins 1.2 BAC69845.1 Signal peptide CDS SAVERM_2135 2601471 2602283 ssuB3 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein, PF00005: ABC transporter 7.35 29577 C transport / binding proteins & lipoproteins 1.2 BAC69846.1 Non-secretory protein CDS SAVERM_2136 2602270 2603181 ssuC3 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 9.57 32465 C transport / binding proteins & lipoproteins 1.2 BAC69847.1 Non-secretory protein CDS SAVERM_2137 2603189 2603926 hypothetical protein PF01903: CbiX 9.29 26171 C similar to unknown proteins 5 BAC69848.1 Non-secretory protein CDS SAVERM_2138 2604580 2603984 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 4.54 21671 C similar to unknown proteins 5 BAC69849.1 Non-secretory protein CDS SAVERM_2139 2604877 2605152 hypothetical protein PF00248: Aldo/keto reductase family 4.23 10114 C similar to unknown proteins 5 BAC69850.1 Non-secretory protein CDS SAVERM_2140 2605766 2605221 hypothetical protein PF08002: Protein of unknown function (DUF1697) 6.8 19671 C similar to unknown proteins 5 BAC69851.1 Non-secretory protein CDS SAVERM_2141 2606063 2608336 putative integral membrane protein PF03176: MMPL family 6.38 79583 C miscellaneous 4.7 BAC69852.1 Non-secretory protein CDS SAVERM_2142 2609378 2608407 pgsA4 putative phosphatidylglycerophosphate synthase PF01066: CDP-alcohol phosphatidyltransferase 9.7 36477 C metabolism of lipids 2.4 BAC69853.1 Non-secretory protein CDS SAVERM_2143 2610945 2609665 putative ABC transporter substrate-binding protein Tat substrate, PF01547: Bacterial extracellular solute-binding protein 5.65 46242 O transport / binding proteins & lipoproteins 1.2 BAC69854.1 Signal peptide CDS SAVERM_2144 2611778 2610945 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 11.32 29927 O transport / binding proteins & lipoproteins 1.2 BAC69855.1 Non-secretory protein CDS SAVERM_2145 2612713 2611775 putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.96 33605 O transport / binding proteins & lipoproteins 1.2 BAC69856.1 Non-secretory protein CDS SAVERM_2146 2612960 2613823 hypothetical protein PF01636: Phosphotransferase enzyme family 4.98 31227 O similar to unknown proteins 5 BAC69857.1 Non-secretory protein CDS SAVERM_2147 2614584 2613862 dnaQ3 putative DNA polymerase III epsilon subunit PF00929: Exonuclease 5.19 26358 O DNA replication 3.1 BAC69858.1 Non-secretory protein CDS SAVERM_2148 2616017 2614725 hypothetical protein 5.6 47436 O similar to unknown proteins 5 BAC69859.1 Non-secretory protein CDS SAVERM_2149 2617398 2616079 putative copper amine oxidase, secreted PF01179: Copper amine oxidase, enzyme domain 8.87 47736 O miscellaneous 4.7 BAC69860.1 Signal peptide CDS SAVERM_2150 2618409 2617549 putative secreted protein 5.75 29675 O no similarity 6 BAC69861.1 Signal peptide CDS SAVERM_2151 2618580 2620688 glgX1 putative glycogen debranching enzyme PF02922: Carbohydrate-binding module 48 (Isoamylase N-terminal domain) 5.6 79094 O specific pathways 2.1.1 BAC69862.1 Non-secretory protein CDS SAVERM_2152 2621126 2623513 amyA1 putative alpha-amylase PF00128: Alpha amylase, catalytic domain 5.89 86075 O specific pathways 2.1.1 BAC69863.1 Non-secretory protein CDS SAVERM_2153 2624516 2623527 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.91 35204 O regulation 3.5.2 BAC69864.1 Non-secretory protein CDS SAVERM_2154 2624596 2626032 lpdA2 putative dihydrolipoamide dehydrogenase PF07992: Pyridine nucleotide-disulphide oxidoreductase 6.56 49870 O TCA cycle 2.1.3 BAC69865.1 Non-secretory protein CDS SAVERM_2155 2626186 2627436 putative 3-hydroxyacyl-CoA dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 6.73 44870 O metabolism of lipids 2.4 BAC69866.1 Non-secretory protein CDS SAVERM_2156 2627916 2627476 sti1 putative subtilisin inhibitor, secreted PF00720: Subtilisin inhibitor-like 6.94 15237 O protein modification 3.8 BAC69867.1 Signal peptide CDS SAVERM_2157 2629322 2627913 putative carboxypeptidase PF00246: Zinc carboxypeptidase 6.14 50512 O protein modification 3.8 BAC69868.1 Non-secretory protein CDS SAVERM_2158 2630123 2629485 hypothetical protein PF00498: FHA domain 10.87 23258 O similar to unknown proteins 5 BAC69869.1 Non-secretory protein CDS SAVERM_2159 2630209 2631954 amyA2 putative alpha-amylase PF00128: Alpha amylase, catalytic domain 5.49 63692 O specific pathways 2.1.1 BAC69870.1 Non-secretory protein CDS SAVERM_2160 2632999 2632064 putative phosphotransferase PF01636: Phosphotransferase enzyme family 6.32 32870 O miscellaneous 4.7 BAC69871.1 Non-secretory protein CDS SAVERM_2161 2634188 2633043 putative peptidase PF00557: metallopeptidase family M24 4.9 40515 O protein modification 3.8 BAC69872.1 Non-secretory protein CDS SAVERM_2162 2635048 2634707 hypothetical protein PF00595: PDZ domain (Also known as DHR or GLGF) 10.22 10970 O similar to unknown proteins 5 BAC69873.1 Non-secretory protein CDS SAVERM_2163 2637760 2635583 geoA germacradienol/geosmin synthase PF03936: Terpene synthase family, metal binding domain 4.84 81686 O antibiotic production 4.3 BAC69874.1 Non-secretory protein CDS SAVERM_2164 2637962 2638741 putative hydrolase PF00561: alpha/beta hydrolase fold 5.58 28008 O miscellaneous 4.7 BAC69875.1 Non-secretory protein CDS SAVERM_2165 2638738 2640003 putative cytochrome P450 CYP180A1 8.67 46309 O metabolism of coenzymes & prosthetic groups 2.5 BAC69876.1 Non-secretory protein CDS SAVERM_2166 2641226 2640012 hypothetical protein PF01937: Protein of unknown function DUF89 4.87 43731 O similar to unknown proteins 5 BAC69877.1 Non-secretory protein CDS SAVERM_2167 2641800 2641219 hypothetical protein 4.86 20424 O no similarity 6 BAC69878.1 Non-secretory protein CDS SAVERM_2168 2641968 2642903 cpbD1 putative chitin-binding protein, secreted PF03067: Chitin binding domain 10.88 31390 O miscellaneous 4.7 BAC69879.1 Signal peptide CDS SAVERM_2169 2644206 2643034 hypothetical protein 11.53 39379 O similar to unknown proteins 5 BAC69880.1 Non-secretory protein CDS SAVERM_2170 2644470 2645144 putative cholesterol esterase 4.81 22776 O specific pathways 2.1.1 BAC69881.1 Non-secretory protein CDS SAVERM_2171 2645144 2645563 hypothetical protein 12 15251 O similar to unknown proteins 5 BAC69882.1 Non-secretory protein CDS SAVERM_2172 2646671 2645871 putative hydroxylase SgaA homolog, PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 6.96 28818 O miscellaneous 4.7 BAC69883.1 Non-secretory protein CDS SAVERM_2173 2647331 2646843 hypothetical protein 8.22 17811 O similar to unknown proteins 5 BAC69884.1 Non-secretory protein CDS SAVERM_2174 2648019 2647309 hypothetical protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.58 24693 O similar to unknown proteins 5 BAC69885.1 Non-secretory protein CDS SAVERM_2175 2648187 2649062 putative DNA-binding protein PF01381: Helix-turn-helix 9.86 32812 O regulation 3.5.2 BAC69886.1 Non-secretory protein CDS SAVERM_2176 2649063 2649314 abaA1 putative AbaA-like protein regulatory protein, PF04149: Domain of unknown function (DUF397) 7.69 8828 O adaptation to atypical conditions 4.1 BAC69887.1 Non-secretory protein CDS SAVERM_2177 2649403 2650233 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.48 30188 O similar to unknown proteins 5 BAC69888.1 Non-secretory protein CDS SAVERM_2178 2651343 2650339 opuBC1 putative ABC transporter substrate-binding protein osmoprotectant transport system substrate-binding protin, PF04069: Substrate binding domain of ABC-type glycine betaine transport system 8.14 34624 O transport / binding proteins & lipoproteins 1.2 BAC69889.1 Non-secretory protein CDS SAVERM_2179 2651518 2654274 cvnA4 putative sensor-like histidine kinase multi-component regulatory system-4 4.88 98044 O sensors 1.3 BAC69890.1 Non-secretory protein CDS SAVERM_2180 2654271 2654747 cvnB4 hypothetical protein multi-component regulatory system-4, PF03259: Roadblock/LC7 domain 4.38 15768 O similar to unknown proteins 5 BAC69891.1 Non-secretory protein CDS SAVERM_2181 2654781 2655221 cvnC4 hypothetical protein multi-component regulatory system-4, PF05331: Protein of unknown function (DUF742) 5.77 15602 O similar to unknown proteins 5 BAC69892.1 Non-secretory protein CDS SAVERM_2182 2655208 2655783 cvnD4 putative ATP/GTP-binding protein multi-component regulatory system-4 4.39 20587 O miscellaneous 4.7 BAC69893.1 Non-secretory protein CDS SAVERM_2183 2656509 2655841 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 9.92 23405 O transport / binding proteins & lipoproteins 1.2 BAC69894.1 Non-secretory protein CDS SAVERM_2184 2657228 2656506 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 9.69 25550 O transport / binding proteins & lipoproteins 1.2 BAC69895.1 Non-secretory protein CDS SAVERM_2185 2658352 2657225 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.54 40495 O transport / binding proteins & lipoproteins 1.2 BAC69896.1 Non-secretory protein CDS SAVERM_2186 2660437 2658461 agaA2 putative alpha-galactosidase, secreted PF00652: QXW lectin repeat 6.25 68909 O specific pathways 2.1.1 BAC69897.1 Signal peptide CDS SAVERM_2187 2660768 2661793 putative ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.06 35162 O transport / binding proteins & lipoproteins 1.2 BAC69898.1 Signal peptide CDS SAVERM_2188 2662022 2664511 cvnA5 putative sensor-like histidine kinase multi-component regulatory system-5 5.12 89601 O sensors 1.3 BAC69899.1 Signal peptide CDS SAVERM_2189 2664523 2664954 cvnB5 hypothetical protein multi-component regulatory system-5, PF03259: Roadblock/LC7 domain 6.97 14878 O similar to unknown proteins 5 BAC69900.1 Non-secretory protein CDS SAVERM_2190 2664956 2665312 cvnC5 hypothetical protein multi-component regulatory system-5, PF05331: Protein of unknown function (DUF742) 8.83 12687 O similar to unknown proteins 5 BAC69901.1 Non-secretory protein CDS SAVERM_2191 2665299 2665883 cvnD5 putative ATP/GTP-binding protein multi-component regulatory system-5 4.31 20645 O miscellaneous 4.7 BAC69902.1 Non-secretory protein CDS SAVERM_2192 2666678 2665941 apbE1 putative thiamine biosynthesis lipoprotein precursor PF02424: ApbE family 4.81 25886 O metabolism of nucleotides & nucleic acids 2.3 BAC69903.1 Non-secretory protein CDS SAVERM_2193 2667099 2666680 putative secreted protein PF04205: FMN-binding domain 5.84 14148 O similar to unknown proteins 5 BAC69904.1 Signal peptide CDS SAVERM_2194 2668537 2667119 putative oxidoreductase PF01794: Ferric reductase like transmembrane component 10.5 51823 O miscellaneous 4.7 BAC69905.1 Non-secretory protein CDS SAVERM_2195 2668563 2669351 putative two-component system response regulator PF00072: Response regulator receiver domain 5.46 28970 O regulation 3.5.2 BAC69906.1 Non-secretory protein CDS SAVERM_2196 2669348 2670784 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.44 51702 O sensors 1.3 BAC69907.1 Non-secretory protein CDS SAVERM_2197 2672757 2670814 hypothetical protein PF00733: Asparagine synthase 9.53 70408 O similar to unknown proteins 5 BAC69908.1 Non-secretory protein CDS SAVERM_2198 2673259 2672633 hypothetical protein 10.34 22740 O no similarity 6 BAC69909.1 Non-secretory protein CDS SAVERM_2199 2677531 2673659 hypothetical protein PF00004: ATPase family associated with various cellular activities (AAA) 8.26 135742 O similar to unknown proteins 5 BAC69910.1 Non-secretory protein CDS SAVERM_2200 2677693 2677977 hypothetical protein 5.66 10174 O no similarity 6 BAC69911.1 Non-secretory protein CDS SAVERM_2201 2677988 2678917 hypothetical protein 10.78 33565 O no similarity 6 BAC69912.1 Non-secretory protein CDS SAVERM_2202 2679054 2682824 hypothetical protein PF07813: LTXXQ motif 4.66 134842 O similar to unknown proteins 5 BAC69913.1 Non-secretory protein CDS SAVERM_2203 2683170 2684009 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 5.76 29418 O miscellaneous 4.7 BAC69914.1 Non-secretory protein CDS SAVERM_2204 2684457 2684050 putative oxidoreductase PF01641: SelR domain 4.71 15110 O miscellaneous 4.7 BAC69915.1 Non-secretory protein CDS SAVERM_2205 2685865 2684471 murC putative UDP-N-acetylmuramoyl-L-alanine ligase PF01225: Mur ligase family, catalytic domain 4.76 48063 O cell wall 1.1 BAC69916.1 Non-secretory protein CDS SAVERM_2206 2686515 2686042 hypothetical protein 4.52 17068 O similar to unknown proteins 5 BAC69917.1 Non-secretory protein CDS SAVERM_2207 2687530 2688666 putative ATP/GTP-binding protein PF03969: AFG1-like ATPase 6.51 40246 O miscellaneous 4.7 BAC69919.1 Non-secretory protein CDS SAVERM_2208 2687531 2686713 putative hydrolase PF01872: RibD C-terminal domain 6.05 27949 O miscellaneous 4.7 BAC69918.1 Non-secretory protein CDS SAVERM_2209 2688824 2689216 putative secreted protein 8.82 13268 O similar to unknown proteins 5 BAC69920.1 Signal peptide CDS SAVERM_2210 2689365 2689946 cynT1 putative carbonic anhydrase PF00484: Carbonic anhydrase 6.5 20667 O specific pathways 2.1.1 BAC69921.1 Non-secretory protein CDS SAVERM_2211 2689943 2691433 putative transmembrane sulfate transport protein PF00916: Sulfate transporter family 10.61 50896 O transport / binding proteins & lipoproteins 1.2 BAC69922.1 Non-secretory protein CDS SAVERM_2212 2691565 2692521 putative membrane protease subunit, stomatin/prohibitin homolog PF01145: SPFH domain / Band 7 family 5.52 33635 O miscellaneous 4.7 BAC69923.1 Non-secretory protein CDS SAVERM_2213 2692611 2693993 putative secreted protein Tat substrate, PF05787: Bacterial protein of unknown function (DUF839) 6.32 49040 O similar to unknown proteins 5 BAC69924.1 Non-secretory protein CDS SAVERM_2214 2694231 2695100 putative polysaccharide deacetylase PF01522: Polysaccharide deacetylase 9.2 30528 O miscellaneous 4.7 BAC69925.1 Signal peptide CDS SAVERM_2215 2695154 2695333 hypothetical protein 4.13 6056 O similar to unknown proteins 5 BAC69926.1 Non-secretory protein CDS SAVERM_2216 2695406 2696179 hypothetical protein PF01981: Domain of unknown function UPF0099 4.72 27603 O similar to unknown proteins 5 BAC69927.1 Non-secretory protein CDS SAVERM_2217 2696357 2697145 putative secreted protein 5.68 27492 O miscellaneous 4.7 BAC69928.1 Non-secretory protein CDS SAVERM_2218 2697334 2698797 hypothetical protein PF05114: Protein of unknown function (DUF692) 5.94 51637 O similar to unknown proteins 5 BAC69929.1 Non-secretory protein CDS SAVERM_2219 2699175 2699942 putative secreted protein 7.94 27024 O miscellaneous 4.7 BAC69930.1 Non-secretory protein CDS SAVERM_2220 2700103 2700870 putative integral membrane protein 9.83 26810 O miscellaneous 4.7 BAC69931.1 Non-secretory protein CDS SAVERM_2221 2701815 2701084 hypothetical protein PF06778: Chlorite dismutase 5.43 28125 O similar to unknown proteins 5 BAC69932.1 Non-secretory protein CDS SAVERM_2222 2703286 2701820 hemY putative protoporphyrinogen oxidase PF01593: Flavin containing amine oxidoreductase 6.45 50532 O miscellaneous 4.7 BAC69933.1 Non-secretory protein CDS SAVERM_2224 2703486 2704460 putative lipoprotein 9.87 33707 O transport / binding proteins & lipoproteins 1.2 BAC69935.1 Signal peptide CDS SAVERM_2225 2704494 2705894 putative flavoprotein oxidoreductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 6.2 49028 O miscellaneous 4.7 BAC69936.1 Non-secretory protein CDS SAVERM_2226 2706365 2705952 hypothetical protein 8.81 14771 O no similarity 6 BAC69937.1 Non-secretory protein CDS SAVERM_2227 2706401 2707219 hypothetical protein PF01694: Rhomboid family 8.11 29242 O similar to unknown proteins 5 BAC69938.1 Non-secretory protein CDS SAVERM_2228 2708297 2707230 hemE putative uroporphyrinogen decarboxylase PF01208: Uroporphyrinogen decarboxylase (URO-D) 5.12 38383 O metabolism of coenzymes & prosthetic groups 2.5 BAC69939.1 Non-secretory protein CDS SAVERM_2229 2708486 2709157 hypothetical protein PF11452: Protein of unknown function (DUF3000) 4.44 23695 O similar to unknown proteins 5 BAC69940.1 Non-secretory protein CDS SAVERM_2230 2709485 2710147 putative two-component system response regulator PF00196: Bacterial regulatory proteins, luxR family 11.49 22827 O regulation 3.5.2 BAC69941.1 Non-secretory protein CDS SAVERM_2231 2710371 2711651 rnd putative ribonuclease D PF01612: 3'-5' exonuclease 5.23 45811 O RNA modification 3.6 BAC69942.1 Non-secretory protein CDS SAVERM_2232 2712053 2711655 hypothetical protein 11.4 14265 O similar to unknown proteins 5 BAC69943.1 Non-secretory protein CDS SAVERM_2233 2712145 2713371 fadA8 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF00108: Thiolase, N-terminal domain 5.8 43549 O metabolism of lipids 2.4 BAC69944.1 Non-secretory protein CDS SAVERM_2234 2713368 2715494 fadB2 putative fatty acid oxidation complex alpha-subunit similar to glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a: including enoyl-CoA hydratase; 3-2-trans-enoyl-CoA isomerase; 3-hydroxybutyryl-CoA epimerase; 3-hydroxyacyl-CoA dehydrogenase 4.91 75149 O metabolism of lipids 2.4 BAC69945.1 Non-secretory protein CDS SAVERM_2235 2720106 2715592 ggaB putative galactosamine-containing minor teichoic acid biosynthesis protein PF00535: Glycosyl transferase 6.77 169901 O cell wall 1.1 BAC69946.1 Non-secretory protein CDS SAVERM_2236 2721308 2720088 hypothetical protein PF01066: CDP-alcohol phosphatidyltransferase 9.23 45925 O similar to unknown proteins 5 BAC69947.1 Non-secretory protein CDS SAVERM_2237 2723190 2721613 hypothetical protein 6.75 55160 O similar to unknown proteins 5 BAC69948.1 Non-secretory protein CDS SAVERM_2238 2724472 2723231 putative secreted protein 8.34 43285 O similar to unknown proteins 5 BAC69949.1 Non-secretory protein CDS SAVERM_2239 2725416 2724430 galE7 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 5.23 34968 O specific pathways 2.1.1 BAC69950.1 Non-secretory protein CDS SAVERM_2240 2725600 2726709 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 9.87 39004 O regulation 3.5.2 BAC69951.1 Non-secretory protein CDS SAVERM_2241 2726824 2727189 hypothetical protein 4.98 12730 O similar to unknown proteins 5 BAC69952.1 Non-secretory protein CDS SAVERM_2242 2728743 2727250 hypothetical protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 9.23 52985 O similar to unknown proteins 5 BAC69953.1 Non-secretory protein CDS SAVERM_2243 2730330 2728807 putative cationic amino acid transporter PF00324: Amino acid permease 9.26 54006 O transport / binding proteins & lipoproteins 1.2 BAC69954.1 Non-secretory protein CDS SAVERM_2244 2732397 2730469 dxs2 putative 1-deoxy-D-xylulose 5-phosphate synthase MEP pathway, EC 4.1.3.37 5.82 68726 O specific pathways 2.1.1 BAC69955.1 Non-secretory protein CDS SAVERM_2245 2733906 2732614 xylH putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.21 44304 O transport / binding proteins & lipoproteins 1.2 BAC69956.1 Non-secretory protein CDS SAVERM_2246 2734691 2733903 xylG putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 6.81 28118 O transport / binding proteins & lipoproteins 1.2 BAC69957.1 Non-secretory protein CDS SAVERM_2247 2735983 2734874 xylF putative simple sugar ABC transporter substrate-binding protein (N-acetylglucosamine transport system substrate-binding protein) PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 9.38 38634 O transport / binding proteins & lipoproteins 1.2 BAC69958.1 Signal peptide CDS SAVERM_2248 2737304 2736105 putative ROK-family transcriptional regulator PF00480: ROK family 5.93 40620 O regulation 3.5.2 BAC69959.1 Non-secretory protein CDS SAVERM_2249 2738576 2737656 ngcG putative ABC transporter permease protein (N-acetylglucosamine transport system permease protein) PF00528: Binding-protein-dependent transport system inner membrane component 9.64 33977 O transport / binding proteins & lipoproteins 1.2 BAC69960.1 Non-secretory protein CDS SAVERM_2250 2739499 2738576 ngcF putative ABC transporter permease protein (N-acetylglucosamine transport system permease protein) PF00528: Binding-protein-dependent transport system inner membrane component 9.08 34041 O transport / binding proteins & lipoproteins 1.2 BAC69961.1 Non-secretory protein CDS SAVERM_2251 2741016 2739559 ngcE putative ABC transporter substrate-binding protein ( (N-acetylglucosamine transport system permease protein) Tat substrate, PF01547: Bacterial extracellular solute-binding protein 8.92 52438 O transport / binding proteins & lipoproteins 1.2 BAC69962.1 Non-secretory protein CDS SAVERM_2252 2741507 2745352 putative alpha-1,2-mannosidase, secreted PF07971: Glycosyl hydrolase family 92 6.34 137929 O miscellaneous 4.7 BAC69963.1 Signal peptide CDS SAVERM_2253 2748745 2745431 putative alpha-1,2-mannosidase, secreted PF07971: Glycosyl hydrolase family 92 5.79 115542 O similar to unknown proteins 5 BAC69964.1 Signal peptide CDS SAVERM_2254 2750248 2749073 celS2 putative cellulose-binding protein PF03067: Chitin binding domain 6.03 41938 O specific pathways 2.1.1 BAC69965.1 Non-secretory protein CDS SAVERM_2255 2750352 2750849 hypothetical protein 4.7 17265 O no similarity 6 BAC69966.1 Non-secretory protein CDS SAVERM_2256 2752438 2750900 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.16 53683 O sensors 1.3 BAC69967.1 Signal peptide CDS SAVERM_2257 2753160 2752435 putative two-component system response regulator PF00072: Response regulator receiver domain 9.04 26410 O regulation 3.5.2 BAC69968.1 Non-secretory protein CDS SAVERM_2258 2756010 2753293 acnA putative aconitase PF00330: Aconitase family (aconitate hydratase) 4.71 97690 O TCA cycle 2.1.3 BAC69969.1 Non-secretory protein CDS SAVERM_2259 2756601 2756798 hypothetical protein 12.87 7521 O no similarity 6 BAC69970.1 Non-secretory protein CDS SAVERM_2260 2757079 2758392 murA2 putative UDP-N-acetylglucosamine transferase PF00275: EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 5.12 48232 O cell wall 1.1 BAC69971.1 Non-secretory protein CDS SAVERM_2261 2759262 2758588 hypothetical protein 6.52 24763 O no similarity 6 BAC69972.1 Non-secretory protein CDS SAVERM_2262 2761302 2759311 pkn5 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 4.37 66754 O protein modification 3.8 BAC69973.1 Non-secretory protein CDS SAVERM_2263 2762247 2761657 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.25 21533 O regulation 3.5.2 BAC69974.1 Non-secretory protein CDS SAVERM_2264 2762407 2763975 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10.47 54396 O transport / binding proteins & lipoproteins 1.2 BAC69975.1 Non-secretory protein CDS SAVERM_2265 2764008 2764211 hypothetical protein 11.19 6928 O no similarity 6 BAC69976.1 Non-secretory protein CDS SAVERM_2266 2765037 2764348 avaC putative phosphatase PF00702: haloacid dehalogenase-like hydrolase 7.14 25617 O similar to unknown proteins 5 BAC69977.1 Non-secretory protein CDS SAVERM_2267 2766250 2765027 avaB putative oxidoreductase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.67 42991 O miscellaneous 4.7 BAC69978.1 Non-secretory protein CDS SAVERM_2268 2766319 2766939 avaL2 putative TetR-family transcriptional regulator similar to gamma-butyrolactone-dependent transcriptional regulator, PF00440: Bacterial regulatory proteins, tetR family 6.9 22350 O regulation 3.5.2 BAC69979.1 Non-secretory protein CDS SAVERM_2269 2768005 2766968 avaA putative gamma-butyrolactone biosynthesis protein homology to BarX, FarX, AfsA, and ScbA, PF03756: A-factor biosynthesis repeat 7.67 38292 O miscellaneous 4.7 BAC69980.1 Non-secretory protein CDS SAVERM_2270 2768197 2768853 avaL1 putative TetR-family transcriptional regulator similar to gamma-butyrolactone-dependent transcriptional regulator, PF00440: Bacterial regulatory proteins, tetR family 6.16 24004 M regulation 3.5.2 BAC69981.1 Non-secretory protein CDS SAVERM_2272 2770635 2769076 hypothetical protein VlmK homolog, PF03972: MmgE/PrpD family 8.84 59289 M miscellaneous 4.7 BAC69982.1 Non-secretory protein CDS SAVERM_2273 2771120 2770752 putative isomerase 4.27 12915 M miscellaneous 4.7 BAC69984.1 Non-secretory protein CDS SAVERM_2274 2772171 2771212 putative secreted protein VlmJ homolog, PF00781: Diacylglycerol kinase catalytic domain (presumed) 6.68 33418 M similar to unknown proteins 5 BAC69985.1 Non-secretory protein CDS SAVERM_2275 2773797 2772328 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.96 49840 M transport / binding proteins & lipoproteins 1.2 BAC69986.1 Non-secretory protein CDS SAVERM_2276 2774897 2773878 fabH7 putative 3-oxoacyl-ACP synthase III pks3 gene cluster, PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 4.5 36249 M metabolism of lipids 2.4 BAC69987.1 Non-secretory protein CDS SAVERM_2277 2775995 2775228 putative thioesterase pks3 gene cluster, PF00975: Thioesterase domain 4.76 28172 M antibiotic production 4.3 BAC69988.1 Non-secretory protein CDS SAVERM_2278 2777119 2776016 putative F420-dependent dehydrogenase pks3 gene cluster, PF00296: Luciferase-like monooxygenase 6.07 38960 M membrane bioenergetics 1.4 BAC69989.1 Non-secretory protein CDS SAVERM_2279 2778762 2777158 putative acyl-CoA synthetase pks3 gene cluster, PF00501: AMP-binding enzyme 6.17 57602 M metabolism of lipids 2.4 BAC69990.1 Non-secretory protein CDS SAVERM_2280 2780709 2778808 pks3-1 putative modular polyketide synthase pks3 gene cluster, containing KR and ACP domains 4.72 66960 M antibiotic production 4.3 BAC69991.1 Non-secretory protein CDS SAVERM_2281 2784467 2780706 pks3-2 putative modular polyketide synthase pks3 gene cluster, containing KS and AT domains 7 131787 M antibiotic production 4.3 BAC69992.1 Non-secretory protein CDS SAVERM_2282 2784841 2784503 pks3-3 putative acyl carrier protein pks3 gene cluster, PF00550: Phosphopantetheine attachment site 3.93 12411 M metabolism of lipids 2.4 BAC69993.1 Non-secretory protein CDS SAVERM_2283 2785013 2786644 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.1 59785 M specific pathways 2.1.1 BAC69994.1 Non-secretory protein CDS SAVERM_2284 2786679 2787818 putative isobutylamine N-hydroxylase VlmH homolog 5.24 39862 M antibiotic production 4.3 BAC69995.1 Non-secretory protein CDS SAVERM_2285 2787876 2789159 rocD3 putative ornithine aminotransferase PF00202: Aminotransferase class-III 5.19 45630 M metabolism of amino acids & related molecules 2.2 BAC69996.1 Non-secretory protein CDS SAVERM_2286 2789162 2789644 putative cyclase/dehydrase PF03364: Polyketide cyclase / dehydrase and lipid transport 4.17 17892 M similar to unknown proteins 5 BAC69997.1 Non-secretory protein CDS SAVERM_2287 2789666 2790202 hypothetical protein VlmO homolog 9.32 20007 M similar to unknown proteins 5 BAC69998.1 Non-secretory protein CDS SAVERM_2288 2790199 2790753 putative NADPH-flavin oxidoreductase VlmR homolog, PF01613: Flavin reductase like domain 9.14 19391 M membrane bioenergetics 1.4 BAC69999.1 Non-secretory protein CDS SAVERM_2289 2790750 2791733 hypothetical protein VlmB homolog 4.47 36405 M similar to unknown proteins 5 BAC70000.1 Non-secretory protein CDS SAVERM_2290 2791730 2792737 fabH3 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 4.7 34345 M metabolism of lipids 2.4 BAC70001.1 Non-secretory protein CDS SAVERM_2291 2792843 2793073 fabC3 putative acyl carrier protein PF00550: Phosphopantetheine attachment site 3.87 8497 M metabolism of lipids 2.4 BAC70002.1 Non-secretory protein CDS SAVERM_2292 2793073 2794293 fabF putative 3-oxoacyl-ACP synthase II PF00109: Beta-ketoacyl synthase, N-terminal domain 4.6 41314 M metabolism of lipids 2.4 BAC70003.1 Non-secretory protein CDS SAVERM_2293 2794444 2795964 putative amino acid permease VlmC homolog, PF00324: Amino acid permease 10.25 52188 M transport / binding proteins & lipoproteins 1.2 BAC70004.1 Non-secretory protein CDS SAVERM_2294 2795948 2797231 serS2 putative seryl-tRNA synthetase VlmL homolog, PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 6.04 46737 M aminoacyl-tRNA-synthetase 3.7.2 BAC70005.1 Non-secretory protein CDS SAVERM_2295 2798093 2797311 fabI2 putative enoyl-ACP reductase PF00106: short chain dehydrogenase 5.3 27594 M metabolism of lipids 2.4 BAC70006.1 Non-secretory protein CDS SAVERM_2296 2798416 2798090 fdxC putative ferredoxin PF00037: 4Fe-4S binding domain 3.87 11583 M membrane bioenergetics 1.4 BAC70007.1 Non-secretory protein CDS SAVERM_2297 2799828 2798419 putative sugar transporter PF07690: Major Facilitator Superfamily 10.19 49278 M transport / binding proteins & lipoproteins 1.2 BAC70008.1 Non-secretory protein CDS SAVERM_2298 2801158 2800061 fadS2 putative fatty acid desaturase PF00487: Fatty acid desaturase 9.9 41207 M metabolism of lipids 2.4 BAC70009.1 Non-secretory protein CDS SAVERM_2299 2801644 2801444 hypothetical protein 3.69 6824 M no similarity 6 BAC70010.1 Non-secretory protein CDS SAVERM_2300 2802733 2801738 hypothetical protein VlmA homolog, PF04329: Family of unknown function (DUF470) 6.18 36271 M similar to unknown proteins 5 BAC70011.1 Non-secretory protein CDS SAVERM_2301 2803964 2804761 putative regulatory protein VlmI homolog, PF03704: Bacterial transcriptional activator domain 6.04 29350 M regulation 3.5.2 BAC70012.1 Non-secretory protein CDS SAVERM_2302 2805029 2805460 putative membrane protein 10.6 14570 M miscellaneous 4.7 BAC70013.1 Non-secretory protein CDS SAVERM_2303 2805537 2807081 mmdA1 putative methylmalonyl-CoA decarboxylase alpha subunit PF01039: Carboxyl transferase domain 5.25 55470 M specific pathways 2.1.1 BAC70014.1 Non-secretory protein CDS SAVERM_2304 2807097 2807282 hypothetical protein 5.56 6606 M no similarity 6 BAC70015.1 Non-secretory protein CDS SAVERM_2305 2808242 2807844 hypothetical protein PF01042: Endoribonuclease L-PSP 4.84 14043 M similar to unknown proteins 5 BAC70016.1 Non-secretory protein CDS SAVERM_2306 2809366 2808239 fadE10 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.19 39764 M metabolism of lipids 2.4 BAC70017.1 Non-secretory protein CDS SAVERM_2307 2809477 2811261 putative acyl-CoA synthetase PF00501: AMP-binding enzyme 5.96 64270 M metabolism of lipids 2.4 BAC70018.1 Non-secretory protein CDS SAVERM_2308 2811277 2812119 putative regulatory protein PF07848: PaaX-like protein 6.43 30967 M regulation 3.5.2 BAC70019.1 Non-secretory protein CDS SAVERM_2309 2812203 2813102 putative secreted protein PF00685: Sulfotransferase domain 10.06 33949 M similar to unknown proteins 5 BAC70020.1 Signal peptide CDS SAVERM_2310 2813099 2813509 hypothetical protein 8.22 15425 M no similarity 6 BAC70021.1 Non-secretory protein CDS SAVERM_2311 2813587 2814753 tagE putative UDP-glucose:polyglycerol phosphate glucosyltransferase PF00534: Glycosyl transferases group 1 8.45 43370 M cell wall 1.1 BAC70022.1 Non-secretory protein CDS SAVERM_2312 2814750 2815301 cysC2 putative adenylylsulfate kinase PF01583: Adenylylsulphate kinase 9.05 19404 M metabolism of amino acids & related molecules 2.2 BAC70023.1 Non-secretory protein CDS SAVERM_2313 2815298 2816233 cysD2 putative sulfate adenylyltransferase subunit 2 PF01507: Phosphoadenosine phosphosulfate reductase family 6.06 35382 M metabolism of sulfur 2.7 BAC70024.1 Non-secretory protein CDS SAVERM_2314 2816236 2817456 cysN2 putative sulfate adenylyltransferase large subunit PF00009: Elongation factor Tu GTP binding domain 5.97 43423 M metabolism of sulfur 2.7 BAC70025.1 Non-secretory protein CDS SAVERM_2315 2819747 2817480 putative NADH-dependent flavin oxidoreductase PF00724: NADH:flavin oxidoreductase / NADH oxidase family 6.51 82711 M miscellaneous 4.7 BAC70026.1 Non-secretory protein CDS SAVERM_2316 2820577 2819750 echA7 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.17 28951 M metabolism of lipids 2.4 BAC70027.1 Non-secretory protein CDS SAVERM_2317 2820828 2821328 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.39 17702 M regulation 3.5.2 BAC70028.1 Non-secretory protein CDS SAVERM_2318 2822730 2821288 putative amino acid permease PF00324: Amino acid permease 7.89 49145 M transport / binding proteins & lipoproteins 1.2 BAC70029.1 Non-secretory protein CDS SAVERM_2319 2823934 2822927 argF putative ornithine carbamoyltransferase PF00185: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 4.87 36610 M metabolism of amino acids & related molecules 2.2 BAC70030.1 Non-secretory protein CDS SAVERM_2320 2825273 2824044 arcA putative arginine deiminase PF02274: Amidinotransferase 5.78 45385 M metabolism of amino acids & related molecules 2.2 BAC70031.1 Non-secretory protein CDS SAVERM_2321 2825412 2826434 hypothetical protein PF01145: SPFH domain / Band 7 family 6.2 36704 M similar to unknown proteins 5 BAC70032.1 Non-secretory protein CDS SAVERM_2322 2826431 2827324 hypothetical protein PF03459: TOBE domain 5.98 31874 M similar to unknown proteins 5 BAC70033.1 Non-secretory protein CDS SAVERM_2323 2830279 2827733 prpA1 putative serine/threonine protein phosphatase PF00149: Calcineurin-like phosphoesterase 6.55 93244 M protein modification 3.8 BAC70034.1 Non-secretory protein CDS SAVERM_2324 2831763 2830276 putative methyltransferase PF08242: Methyltransferase domain 6.08 54279 M similar to unknown proteins 5 BAC70035.1 Non-secretory protein CDS SAVERM_2325 2831927 2832853 putative monooxygenase PF00296: Luciferase-like monooxygenase 4.66 33803 M miscellaneous 4.7 BAC70036.1 Non-secretory protein CDS SAVERM_2326 2833392 2832931 hypothetical protein 4.16 16027 M similar to unknown proteins 5 BAC70037.1 Non-secretory protein CDS SAVERM_2327 2833916 2833584 hypothetical protein PF03819: MazG nucleotide pyrophosphohydrolase domain 4.24 12458 M similar to unknown proteins 5 BAC70038.1 Non-secretory protein CDS SAVERM_2328 2835130 2833913 putative bldA-regulated nucleotide binding protein PF00005: ABC transporter 8.51 42170 M miscellaneous 4.7 BAC70039.1 Non-secretory protein CDS SAVERM_2329 2835636 2835232 hypothetical protein PF04472: Protein of unknown function (DUF552) 5.66 14541 M similar to unknown proteins 5 BAC70040.1 Non-secretory protein CDS SAVERM_2330 2835881 2839939 narB putative assimilatory nitrate reductase large subunit PF00384: Molybdopterin oxidoreductase 5.46 145945 M metabolism of amino acids & related molecules 2.2 BAC70041.1 Non-secretory protein CDS SAVERM_2331 2840065 2841777 putative membrane protein PF00137: ATP synthase subunit C 11.08 60723 M miscellaneous 4.7 BAC70042.1 Non-secretory protein CDS SAVERM_2332 2842133 2841786 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 8.55 12331 M regulation 3.5.2 BAC70043.1 Non-secretory protein CDS SAVERM_2333 2842425 2843558 nicT2 putative high-affinity nickel-transport protein PF03824: High-affinity nickel-transport protein 7.85 40860 M transport / binding proteins & lipoproteins 1.2 BAC70044.1 Non-secretory protein CDS SAVERM_2334 2844349 2843585 putative secreted protein PF07987: Domain of unkown function (DUF1775) 4.95 26151 M similar to unknown proteins 5 BAC70045.1 Signal peptide CDS SAVERM_2335 2845000 2844389 putative secreted protein 12.21 21080 M similar to unknown proteins 5 BAC70046.1 Signal peptide CDS SAVERM_2336 2850074 2845071 savR3 putative type II restriction enzyme PF09126: Restriction endonuclease NaeI 6.34 180061 M regulation 3.5.2 BAC70047.1 Non-secretory protein CDS SAVERM_2337 2851015 2850071 putative MoxR-like ATPase PF07728: ATPase family associated with various cellular activities (AAA) 5.65 34349 M miscellaneous 4.7 BAC70048.1 Non-secretory protein CDS SAVERM_2338 2853117 2851012 hypothetical protein PF00656: Caspase domain 4.85 75896 M no similarity 6 BAC70049.1 Non-secretory protein CDS SAVERM_2339 2854208 2853138 hypothetical protein PF07336: Protein of unknown function (DUF1470) 10.45 37559 M similar to unknown proteins 5 BAC70050.1 Non-secretory protein CDS SAVERM_2340 2854441 2854833 putative substrate-binding protein PF03459: TOBE domain 6.26 13854 M miscellaneous 4.7 BAC70051.1 Non-secretory protein CDS SAVERM_2341 2855062 2855481 putative molibdenum binding protein PF03459: TOBE domain 4.34 13741 M miscellaneous 4.7 BAC70052.1 Non-secretory protein CDS SAVERM_2342 2855649 2856317 putative membrane protein PF00597: DedA family 10.98 22858 M miscellaneous 4.7 BAC70053.1 Non-secretory protein CDS SAVERM_2343 2857687 2856344 putative membrane protein PF03706: Uncharacterised protein family (UPF0104) 8.13 43437 M miscellaneous 4.7 BAC70054.1 Non-secretory protein CDS SAVERM_2344 2859243 2857684 putative membrane protein PF03901: Alg9-like mannosyltransferase family 11.24 54398 M miscellaneous 4.7 BAC70055.1 Non-secretory protein CDS SAVERM_2345 2860309 2859641 putative dehydrogenase PF00106: short chain dehydrogenase 6.08 23145 M miscellaneous 4.7 BAC70056.1 Non-secretory protein CDS SAVERM_2346 2860718 2861371 putative secreted protein cell wall surface anchor family protein 10.8 21886 M similar to unknown proteins 5 BAC70057.1 Signal peptide CDS SAVERM_2347 2861708 2861430 gvpK3 putative gas vesicle synthesis protein PF05121: Gas vesicle protein K 4.2 10414 M gas vesicle 4.7.1 BAC70058.1 Non-secretory protein CDS SAVERM_2348 2861932 2861705 gvpS3 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 4.09 7802 M gas vesicle 4.7.1 BAC70059.1 Non-secretory protein CDS SAVERM_2349 2862751 2861936 gvpL3 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 8.01 29630 M gas vesicle 4.7.1 BAC70060.1 Non-secretory protein CDS SAVERM_2350 2863107 2862748 gvpJ3 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 4.45 13050 M gas vesicle 4.7.1 BAC70061.1 Non-secretory protein CDS SAVERM_2351 2864230 2863100 putative cyclase/dehydrase PF03364: Polyketide cyclase / dehydrase and lipid transport 4.05 41553 M similar to unknown proteins 5 BAC70062.1 Non-secretory protein CDS SAVERM_2352 2865367 2864237 hypothetical protein PF07382: Histone H1-like nucleoprotein HC2 4.73 40796 M similar to unknown proteins 5 BAC70063.1 Non-secretory protein CDS SAVERM_2353 2865628 2865374 gvpG3 putative gas vesicle synthesis protein PF05120: Gas vesicle protein G 4.44 9443 M gas vesicle 4.7.1 BAC70064.1 Non-secretory protein CDS SAVERM_2354 2866379 2865630 gvpF3 putative gas vesicle synthesis protein PF06386: Gas vesicle synthesis protein GvpL/GvpF 10.17 26858 M gas vesicle 4.7.1 BAC70065.1 Non-secretory protein CDS SAVERM_2355 2866853 2866383 gvpA3 putative gas vesicle synthesis protein PF00741: Gas vesicle protein 4.84 17138 M gas vesicle 4.7.1 BAC70066.1 Non-secretory protein CDS SAVERM_2356 2867207 2866887 gvpO3 putative gas vesicle synthesis protein PF05800: Gas vesicle synthesis protein GvpO 8.49 11656 M gas vesicle 4.7.1 BAC70067.1 Non-secretory protein CDS SAVERM_2357 2867744 2867520 putative membrane protein 11.88 8069 M miscellaneous 4.7 BAC70068.1 Non-secretory protein CDS SAVERM_2358 2868622 2867801 putative dehydrogenase PF00106: short chain dehydrogenase 5.7 28583 M miscellaneous 4.7 BAC70069.1 Non-secretory protein CDS SAVERM_2359 2868840 2869376 hypothetical protein 7.64 18498 M similar to unknown proteins 5 BAC70070.1 Non-secretory protein CDS SAVERM_2360 2869373 2870353 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.12 36191 M miscellaneous 4.7 BAC70071.1 Non-secretory protein CDS SAVERM_2361 2870350 2871699 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.31 48320 M transport / binding proteins & lipoproteins 1.2 BAC70072.1 Signal peptide CDS SAVERM_2362 2871696 2872658 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 7.41 34176 M transport / binding proteins & lipoproteins 1.2 BAC70073.1 Non-secretory protein CDS SAVERM_2363 2872697 2873524 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 8.85 30114 M transport / binding proteins & lipoproteins 1.2 BAC70074.1 Non-secretory protein CDS SAVERM_2364 2875672 2873756 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.19 68902 M transport / binding proteins & lipoproteins 1.2 BAC70075.1 Non-secretory protein CDS SAVERM_2365 2877462 2875669 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.62 65609 M transport / binding proteins & lipoproteins 1.2 BAC70076.1 Non-secretory protein CDS SAVERM_2366 2877941 2878606 putative hydroxylase pks5 gene cluster 6.09 24212 M miscellaneous 4.7 BAC70077.1 Non-secretory protein CDS SAVERM_2367 2880001 2878682 putative dehydrogenase pks5 gene cluster, PF07055: Short-chain alcohol dehydrogenase 7.54 47326 M miscellaneous 4.7 BAC70078.1 Non-secretory protein CDS SAVERM_2368 2893364 2879868 pks5 putative modular polyketide synthase pks5 gene cluster, three modules 5.01 468423 M antibiotic production 4.3 BAC70079.1 Non-secretory protein CDS SAVERM_2369 2893601 2894413 putative regulatory protein pks5 gene cluster, PF03704: Bacterial transcriptional activator domain 7.25 29813 M regulation 3.5.2 BAC70080.1 Non-secretory protein CDS SAVERM_2370 2895315 2894488 putative dehydrogenase Tat substrate, PF00106: short chain dehydrogenase 10.56 29562 M miscellaneous 4.7 BAC70081.1 Signal peptide CDS SAVERM_2371 2895968 2895312 putative two-component system response regulator PF00072: Response regulator receiver domain 7.92 23449 M regulation 3.5.2 BAC70082.1 Non-secretory protein CDS SAVERM_2372 2897352 2896543 putative methyltransferase PF01739: CheR methyltransferase, SAM binding domain 5.85 29896 M miscellaneous 4.7 BAC70083.1 Non-secretory protein CDS SAVERM_2373 2897655 2897395 pks9-1 putative acyl carrier protein pks9 gene cluster, similar to actIORF3, PF00550: Phosphopantetheine attachment site 3.62 9268 M metabolism of lipids 2.4 BAC70084.1 Non-secretory protein CDS SAVERM_2374 2897904 2898908 pks9-2 putative 3-oxoacyl-ACP synthase III pks9 gene cluster, PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 5.04 35495 M metabolism of lipids 2.4 BAC70085.1 Non-secretory protein CDS SAVERM_2375 2900258 2899008 pks9-3 putative 3-oxoacyl-ACP synthase II (probably chain length factor) pks9 gene cluster, similar to actIORF2, PF00109: Beta-ketoacyl synthase, N-terminal domain 4.55 43636 M metabolism of lipids 2.4 BAC70086.1 Non-secretory protein CDS SAVERM_2376 2901483 2900251 pks9-4 putative 3-oxoacyl-ACP synthase I pks9 gene cluster, similar to actIORF1, PF00109: Beta-ketoacyl synthase, N-terminal domain 4.89 43215 M metabolism of lipids 2.4 BAC70087.1 Non-secretory protein CDS SAVERM_2377 2902815 2901616 cyp10 putative cytochrome P450 CYP107Y1, pks9 gene cluster 5.36 44538 M metabolism of coenzymes & prosthetic groups 2.5 BAC70088.1 Non-secretory protein CDS SAVERM_2378 2904644 2903139 putative polyketide oxidase/hydroxylase pks9 gene cluster, PF01360: Monooxygenase 5.34 53936 M antibiotic production 4.3 BAC70089.1 Non-secretory protein CDS SAVERM_2379 2905497 2904712 putative ABC transporter permease protein pks9 gene cluster, PF01061: ABC-2 type transporter 11.55 27849 M transport / binding proteins & lipoproteins 1.2 BAC70090.1 Non-secretory protein CDS SAVERM_2380 2906435 2905494 putative ABC transporter ATP-binding protein pks9 gene cluster, PF00005: ABC transporter 7.58 33091 M transport / binding proteins & lipoproteins 1.2 BAC70091.1 Non-secretory protein CDS SAVERM_2381 2906589 2907374 putative TetR-family transcriptional regulator pks9 gene cluster, PF02909: Tetracyclin repressor, C-terminal all-alpha domain 9.08 28473 M regulation 3.5.2 BAC70092.1 Non-secretory protein CDS SAVERM_2382 2908420 2907341 putative O-methyltransferase pks9 gene cluster, PF00891: O-methyltransferase 5.19 37545 M miscellaneous 4.7 BAC70093.1 Non-secretory protein CDS SAVERM_2383 2909455 2908487 pks9-5 putative aromatase pks9 gene cluster, similar to actVII, PF10604: Polyketide cyclase / dehydrase and lipid transport 6.32 36154 M antibiotic production 4.3 BAC70094.1 Non-secretory protein CDS SAVERM_2384 2909637 2910314 pks9-6 putative cyclase pks9 gene cluster, PF04673: Polyketide synthesis cyclase 4.2 25873 M antibiotic production 4.3 BAC70095.1 Non-secretory protein CDS SAVERM_2385 2910356 2911516 cyp11 putative cytochrome P450 CYP181A1, pks9 gene cluster 5.47 43694 M metabolism of coenzymes & prosthetic groups 2.5 BAC70096.1 Non-secretory protein CDS SAVERM_2386 2911652 2912356 putative ClpX homolog pks9 gene cluster, PF02861: Clp amino terminal domain 4.92 24300 M protein modification 3.8 BAC70097.1 Non-secretory protein CDS SAVERM_2387 2912795 2913535 pks9-7 putative 3-oxoacyl-ACP reductase pks9 gene cluster, PF00106: short chain dehydrogenase 9.2 25736 M metabolism of lipids 2.4 BAC70098.1 Non-secretory protein CDS SAVERM_2388 2914052 2914291 putative phosphopantetheinyl transferase probably pseudogene 9.41 8699 M metabolism of lipids 2.4 BAC70099.1 Non-secretory protein CDS SAVERM_2389 2915874 2914573 putative RNA methyltransferase PF05958: tRNA (Uracil-5-)-methyltransferase 6.33 46762 M RNA modification 3.6 BAC70100.1 Non-secretory protein CDS SAVERM_2390 2918045 2915994 putative amino acid permease PF00324: Amino acid permease 10.1 73972 M transport / binding proteins & lipoproteins 1.2 BAC70101.1 Non-secretory protein CDS SAVERM_2391 2918457 2919128 trkA putative potassium transporter PF02254: TrkA-N domain 5.13 24089 M transport / binding proteins & lipoproteins 1.2 BAC70102.1 Non-secretory protein CDS SAVERM_2392 2919128 2919805 trkB putative potassium transporter PF02254: TrkA-N domain 4.13 24129 M transport / binding proteins & lipoproteins 1.2 BAC70103.1 Non-secretory protein CDS SAVERM_2393 2920715 2919948 putative membrane protein PF00950: ABC 3 transport family 8.98 28009 M miscellaneous 4.7 BAC70104.1 Non-secretory protein CDS SAVERM_2394 2921237 2920719 hypothetical protein PF01336: OB-fold nucleic acid binding domain 9.1 18904 M similar to unknown proteins 5 BAC70105.1 Non-secretory protein CDS SAVERM_2395 2921955 2921239 kdpE putative two-component system response regulator for high-affinity potassium transport system PF00072: Response regulator receiver domain 5.92 26434 M regulation 3.5.2 BAC70106.1 Non-secretory protein CDS SAVERM_2396 2924504 2921949 kdpD putative two-component system sensor kinase for high-affinity potassium transport system PF02702: Osmosensitive K+ channel His kinase sensor domain 5.58 91083 M sensors 1.3 BAC70107.1 Non-secretory protein CDS SAVERM_2397 2925842 2924628 putative secreted protein 8.75 43987 M miscellaneous 4.7 BAC70108.1 Signal peptide CDS SAVERM_2398 2926780 2926016 hypothetical protein PF12502: Protein of unknown function (DUF3710) 4.17 27149 M similar to unknown proteins 5 BAC70109.1 Non-secretory protein CDS SAVERM_2399 2927309 2926782 dut putative deoxyuridine 5’-triphosphate pyrophosphatase PF00692: dUTPase 6.27 18557 M metabolism of nucleotides & nucleic acids 2.3 BAC70110.1 Non-secretory protein CDS SAVERM_2400 2927890 2927306 hypothetical protein PF03061: Thioesterase superfamily 6.08 20315 M similar to unknown proteins 5 BAC70111.1 Non-secretory protein CDS SAVERM_2401 2927949 2928410 putative secreted protein 6.73 16618 M miscellaneous 4.7 BAC70112.1 Non-secretory protein CDS SAVERM_2402 2929472 2928537 hypothetical protein 10.61 33248 M similar to unknown proteins 5 BAC70113.1 Non-secretory protein CDS SAVERM_2403 2929782 2929486 hypothetical protein 4.15 11033 M similar to unknown proteins 5 BAC70114.1 Non-secretory protein CDS SAVERM_2404 2931426 2930179 cutS putative two-component system sensor kinase transfer copper to melC, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.42 44916 M sensors 1.3 BAC70115.1 Non-secretory protein CDS SAVERM_2405 2932086 2931433 cutR putative two-component system response regulator PF00072: Response regulator receiver domain 4.63 23884 M regulation 3.5.2 BAC70116.1 Non-secretory protein CDS SAVERM_2406 2933600 2932782 suhB1 putative myo-inositol 1-monophosphatase spectinomycin resistance or Li+ sensitivity. extragenic suppressor protein homolog, PF00459: Inositol monophosphatase family 4.31 28768 M regulation 3.5.2 BAC70117.1 Non-secretory protein CDS SAVERM_2407 2934736 2933609 hemH putative ferrochelatase heme biosynthesis 5.14 40493 M metabolism of coenzymes & prosthetic groups 2.5 BAC70118.1 Non-secretory protein CDS SAVERM_2408 2934898 2936136 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 8.97 42905 M miscellaneous 4.7 BAC70119.1 Non-secretory protein CDS SAVERM_2409 2936096 2937415 putative FAD-dependent oxidoreductase PF01565: FAD binding domain 7.28 47911 M miscellaneous 4.7 BAC70120.1 Non-secretory protein CDS SAVERM_2410 2938130 2937339 hypothetical protein 9.2 26432 M similar to unknown proteins 5 BAC70121.1 Non-secretory protein CDS SAVERM_2411 2938603 2939649 putative DNA-binding protein PF05524: PEP-utilising enzyme, N-terminal 4.79 38369 M regulation 3.5.2 BAC70122.1 Non-secretory protein CDS SAVERM_2412 2940583 2939732 sseB putative thiosulfate sulfurtransferase PF00581: Rhodanese-like domain 4.56 28754 M metabolism of sulfur 2.7 BAC70123.1 Non-secretory protein CDS SAVERM_2413 2940907 2941710 putative hydroxylase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.49 28240 M miscellaneous 4.7 BAC70124.1 Non-secretory protein CDS SAVERM_2414 2942433 2941783 tdk putative thymidine kinase PF00265: Thymidine kinase 4.94 23481 M metabolism of nucleotides & nucleic acids 2.3 BAC70125.1 Non-secretory protein CDS SAVERM_2415 2943682 2942495 putative phosphodiesterase PF01663: Type I phosphodiesterase / nucleotide pyrophosphatase 4.39 42803 M metabolism of phosphates 2.6 BAC70126.1 Non-secretory protein CDS SAVERM_2416 2944269 2943682 hypothetical protein 4.63 20622 M similar to unknown proteins 5 BAC70127.1 Non-secretory protein CDS SAVERM_2417 2947171 2944322 acdA2 putative acyl-CoA synthetase (NDP forming type) PF02629: CoA binding domain 6.2 100557 M/Q metabolism of lipids 2.4 BAC70128.1 Non-secretory protein CDS SAVERM_2418 2947307 2947588 ptsH putative phosphocarrier protein PF00381: PTS HPr component phosphorylation site 4.26 9363 Q transport / binding proteins & lipoproteins 1.2 BAC70129.1 Non-secretory protein CDS SAVERM_2419 2948564 2947869 putative GntR-family transcriptional regulator PF07729: FCD domain 10.47 25456 Q regulation 3.5.2 BAC70130.1 Non-secretory protein CDS SAVERM_2420 2949537 2948761 putative zoocin A (secreted peptidase) PF01551: Peptidase family M23 9.53 26277 Q protein modification 3.8 BAC70131.1 Signal peptide CDS SAVERM_2421 2951301 2949913 putative protease PF05193: Peptidase M16 inactive domain 4.53 49041 Q protein modification 3.8 BAC70132.1 Non-secretory protein CDS SAVERM_2422 2952662 2951298 putative protease PF05193: Peptidase M16 inactive domain 4.45 49655 Q protein modification 3.8 BAC70133.1 Non-secretory protein CDS SAVERM_2423 2952967 2955423 parC putative subunit of topoisomerase IV PF00521: DNA gyrase/topoisomerase IV, subunit A 5.17 88499 Q DNA packaging & segregation 3.4 BAC70134.1 Non-secretory protein CDS SAVERM_2424 2956521 2955436 cobW putative cobalamin synthesis protein cobalamin biosynthesis, PF02492: CobW/HypB/UreG, nucleotide-binding domain 4.77 39377 Q metabolism of coenzymes & prosthetic groups 2.5 BAC70135.1 Non-secretory protein CDS SAVERM_2425 2956894 2957415 putative secreted protein 6.15 19765 Q miscellaneous 4.7 BAC70136.1 Non-secretory protein CDS SAVERM_2426 2957588 2957917 hypothetical protein 6.74 11755 Q similar to unknown proteins 5 BAC70137.1 Non-secretory protein CDS SAVERM_2427 2959155 2957989 citA3 putative citrate synthase PF00285: Citrate synthase 5.89 41720 Q TCA cycle 2.1.3 BAC70138.1 Non-secretory protein CDS SAVERM_2428 2959252 2960508 putative citrate synthase-like protein PF00285: Citrate synthase 8.82 44466 Q TCA cycle 2.1.3 BAC70139.1 Non-secretory protein CDS SAVERM_2429 2960607 2961554 hypothetical protein PF06091: Bacterial protein of unknown function (DUF942), putative IdeR-binding site: TCAGGTTAGGCTCACCTCT(2960588:2960606) 6.9 33291 Q similar to unknown proteins 5 BAC70140.1 Non-secretory protein CDS SAVERM_2430 2961753 2963480 dcuS putative two-component system sensor kinase Tat substrate, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.33 61484 Q sensors 1.3 BAC70141.1 Non-secretory protein CDS SAVERM_2431 2963477 2964166 putative two-component system response regulator PF00072: Response regulator receiver domain 7.98 25115 Q regulation 3.5.2 BAC70142.1 Non-secretory protein CDS SAVERM_2432 2965256 2964195 ssuA4 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding protein, PF09084: NMT1/THI5 like 8.36 37284 Q transport / binding proteins & lipoproteins 1.2 BAC70143.1 Signal peptide CDS SAVERM_2433 2966280 2965387 ssuC4 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 11.14 31919 Q transport / binding proteins & lipoproteins 1.2 BAC70144.1 Non-secretory protein CDS SAVERM_2434 2967103 2966252 ssuB4 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein, PF00005: ABC transporter 6.06 30910 Q transport / binding proteins & lipoproteins 1.2 BAC70145.1 Non-secretory protein CDS SAVERM_2435 2967230 2967922 dcuR putative two-component system response regulator PF00072: Response regulator receiver domain 8.49 25139 Q regulation 3.5.2 BAC70146.1 Non-secretory protein CDS SAVERM_2436 2969552 2967960 putative sodium:solute symporter PF00474: Sodium:solute symporter family 9.8 54983 Q transport / binding proteins & lipoproteins 1.2 BAC70147.1 Non-secretory protein CDS SAVERM_2437 2970079 2969549 hypothetical protein PF04341: Protein of unknown function, DUF485 8.86 19275 Q similar to unknown proteins 5 BAC70148.1 Non-secretory protein CDS SAVERM_2438 2970825 2970142 putative two-component system response regulator PF00072: Response regulator receiver domain 5.41 24371 Q regulation 3.5.2 BAC70149.1 Non-secretory protein CDS SAVERM_2439 2971976 2970822 putative two-component system sensor kinase PF07730: Histidine kinase 9.56 40801 Q sensors 1.3 BAC70150.1 Non-secretory protein CDS SAVERM_2440 2972521 2971973 putative integral membrane protein 11.81 19510 Q miscellaneous 4.7 BAC70151.1 Non-secretory protein CDS SAVERM_2441 2972771 2972580 hypothetical protein 12.42 6977 Q no similarity 6 BAC70152.1 Non-secretory protein CDS SAVERM_2442 2974948 2972825 parE putative subunit of topoisomerase IV PF00204: DNA gyrase B 8.14 77160 Q DNA packaging & segregation 3.4 BAC70153.1 Non-secretory protein CDS SAVERM_2443 2976687 2975869 putative trypsin-like protease, secreted PF00089: Trypsin 6.5 27676 Q protein modification 3.8 BAC70154.1 Signal peptide CDS SAVERM_2444 2978393 2976855 rpoD RNA polymerase major sigma factor, sigma-70 family hrdB; sigA, PF04539: Sigma-70 region 3 5.92 55911 Q RNA initiation 3.5.1 BAC70155.1 Non-secretory protein CDS SAVERM_2445 2979863 2979000 whiH putative sporulation transcription factor GntR-family transcriptional regulator, PF07729: FCD domain 5.84 30902 Q regulation 3.5.2 BAC70156.1 Non-secretory protein CDS SAVERM_2446 2981795 2980050 putative ABC transporter ATP-binding protein PF00005: ABC transporter 9.99 61375 Q transport / binding proteins & lipoproteins 1.2 BAC70157.1 Non-secretory protein CDS SAVERM_2447 2982661 2981909 putative DNA hydrolase PF00293: NUDIX domain 7.15 26945 Q miscellaneous 4.7 BAC70158.1 Non-secretory protein CDS SAVERM_2448 2985184 2982785 hypothetical protein 11.3 82950 Q similar to unknown proteins 5 BAC70159.1 Non-secretory protein CDS SAVERM_2449 2987020 2985293 hypothetical protein 5.06 60128 Q similar to unknown proteins 5 BAC70160.1 Non-secretory protein CDS SAVERM_2450 2987332 2989536 putative ATP-dependent DNA helicase PF00270: DEAD/DEAH box helicase 6.07 78354 Q DNA modification & repair 3.2 BAC70161.1 Non-secretory protein CDS SAVERM_2451 2989772 2990407 putative secreted protein 10.7 22902 Q similar to unknown proteins 5 BAC70162.1 Non-secretory protein CDS SAVERM_2452 2991579 2990953 hypothetical protein 4.94 20810 Q similar to unknown proteins 5 BAC70163.1 Non-secretory protein CDS SAVERM_2453 2992350 2991649 rnhB putative ribonuclease HII PF01351: Ribonuclease HII 9.06 25206 Q DNA replication 3.1 BAC70164.1 Non-secretory protein CDS SAVERM_2454 2993250 2992627 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.13 22756 Q regulation 3.5.2 BAC70165.1 Non-secretory protein CDS SAVERM_2455 2993440 2994999 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 7.8 54047 Q transport / binding proteins & lipoproteins 1.2 BAC70166.1 Non-secretory protein CDS SAVERM_2456 2997046 2995226 hypothetical protein 5.16 64012 Q similar to unknown proteins 5 BAC70167.1 Non-secretory protein CDS SAVERM_2457 2998288 2997383 putative hydrolase PF03747: ADP-ribosylglycohydrolase 5.35 31553 Q miscellaneous 4.7 BAC70168.1 Non-secretory protein CDS SAVERM_2458 2998960 2998301 hypothetical protein PF00300: Phosphoglycerate mutase family 6.17 25663 Q similar to unknown proteins 5 BAC70169.1 Non-secretory protein CDS SAVERM_2459 2999759 2999154 hypothetical protein 8.77 22773 Q similar to unknown proteins 5 BAC70170.1 Non-secretory protein CDS SAVERM_2460 2999916 3000449 hypothetical protein 4.84 19278 Q similar to unknown proteins 5 BAC70171.1 Non-secretory protein CDS SAVERM_2461 3003436 3000542 nrdA putative vitamin B12-dependent ribonucleotide reductase PF02867: Ribonucleotide reductase, barrel domain 5.31 105011 Q metabolism of nucleotides & nucleic acids 2.3 BAC70172.1 Non-secretory protein CDS SAVERM_2462 3004149 3003586 nrdR putative regulatory protein PF03477: ATP cone domain 5 20616 Q regulation 3.5.2 BAC70173.1 Non-secretory protein CDS SAVERM_2463 3004668 3005447 lexA putative SOS regulatory protein LexA PF01726: LexA DNA binding domain 7.77 28039 Q regulation 3.5.2 BAC70174.1 Non-secretory protein CDS SAVERM_2464 3007643 3005610 dinG putative ATP-dependent helicase PF00270: DEAD/DEAH box helicase 4.71 72981 Q DNA modification & repair 3.2 BAC70175.1 Non-secretory protein CDS SAVERM_2465 3009009 3007876 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.34 38462 Q miscellaneous 4.7 BAC70176.1 Non-secretory protein CDS SAVERM_2466 3011109 3009049 putative siderophore biosynthesis protein/iron transport protein PF04183: IucA / IucC family 6.95 74688 Q miscellaneous 4.7 BAC70177.1 Non-secretory protein CDS SAVERM_2467 3012729 3011275 putative 2,4-diaminobutyrate 4-transaminase PF00202: Aminotransferase class-III 8.24 50998 Q metabolism of amino acids & related molecules 2.2 BAC70178.1 Non-secretory protein CDS SAVERM_2468 3013261 3014493 putative secreted protein 6.07 43354 Q miscellaneous 4.7 BAC70179.1 Signal peptide CDS SAVERM_2469 3014689 3015882 putative secreted protein 6.11 42029 Q miscellaneous 4.7 BAC70180.1 Signal peptide CDS SAVERM_2470 3017441 3015948 putative ATP/GTP-binding protein PF01926: GTPase of unknown function 5.43 54166 Q miscellaneous 4.7 BAC70181.1 Non-secretory protein CDS SAVERM_2471 3019096 3017627 putative metallopeptidase, secreted Tat substrate, PF01433: Peptidase family M1 7.28 53722 Q protein modification 3.8 BAC70182.1 Signal peptide CDS SAVERM_2472 3021470 3019308 rshA putative RelA homolog PF04607: Region found in RelA / SpoT proteins 5.94 77896 Q metabolism of nucleotides & nucleic acids 2.3 BAC70183.1 Non-secretory protein CDS SAVERM_2473 3022638 3021769 dapF1 putative diaminopimelate epimerase PF01678: Diaminopimelate epimerase 4.55 30078 Q metabolism of amino acids & related molecules 2.2 BAC70184.1 Non-secretory protein CDS SAVERM_2474 3023495 3022962 putative membrane protein 4.39 18849 Q miscellaneous 4.7 BAC70185.1 Non-secretory protein CDS SAVERM_2475 3024536 3023598 miaA putative delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase PF01715: IPP transferase 5.48 33876 Q RNA modification 3.6 BAC70186.1 Non-secretory protein CDS SAVERM_2476 3024719 3025084 hypothetical protein 4.2 12518 Q similar to unknown proteins 5 BAC70187.1 Signal peptide CDS SAVERM_2477 3025109 3025384 hypothetical protein 10.14 9444 Q similar to unknown proteins 5 BAC70188.1 Non-secretory protein CDS SAVERM_2478 3026248 3025529 hypothetical protein PF02900: Catalytic LigB subunit of aromatic ring-opening dioxygenase 4.34 24065 Q similar to unknown proteins 5 BAC70189.1 Signal peptide CDS SAVERM_2479 3027844 3026318 miaB putative methylase of isopentenylated A37 derivatives in tRNA PF00919: Uncharacterized protein family UPF0004 5.86 55716 Q RNA modification 3.6 BAC70190.1 Non-secretory protein CDS SAVERM_2480 3028434 3027958 putative secreted protein PF03819: MazG nucleotide pyrophosphohydrolase domain 5.85 16267 Q similar to unknown proteins 5 BAC70191.1 Non-secretory protein CDS SAVERM_2481 3028547 3029545 putative secreted protein PF03466: LysR substrate binding domain 8.83 35796 Q miscellaneous 4.7 BAC70192.1 Signal peptide CDS SAVERM_2482 3030974 3029568 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.11 50057 Q sensors 1.3 BAC70193.1 Signal peptide CDS SAVERM_2483 3031670 3030984 putative two-component system response regulator PF00072: Response regulator receiver domain 8.51 24836 Q regulation 3.5.2 BAC70194.1 Non-secretory protein CDS SAVERM_2484 3031983 3032759 gluA2 putative glutamate ABC transporter ATP-binding protein gltL, PF00005: ABC transporter 7.17 28307 Q transport / binding proteins & lipoproteins 1.2 BAC70195.1 Non-secretory protein CDS SAVERM_2485 3032876 3033709 gluB2 putative glutamate ABC transporter substrate-binding protein gltI, PF01547: Bacterial extracellular solute-binding protein 9.68 29566 Q transport / binding proteins & lipoproteins 1.2 BAC70196.1 Signal peptide CDS SAVERM_2486 3033795 3034460 gluC2 putative glutamate ABC transporter permease gltK, PF00528: Binding-protein-dependent transport system inner membrane component 9.22 23436 Q transport / binding proteins & lipoproteins 1.2 BAC70197.1 Non-secretory protein CDS SAVERM_2487 3034457 3035362 gluD2 putative glutamate ABC transporter permease gltK, PF00528: Binding-protein-dependent transport system inner membrane component 10.19 32121 Q transport / binding proteins & lipoproteins 1.2 BAC70198.1 Non-secretory protein CDS SAVERM_2488 3035563 3037428 putative monooxygenase PF01360: Monooxygenase 9.21 64476 Q miscellaneous 4.7 BAC70199.1 Non-secretory protein CDS SAVERM_2489 3037719 3038264 cdo1 putative cysteine dioxygenase PF05995: cysteine dioxygenase type I 5.53 19811 Q miscellaneous 4.7 BAC70200.1 Non-secretory protein CDS SAVERM_2490 3038261 3038662 hypothetical protein PF00581: Rhodanese-like domain 4.95 14303 Q similar to unknown proteins 5 BAC70201.1 Non-secretory protein CDS SAVERM_2491 3039747 3038800 recX putative regulatory protein RecX PF02631: RecX family 5.82 33381 Q DNA recombination 3.3 BAC70202.1 Non-secretory protein CDS SAVERM_2492 3040884 3039751 recA putative recombination protein RecA PF00154: recA bacterial DNA recombination protein 5.92 39944 Q DNA recombination 3.3 BAC70203.1 Non-secretory protein CDS SAVERM_2493 3041349 3042380 hypothetical protein 11.83 36780 Q no similarity 6 BAC70204.1 Non-secretory protein CDS SAVERM_2494 3043574 3042423 putative membrane protein PF01594: Domain of unknown function DUF20 10.01 41759 Q miscellaneous 4.7 BAC70205.1 Non-secretory protein CDS SAVERM_2495 3043980 3043786 hypothetical protein PF11248: Protein of unknown function (DUF3046) 6.51 7315 Q similar to unknown proteins 5 BAC70206.1 Non-secretory protein CDS SAVERM_2496 3044061 3045005 hypothetical protein 6.86 34705 Q similar to unknown proteins 5 BAC70207.1 Non-secretory protein CDS SAVERM_2497 3045347 3045039 putative membrane protein PF06063: Domain of unknown function (DUF931) 11.41 10210 Q miscellaneous 4.7 BAC70208.1 Non-secretory protein CDS SAVERM_2498 3046252 3045344 putative membrane protein PF03591: AzlC protein 10.85 30655 Q miscellaneous 4.7 BAC70209.1 Non-secretory protein CDS SAVERM_2499 3047096 3046200 putative AraC-family transcriptional regulator PF02311: AraC-like ligand binding domain 8.81 31965 Q regulation 3.5.2 BAC70210.1 Non-secretory protein CDS SAVERM_2500 3047311 3052287 lhr putative ATP-dependent DNA helicase PF00270: DEAD/DEAH box helicase 6.06 175748 Q DNA modification & repair 3.2 BAC70211.1 Non-secretory protein CDS SAVERM_2501 3052491 3053333 nei1 putative endonuclease VIII and DNA N-glycosylase with an AP lyase activity involved in DNA repair; nick DNA at apurinic/apyrimidinic sites. PF01149: Formamidopyrimidine-DNA glycosylase N-terminal domain 10.78 30936 Q DNA modification & repair 3.2 BAC70212.1 Non-secretory protein CDS SAVERM_2502 3053367 3054131 fabG3 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 7.11 26445 Q metabolism of lipids 2.4 BAC70213.1 Non-secretory protein CDS SAVERM_2503 3054602 3054324 hypothetical protein 11.92 9809 Q similar to unknown proteins 5 BAC70214.1 Non-secretory protein CDS SAVERM_2504 3055274 3054804 mrgA2 putative starvation-induced DNA protecting protein PF00210: ferritin-like domain 4.74 16653 Q adaptation to atypical conditions 4.1 BAC70215.1 Non-secretory protein CDS SAVERM_2505 3055896 3055519 putative DNA-binding protein PF01381: Helix-turn-helix 6.77 13593 Q regulation 3.5.2 BAC70216.1 Non-secretory protein CDS SAVERM_2506 3056551 3056006 cinA putative competence-damage inducible protein PF02464: Competence-damaged protein 4.46 18270 Q transformation & competence 1.1 BAC70217.1 Non-secretory protein CDS SAVERM_2507 3057396 3056548 pgsA1 putative phosphatidylglycerophosphate synthase PF01066: CDP-alcohol phosphatidyltransferase 10.33 28642 Q metabolism of lipids 2.4 BAC70218.1 Non-secretory protein CDS SAVERM_2508 3058880 3057393 hypothetical protein PF00919: Uncharacterized protein family UPF0004 4.38 53256 Q similar to unknown proteins 5 BAC70219.1 Non-secretory protein CDS SAVERM_2509 3059888 3058992 putative membrane protein 6.97 31334 Q miscellaneous 4.7 BAC70220.1 Non-secretory protein CDS SAVERM_2510 3062879 3060126 ftsK putative DNA translocase FtsK PF01580: FtsK/SpoIIIE family 8.42 97263 Q cell division 1.7 BAC70221.1 Signal peptide CDS SAVERM_2511 3063673 3062987 osaB putative two-component system response regulator (response to osmoadaptation and osmtic stress) PF00072: Response regulator receiver domain 5.15 24468 Q regulation 3.5.2 BAC70222.1 Non-secretory protein CDS SAVERM_2512 3069437 3063948 osaA putative two-component system sensor kinase (response to osmoadaptation and osmtic stress) PF00672: HAMP domain 4.7 196169 Q sensors 1.3 BAC70223.1 Non-secretory protein CDS SAVERM_2513 3069826 3072573 osaC putative osmitic regulatory protein(prpM2, magnesium or manganese-dependent protein phosphatase) PF01590: GAF domain 4.6 97387 Q protein modification 3.8 BAC70224.1 Non-secretory protein CDS SAVERM_2514 3073468 3072791 putative aminotransferase PF01041: DegT/DnrJ/EryC1/StrS aminotransferase family 6.24 23873 Q miscellaneous 4.7 BAC70225.1 Non-secretory protein CDS SAVERM_2515 3081036 3079351 putative hydrolase of the metallo-beta-lactamase superfamily PF00753: Metallo-beta-lactamase superfamily 6.48 61192 V miscellaneous 4.7 BAC70226.1 Non-secretory protein CDS SAVERM_2516 3082064 3081165 dapA2 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 5.8 31307 V metabolism of amino acids & related molecules 2.2 BAC70227.1 Non-secretory protein CDS SAVERM_2517 3083035 3082295 thyX putative thymidylate synthase PF02511: Thymidylate synthase complementing protein 6.26 28001 V metabolism of nucleotides & nucleic acids 2.3 BAC70228.1 Non-secretory protein CDS SAVERM_2518 3083239 3083478 hypothetical protein 12.04 8469 V similar to unknown proteins 5 BAC70229.1 Non-secretory protein CDS SAVERM_2519 3083604 3084161 putative membrane protein 10.09 20049 V miscellaneous 4.7 BAC70230.1 Non-secretory protein CDS SAVERM_2520 3084691 3084239 putative membrane protein PF00515: TPR Domain 10.27 16600 V miscellaneous 4.7 BAC70231.1 Non-secretory protein CDS SAVERM_2521 3085449 3084697 dapB putative dihydrodipicolinate reductase PF05173: Dihydrodipicolinate reductase, C-terminus 6.51 26280 V metabolism of amino acids & related molecules 2.2 BAC70232.1 Non-secretory protein CDS SAVERM_2522 3086853 3085474 putative protease PF05193: Peptidase M16 inactive domain 6.88 49712 V protein modification 3.8 BAC70233.1 Non-secretory protein CDS SAVERM_2523 3089066 3086850 pnp putative guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase PF01138: 3' exoribonuclease family, domain 1 4.75 79256 V adaptation to atypical conditions 4.1 BAC70234.1 Non-secretory protein CDS SAVERM_2524 3089701 3089414 rpsO putative ribosomal protein S15 PF00312: Ribosomal protein S15 11.56 10768 V ribosomal protein 3.7.1 BAC70235.1 Non-secretory protein CDS SAVERM_2525 3091380 3089920 putative secreted protein PF01011: PQQ enzyme repeat 9.27 51639 V similar to unknown proteins 5 BAC70236.1 Non-secretory protein CDS SAVERM_2526 3093125 3091623 putative membrane protein PF01011: PQQ enzyme repeat 6.93 53666 V miscellaneous 4.7 BAC70237.1 Non-secretory protein CDS SAVERM_2527 3094788 3093280 eccD putative membrane protein type VII SS; PF04600: Protein of unknown function (DUF571) 5.75 51510 V miscellaneous 4.7 BAC70238.1 Non-secretory protein CDS SAVERM_2528 3095123 3099094 eccC putative FtsK/SpoIIIE family protein type VII SS; PF01580: FtsK/SpoIIIE family 5.83 143592 V cell division 1.7 BAC70239.1 Non-secretory protein CDS SAVERM_2529 3099241 3099561 bldB putative BldB protein PF04149: Domain of unknown function (DUF397) 3.96 11779 V miscellaneous 4.7 BAC70240.1 Non-secretory protein CDS SAVERM_2530 3099693 3100982 hypothetical protein 5.71 45900 V no similarity 6 BAC70241.1 Non-secretory protein CDS SAVERM_2531 3102105 3101017 putative secreted protein Tat substrate 4.57 38677 V no similarity 6 BAC70242.1 Non-secretory protein CDS SAVERM_2532 3102848 3102549 hypothetical protein PF06013: Proteins of 100 residues with WXG 4.54 10576 V no similarity 6 BAC70243.1 Non-secretory protein CDS SAVERM_2533 3103279 3102929 hypothetical protein 5.18 12710 V no similarity 6 BAC70244.1 Non-secretory protein CDS SAVERM_2534 3104616 3103399 putative serine protease, secreted PF00082: Subtilase family 6.53 41192 V protein modification 3.8 BAC70245.1 Signal peptide CDS SAVERM_2535 3106504 3104717 hypothetical protein 9.85 60096 V similar to unknown proteins 5 BAC70246.1 Non-secretory protein CDS SAVERM_2536 3107028 3106501 hypothetical protein 9.55 18693 V similar to unknown proteins 5 BAC70247.1 Non-secretory protein CDS SAVERM_2537 3107404 3107856 hypothetical protein 4.44 16158 V similar to unknown proteins 5 BAC70248.1 Non-secretory protein CDS SAVERM_2538 3107861 3110161 hypothetical protein 4.53 82509 V similar to unknown proteins 5 BAC70249.1 Non-secretory protein CDS SAVERM_2539 3111895 3111308 putative secreted protein 4.18 20357 V no similarity 6 BAC70250.1 Signal peptide CDS SAVERM_2540 3113190 3111892 mycP putative mycosin-1 (secreted serine protease) type VII SS; PF00082: Subtilase family 8.2 44240 V protein modification 3.8 BAC70251.1 Signal peptide CDS SAVERM_2541 3114744 3113221 eccB putative membrane protein type VII SS; PF05108: Protein of unknown function (DUF690) 8.87 53320 V miscellaneous 4.7 BAC70252.1 Non-secretory protein CDS SAVERM_2542 3114971 3116308 eccE putative membrane protein type VII SS; 11.64 47140 V miscellaneous 4.7 BAC70253.1 Non-secretory protein CDS SAVERM_2543 3116308 3117111 hypothetical protein 8.72 27932 V similar to unknown proteins 5 BAC70254.1 Non-secretory protein CDS SAVERM_2544 3118702 3121134 hypothetical protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 11.45 86244 V similar to unknown proteins 5 BAC70255.1 Non-secretory protein CDS SAVERM_2545 3122004 3121210 hypothetical protein PF10978: Protein of unknown function (DUF2785) 6.23 28532 V no similarity 6 BAC70256.1 Non-secretory protein CDS SAVERM_2546 3123031 3122078 ribF putative riboflavin kinase PF06574: FAD synthetase 5.55 34648 V metabolism of coenzymes & prosthetic groups 2.5 BAC70257.1 Non-secretory protein CDS SAVERM_2547 3126779 3123180 hypothetical protein 6.8 124938 V similar to unknown proteins 5 BAC70258.1 Non-secretory protein CDS SAVERM_2548 3127969 3127064 truB putative tRNA pseudouridine synthase PF01509: TruB family pseudouridylate synthase (N terminal domain) 7.72 32111 V RNA modification 3.6 BAC70259.1 Non-secretory protein CDS SAVERM_2549 3128439 3127966 rbfA putative ribosome-binding factor PF02033: Ribosome-binding factor A 4.48 16544 V initiation 3.7.3 BAC70260.1 Non-secretory protein CDS SAVERM_2550 3128767 3128474 hypothetical protein PF04456: Protein of unknown function (DUF503) 6.96 10917 V similar to unknown proteins 5 BAC70261.1 Non-secretory protein CDS SAVERM_2551 3132060 3128920 infB putative translation initiation factor IF-2 PF00009: Elongation factor Tu GTP binding domain 10.02 106883 V initiation 3.7.3 BAC70262.1 Non-secretory protein CDS SAVERM_2552 3132501 3132208 hypothetical protein PF04296: Protein of unknown function (DUF448) 9.53 10545 V similar to unknown proteins 5 BAC70263.1 Non-secretory protein CDS SAVERM_2553 3133602 3132616 nusA putative transcriptional termination/antitermination factor PF00575: S1 RNA binding domain 5.34 35808 V DNA termination 3.5.4 BAC70264.1 Non-secretory protein CDS SAVERM_2554 3134114 3133605 hypothetical protein PF02576: Uncharacterised BCR, YhbC family COG0779 4.42 18721 V similar to unknown proteins 5 BAC70265.1 Non-secretory protein CDS SAVERM_2555 3134389 3135087 hypothetical protein 11.94 22882 V similar to unknown proteins 5 BAC70266.1 Non-secretory protein CDS SAVERM_2556 3135084 3135587 hypothetical protein 9.85 17047 V similar to unknown proteins 5 BAC70267.1 Non-secretory protein CDS SAVERM_2557 3135663 3136565 aph2 putative phosphotransferase PF04655: Aminoglycoside/hydroxyurea antibiotic resistance kinase 5.89 32672 V miscellaneous 4.7 BAC70268.1 Non-secretory protein CDS SAVERM_2558 3138583 3136889 proS1 putative prolyl-tRNA synthetase PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 4.6 61193 V aminoacyl-tRNA-synthetase 3.7.2 BAC70269.1 Non-secretory protein CDS SAVERM_2559 3139266 3138697 putative acetyltransferase, secreted PF00583: Acetyltransferase (GNAT) family 6.75 20709 V miscellaneous 4.7 BAC70270.1 Non-secretory protein CDS SAVERM_2560 3140311 3139424 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.21 32183 V miscellaneous 4.7 BAC70271.1 Non-secretory protein CDS SAVERM_2561 3141613 3140456 ispG1 putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase gcpE, MEP pathway 5.06 40673 V specific pathways 2.1.1 BAC70272.1 Non-secretory protein CDS SAVERM_2562 3143086 3141782 putative metalloprotease PF02163: Peptidase family M50 9.44 46785 V protein modification 3.8 BAC70273.1 Non-secretory protein CDS SAVERM_2563 3144267 3143083 dxr putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase ispC, MEP pathway, EC 1.1.1.267 5.23 41285 V specific pathways 2.1.1 BAC70274.1 Non-secretory protein CDS SAVERM_2564 3144529 3144978 putative secreted protein PF00932: Intermediate filament tail domain 9.78 15707 V miscellaneous 4.7 BAC70275.1 Signal peptide CDS SAVERM_2565 3147747 3144985 secA2 putative preprotein translocase SecA subunit PF07517: SecA DEAD-like domain 5.11 103684 V protein secretion 1.6 BAC70276.1 Non-secretory protein CDS SAVERM_2566 3148330 3147845 hypothetical protein 7.17 17997 V no similarity 6 BAC70277.1 Non-secretory protein CDS SAVERM_2567 3150373 3148433 fadE11 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.4 70624 V metabolism of lipids 2.4 BAC70278.1 Non-secretory protein CDS SAVERM_2568 3151310 3150501 celA4 putative secreted endo-1,4-beta-glucanase PF01670: Glycosyl hydrolase family 12 9.37 29361 V specific pathways 2.1.1 BAC70279.1 Signal peptide CDS SAVERM_2569 3151535 3152548 putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 5.58 35716 J regulation 3.5.2 BAC70280.1 Non-secretory protein CDS SAVERM_2570 3152878 3154806 putative glycosyl hydrolase PF01055: Glycosyl hydrolases family 31 4.8 71629 J miscellaneous 4.7 BAC70281.1 Non-secretory protein CDS SAVERM_2571 3155575 3154862 putative endo-1,4-beta-glucanase, secreted PF01670: Glycosyl hydrolase family 12 8.96 24910 J miscellaneous 4.7 BAC70282.1 Signal peptide CDS SAVERM_2572 3157809 3155611 hypothetical protein 6.84 79224 J similar to unknown proteins 5 BAC70283.1 Non-secretory protein CDS SAVERM_2573 3159785 3157806 bga6 putative beta-galactosidase PF02449: Beta-galactosidase 5.09 73417 J specific pathways 2.1.1 BAC70284.1 Non-secretory protein CDS SAVERM_2574 3162004 3159785 putative secreted endo-1,4-beta-glucanase Tat substrate, PF02012: BNR/Asp-box repeat 6.42 78399 J miscellaneous 4.7 BAC70285.1 Signal peptide CDS SAVERM_2575 3163110 3162175 lplC2 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.92 33227 J transport / binding proteins & lipoproteins 1.2 BAC70286.1 Non-secretory protein CDS SAVERM_2576 3164192 3163107 lplB2 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.47 39194 J transport / binding proteins & lipoproteins 1.2 BAC70287.1 Non-secretory protein CDS SAVERM_2577 3165879 3164197 lplA2 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.39 60341 J transport / binding proteins & lipoproteins 1.2 BAC70288.1 Signal peptide CDS SAVERM_2578 3166246 3169110 putative sugar hydrolase PF01915: Glycosyl hydrolase family 3 C terminal domain 5.05 102971 J miscellaneous 4.7 BAC70289.1 Non-secretory protein CDS SAVERM_2579 3170743 3169298 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.82 50691 J specific pathways 2.1.1 BAC70290.1 Non-secretory protein CDS SAVERM_2580 3172035 3170953 putative regulatory protein frameshift 6.3 37690 J miscellaneous 4.7 BAC70291.1 Non-secretory protein CDS SAVERM_2581 3172622 3171843 putative regulatory protein frameshift 9.37 26987 J miscellaneous 4.7 BAC70292.1 Non-secretory protein CDS SAVERM_2582 3175179 3172738 putative ATP/GTP-binding protein 8.61 87041 J miscellaneous 4.7 BAC70293.1 Non-secretory protein CDS SAVERM_2583 3175462 3176796 gabT putative 4-aminobutyrate aminotransferase PF00202: Aminotransferase class-III 5.19 46470 J metabolism of amino acids & related molecules 2.2 BAC70294.1 Non-secretory protein CDS SAVERM_2584 3176974 3177798 putative membrane protein PF01569: PAP2 superfamily 12.15 28489 J miscellaneous 4.7 BAC70295.1 Non-secretory protein CDS SAVERM_2585 3179566 3177737 chiA1 putative secreted chitinase A PF00704: Glycosyl hydrolases family 18 6.32 63870 J specific pathways 2.1.1 BAC70296.1 Signal peptide CDS SAVERM_2586 3179960 3179751 hypothetical protein frameshift 10.46 7895 J miscellaneous 4.7 BAC70298.1 Non-secretory protein CDS SAVERM_2587 3181170 3179635 hypothetical protein frameshift 11.57 55130 J miscellaneous 4.7 BAC70297.1 Non-secretory protein CDS SAVERM_2588 3181999 3181199 potC2 putative polyamine ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.58 29139 J transport / binding proteins & lipoproteins 1.2 BAC70299.1 Non-secretory protein CDS SAVERM_2589 3182944 3182000 potB2 putative polyamine ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.54 34682 J transport / binding proteins & lipoproteins 1.2 BAC70300.1 Non-secretory protein CDS SAVERM_2590 3184104 3182941 potA2 putative polyamine ABC transporter ATP-binding protein PF00005: ABC transporter 5.14 41694 J transport / binding proteins & lipoproteins 1.2 BAC70301.1 Non-secretory protein CDS SAVERM_2591 3185348 3184101 potD2 putative polyamine ABC transporter substrate-binding protein Tat substrate, PF01547: Bacterial extracellular solute-binding protein 5.75 45504 J transport / binding proteins & lipoproteins 1.2 BAC70302.1 Non-secretory protein CDS SAVERM_2592 3186951 3185428 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 6.09 54522 J specific pathways 2.1.1 BAC70303.1 Non-secretory protein CDS SAVERM_2593 3187135 3187722 hypothetical protein PF08719: Domain of unknown function (DUF1768) 8.74 21799 J similar to unknown proteins 5 BAC70304.1 Non-secretory protein CDS SAVERM_2594 3188071 3187745 putative membrane protein 7.26 11090 J miscellaneous 4.7 BAC70305.1 Non-secretory protein CDS SAVERM_2595 3189222 3190298 add2 putative adenosine deaminase PF00962: Adenosine/AMP deaminase 4.91 39202 J metabolism of nucleotides & nucleic acids 2.3 BAC70306.1 Non-secretory protein CDS SAVERM_2596 3190331 3191011 glpQ1 putative glycerophosphoryl diester phosphodiesterase F03009: Glycerophosphoryl diester phosphodiesterase family 8.69 25304 J metabolism of lipids 2.4 BAC70307.1 Non-secretory protein CDS SAVERM_2597 3193035 3191131 sig20 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 9.77 67092 J RNA initiation 3.5.1 BAC70308.1 Non-secretory protein CDS SAVERM_2598 3193662 3193078 hypothetical protein 9.47 21571 J similar to unknown proteins 5 BAC70309.1 Non-secretory protein CDS SAVERM_2599 3193693 3194193 hypothetical protein 4.19 17767 J similar to unknown proteins 5 BAC70310.1 Non-secretory protein CDS SAVERM_2600 3194289 3196817 clpC1 putative ATP-dependent Clp protease PF07724: ATPase family associated with various cellular activities (AAA) 5.83 93285 J adaptation to atypical conditions 4.1 BAC70311.1 Non-secretory protein CDS SAVERM_2601 3197051 3197644 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6.9 21673 J regulation 3.5.2 BAC70312.1 Non-secretory protein CDS SAVERM_2602 3197875 3198312 hypothetical protein PF02566: OsmC-like protein 5.15 15087 J similar to unknown proteins 5 BAC70313.1 Non-secretory protein CDS SAVERM_2603 3199818 3198583 putative multi-drug efflux transporter PF07690: Major Facilitator Superfamily 9.88 41778 J transport / binding proteins & lipoproteins 1.2 BAC70314.1 Non-secretory protein CDS SAVERM_2604 3199977 3202772 putative secreted protein 9.19 97729 J miscellaneous 4.7 BAC70315.1 Signal peptide CDS SAVERM_2605 3202942 3203868 putative dioxygenase PF03060: 2-nitropropane dioxygenase 6.04 31713 J detoxification 4.2 BAC70316.1 Non-secretory protein CDS SAVERM_2606 3205114 3204071 putative sulfate transporter PF01740: STAS domain 7.57 37595 J transport / binding proteins & lipoproteins 1.2 BAC70317.1 Non-secretory protein CDS SAVERM_2607 3205645 3205962 putative ISNCY family ISMk1-like transposase frameshift 8.98 11153 J miscellaneous 4.7 BAC70318.1 Non-secretory protein CDS SAVERM_2608 3205662 3206138 putative IS1380 family IS1676-like transposase frameshift 12.3 18207 J miscellaneous 4.7 BAC70319.1 Non-secretory protein CDS SAVERM_2609 3207868 3206678 putative ABC transporter substrate-binding protein Tat substrate, PF01547: Bacterial extracellular solute-binding protein 5.17 44097 J transport / binding proteins & lipoproteins 1.2 BAC70320.1 Signal peptide CDS SAVERM_2610 3209558 3208119 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.74 51382 J specific pathways 2.1.1 BAC70321.1 Non-secretory protein CDS SAVERM_2611 3209748 3210248 putative AsnC-family transcriptional regulator PF01037: AsnC family 5.29 18245 J regulation 3.5.2 BAC70322.1 Non-secretory protein CDS SAVERM_2612 3210233 3211612 putative aminotransferase PF00202: Aminotransferase class-III 5.2 50754 J metabolism of amino acids & related molecules 2.2 BAC70323.1 Non-secretory protein CDS SAVERM_2613 3211871 3212608 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10.52 26540 J transport / binding proteins & lipoproteins 1.2 BAC70324.1 Non-secretory protein CDS SAVERM_2614 3212590 3213984 putative secreted protein Tat substrate, PF07690: Major Facilitator Superfamily 9.8 46205 J similar to unknown proteins 5 BAC70325.1 Non-secretory protein CDS SAVERM_2615 3214075 3214482 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.14 14958 J similar to unknown proteins 5 BAC70326.1 Non-secretory protein CDS SAVERM_2616 3214509 3215627 hypothetical protein PF03641: Possible lysine decarboxylase 4.73 40171 J similar to unknown proteins 5 BAC70327.1 Non-secretory protein CDS SAVERM_2617 3215775 3216449 putative secreted protein PF00746: Gram positive anchor 8.88 22615 J similar to unknown proteins 5 BAC70328.1 Signal peptide CDS SAVERM_2618 3217607 3216570 thiQ putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.68 36282 J transport / binding proteins & lipoproteins 1.2 BAC70329.1 Non-secretory protein CDS SAVERM_2619 3219308 3217608 thiP putative ABC transporter permease protein thiamine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 11.18 60267 J transport / binding proteins & lipoproteins 1.2 BAC70330.1 Non-secretory protein CDS SAVERM_2620 3220357 3219272 tbpA putative ABC transporter substrate-binding protein thiamine transport system substrate-binding protein, PF01547: Bacterial extracellular solute-binding protein 6.79 38511 J transport / binding proteins & lipoproteins 1.2 BAC70331.1 Signal peptide CDS SAVERM_2621 3221674 3220568 hypothetical protein PF04055: Radical SAM superfamily 8.59 40475 J similar to unknown proteins 5 BAC70332.1 Non-secretory protein CDS SAVERM_2622 3222370 3221960 putative secreted protein 4.56 14282 J no similarity 6 BAC70333.1 Signal peptide CDS SAVERM_2623 3223806 3222628 cdsA putative phosphatidate cytidylyltransferase PF01148: Cytidylyltransferase family 5.37 40876 J metabolism of lipids 2.4 BAC70334.1 Non-secretory protein CDS SAVERM_2624 3224363 3223806 frr putative ribosome recycling factor PF01765: Ribosome recycling factor 4.94 20740 J termination 3.7.5 BAC70335.1 Non-secretory protein CDS SAVERM_2625 3225275 3224517 pyrH putative uridylate kinase PF00696: Amino acid kinase family 4.9 26975 J metabolism of nucleotides & nucleic acids 2.3 BAC70336.1 Non-secretory protein CDS SAVERM_2626 3226312 3225476 tsf putative elongation factor EF-Ts PF00889: Elongation factor TS 5.16 29777 J elongation 3.7.4 BAC70337.1 Non-secretory protein CDS SAVERM_2627 3227335 3226409 rpsB putative ribosomal protein S2 PF00318: Ribosomal protein S2 4.83 33404 J ribosomal protein 3.7.1 BAC70338.1 Non-secretory protein CDS SAVERM_2628 3227598 3228296 putative peptidase, secreted PF01551: Peptidase family M23 11.92 23815 J protein modification 3.8 BAC70339.1 Signal peptide CDS SAVERM_2629 3228950 3228411 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.32 18818 J regulation 3.5.2 BAC70340.1 Non-secretory protein CDS SAVERM_2630 3229997 3229155 whiG putative RNA polymerase sigma factor sigma-70 family, PF04545: Sigma-70, region 4 5.48 30981 J RNA initiation 3.5.1 BAC70341.1 Non-secretory protein CDS SAVERM_2631 3231415 3230270 smf putative DNA processing Smf-family protein PF02481: SMF family 8.93 40094 J DNA packaging & segregation 3.4 BAC70342.1 Non-secretory protein CDS SAVERM_2632 3233037 3231412 putative magnesium chelatase PF01078: Magnesium chelatase, subunit ChlI 6.59 56198 J metabolism of coenzymes & prosthetic groups 2.5 BAC70343.1 Non-secretory protein CDS SAVERM_2633 3233579 3233037 hypothetical protein PF02021: Uncharacterised protein family UPF0102 10.94 19222 J similar to unknown proteins 5 BAC70344.1 Non-secretory protein CDS SAVERM_2634 3233899 3233591 hypothetical protein PF10611: Protein of unknown function (DUF2469) 4.35 12304 J similar to unknown proteins 5 BAC70345.1 Non-secretory protein CDS SAVERM_2635 3234544 3234017 putative MutT/nudix-family hydrolase PF00293: NUDIX domain 4.37 19481 J miscellaneous 4.7 BAC70346.1 Non-secretory protein CDS SAVERM_2636 3235277 3234534 lepB1 putative signal peptidase I PF00717: Peptidase S24-like 10.63 25770 J protein secretion 1.6 BAC70347.1 Non-secretory protein CDS SAVERM_2637 3236232 3235357 lepB2 putative signal peptidase I PF00717: Peptidase S24-like 6.8 31079 J protein secretion 1.6 BAC70348.1 Non-secretory protein CDS SAVERM_2638 3237286 3236204 lepB3 putative signal peptidase I PF00717: Peptidase S24-like 11.82 39144 J protein secretion 1.6 BAC70349.1 Non-secretory protein CDS SAVERM_2639 3237995 3237279 lepB4 putative signal peptidase I PF00717: Peptidase S24-like 5.32 25754 J protein secretion 1.6 BAC70350.1 Non-secretory protein CDS SAVERM_2640 3238391 3238041 rplS putative ribosomal protein L19 PF01245: Ribosomal protein L19 11.49 13186 J ribosomal protein 3.7.1 BAC70351.1 Non-secretory protein CDS SAVERM_2641 3239375 3238527 trmD putative tRNA (guanine-N(1)-)-methyltransferase PF01746: tRNA (Guanine-1)-methyltransferase 5.11 31637 J RNA modification 3.6 BAC70352.1 Non-secretory protein CDS SAVERM_2642 3239935 3239375 rimM putative 16S rRNA processing protein PF01782: RimM N-terminal domain 3.96 20332 J RNA modification 3.6 BAC70353.1 Non-secretory protein CDS SAVERM_2643 3240283 3240044 hypothetical protein PF00013: KH domain 9.52 8683 J similar to unknown proteins 5 BAC70354.1 Non-secretory protein CDS SAVERM_2644 3240714 3240286 rpsP putative ribosomal protein S16 PF00886: Ribosomal protein S16 10.1 15405 J ribosomal protein 3.7.1 BAC70355.1 Non-secretory protein CDS SAVERM_2645 3241593 3240997 hypothetical protein 8.78 21035 J similar to unknown proteins 5 BAC70356.1 Non-secretory protein CDS SAVERM_2646 3243270 3241855 proS2 putative prolyl-tRNA synthetase (eukaryote type) PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 5.68 52164 J aminoacyl-tRNA-synthetase 3.7.2 BAC70357.1 Non-secretory protein CDS SAVERM_2647 3243503 3244366 hypothetical protein PF08242: Methyltransferase domain 7.02 30581 J similar to unknown proteins 5 BAC70358.1 Non-secretory protein CDS SAVERM_2648 3246002 3244452 ffh putative signal recognition particle, subunit SRP54 PF00448: SRP54-type protein, GTPase domain 9.49 55546 J protein secretion 1.6 BAC70359.1 Non-secretory protein CDS SAVERM_2649 3248602 3246143 glnD putative protein P-II uridylyltransferase PF08335: GlnD PII-uridylyltransferase 6.08 90905 J metabolism of amino acids & related molecules 2.2 BAC70360.1 Non-secretory protein CDS SAVERM_2650 3248963 3248625 glnB1 putative nitrogen regulatory protein P-II regulatory protein for glutamine synthetase; glnB-homolog; PF00543: Nitrogen regulatory protein P-II 6.26 12234 J regulation 3.5.2 BAC70361.1 Non-secretory protein CDS SAVERM_2651 3250300 3248960 amtB1 putative ammonium transporter PF00909: Ammonium Transporter Family 5.87 46337 J transport / binding proteins & lipoproteins 1.2 BAC70362.1 Non-secretory protein CDS SAVERM_2652 3252114 3250639 putative regulatory protein 6.92 54013 J regulation 3.5.2 BAC70363.1 Non-secretory protein CDS SAVERM_2653 3252563 3253225 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 7.46 22924 J similar to unknown proteins 5 BAC70364.1 Non-secretory protein CDS SAVERM_2654 3254544 3253315 ftsY putative signal recognition particle receptor PF00448: SRP54-type protein, GTPase domain 4.52 43447 J protein secretion 1.6 BAC70365.1 Non-secretory protein CDS SAVERM_2655 3254633 3256105 putative allantoin permease-family protein PF02133: Permease for cytosine/purines, uracil, thiamine, allantoin 9.43 51260 J transport / binding proteins & lipoproteins 1.2 BAC70366.1 Non-secretory protein CDS SAVERM_2656 3256152 3257132 hypothetical protein PF00296: Luciferase-like monooxygenase 5.4 36116 J similar to unknown proteins 5 BAC70367.1 Non-secretory protein CDS SAVERM_2657 3258631 3257219 araE putative L-arabinose permease PF00083: Sugar (and other) transporter 6.16 50233 J transport / binding proteins & lipoproteins 1.2 BAC70368.1 Non-secretory protein CDS SAVERM_2658 3262502 3258894 smc putative chromosome segregation protein PF02483: SMC family, C-terminal domain 5.2 130717 J DNA packaging & segregation 3.4 BAC70369.1 Signal peptide CDS SAVERM_2659 3263576 3263295 acyP putative acylphosphatase PF00708: Acylphosphatase 4.56 10283 J metabolism of lipids 2.4 BAC70370.1 Non-secretory protein CDS SAVERM_2660 3263727 3264662 hypothetical protein PF00188: SCP-like extracellular protein 8.23 31736 J similar to unknown proteins 5 BAC70371.1 Non-secretory protein CDS SAVERM_2661 3265464 3264841 wrbA putative multimeric flavodoxin PF00258: Flavodoxin 6.5 21792 J miscellaneous 4.7 BAC70372.1 Signal peptide CDS SAVERM_2662 3265560 3265973 putative transcriptional regulator PF01638: Transcriptional regulator 6.51 15228 J regulation 3.5.2 BAC70373.1 Non-secretory protein CDS SAVERM_2663 3267308 3265995 putative beta-lactamase, secreted PF00144: Beta-lactamase 5.39 46425 J detoxification 4.2 BAC70374.1 Signal peptide CDS SAVERM_2664 3268270 3267410 mutM1 putative formamidopyrimidine-DNA glycosylase PF01149: Formamidopyrimidine-DNA glycosylase N-terminal domain 9.88 32330 J DNA modification & repair 3.2 BAC70375.1 Non-secretory protein CDS SAVERM_2665 3269161 3268331 rnc putative ribonuclease III PF00636: RNase3 domain 5.09 28923 J RNA modification 3.6 BAC70376.1 Non-secretory protein CDS SAVERM_2666 3269354 3269181 rpmF putative ribosomal protein L32 PF01783: Ribosomal L32p protein family 10.96 6588 J ribosomal protein 3.7.1 BAC70377.1 Non-secretory protein CDS SAVERM_2667 3270010 3269357 hypothetical protein PF02620: Uncharacterized ACR, COG1399 4.1 23831 J similar to unknown proteins 5 BAC70378.1 Non-secretory protein CDS SAVERM_2668 3271242 3270151 hypothetical protein PF05227: CHASE3 domain 4.23 39804 J similar to unknown proteins 5 BAC70379.1 Non-secretory protein CDS SAVERM_2669 3271871 3271392 coaD putative pantetheine-phosphate adenylyltransferase PF01467: Cytidylyltransferase 5.21 17529 J metabolism of coenzymes & prosthetic groups 2.5 BAC70380.1 Non-secretory protein CDS SAVERM_2670 3272485 3271898 putative RNA methylase PF03602: Conserved hypothetical protein 95 6.03 20954 J RNA modification 3.6 BAC70381.1 Non-secretory protein CDS SAVERM_2671 3275752 3272525 recG putative ATP-dependent DNA helicase PF00271: Helicase conserved C-terminal domain 6.77 117088 J DNA recombination 3.3 BAC70382.1 Non-secretory protein CDS SAVERM_2672 3276139 3277977 htpG putative heat shock protein, hsp90-family PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.58 66934 J adaptation to atypical conditions 4.1 BAC70383.1 Non-secretory protein CDS SAVERM_2673 3277935 3280910 hypothetical protein PF04012: PspA/IM30 family 5.14 108116 J similar to unknown proteins 5 BAC70384.1 Non-secretory protein CDS SAVERM_2674 3282776 3281061 dak3 putative dihydroxyacetone kinase PF02734: DAK2 domain 4.45 57645 J specific pathways 2.1.1 BAC70385.1 Non-secretory protein CDS SAVERM_2675 3283164 3283349 rpmB1 putative ribosomal protein L28 PF00830: Ribosomal L28 family 12.08 6618 J ribosomal protein 3.7.1 BAC70386.1 Non-secretory protein CDS SAVERM_2676 3284451 3283489 thiL putative thiamine monophosphate kinase PF00586: AIR synthase related protein, N-terminal domain 4.9 33329 J metabolism of coenzymes & prosthetic groups 2.5 BAC70387.1 Non-secretory protein CDS SAVERM_2677 3284697 3284930 putative AsnC-family transcriptional regulator PF01037: AsnC family 4.58 8278 J regulation 3.5.2 BAC70388.1 Non-secretory protein CDS SAVERM_2678 3284951 3285442 putative secreted protein 5.81 17427 J similar to unknown proteins 5 BAC70389.1 Signal peptide CDS SAVERM_2679 3286615 3285458 ddlA putative D-alanine-D-alanine ligase PF07478: D-ala D-ala ligase C-terminus 4.51 41905 J cell wall 1.1 BAC70390.1 Non-secretory protein CDS SAVERM_2680 3287763 3286753 gpsA putative glycerol-3-phosphate dehydrogenase, NAD(P)H-dependent PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 5.76 34928 J specific pathways 2.1.1 BAC70391.1 Non-secretory protein CDS SAVERM_2681 3288560 3287760 plsC2 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 10.08 30035 J metabolism of lipids 2.4 BAC70392.1 Non-secretory protein CDS SAVERM_2682 3288705 3289355 cofC putative 2-phospho-L-lactate guanylyltransferase PF01983: Protein of unknown function DUF121 9.5 21496 J similar to unknown proteins 5 BAC70393.1 Non-secretory protein CDS SAVERM_2683 3289365 3289568 hypothetical protein 4.36 7326 J similar to unknown proteins 5 BAC70394.1 Non-secretory protein CDS SAVERM_2684 3290308 3289655 hupB putative histone-like DNA-binding protein PF00216: Bacterial DNA-binding protein 11.97 22266 J DNA packaging & segregation 3.4 BAC70395.1 Non-secretory protein CDS SAVERM_2685 3291557 3290964 leuD putative 3-isopropylmalate dehydratase subunit small PF00694: Aconitase C-terminal domain 5.15 22161 J metabolism of amino acids & related molecules 2.2 BAC70396.1 Non-secretory protein CDS SAVERM_2686 3292997 3291564 leuC putative 3-isopropylmalate dehydratase subunit large PF00330: Aconitase family (aconitate hydratase) 4.9 50345 J metabolism of amino acids & related molecules 2.2 BAC70397.1 Non-secretory protein CDS SAVERM_2687 3293189 3293905 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 11.75 24961 J regulation 3.5.2 BAC70398.1 Non-secretory protein CDS SAVERM_2688 3294476 3293979 hypothetical protein 10.6 18777 J similar to unknown proteins 5 BAC70399.1 Non-secretory protein CDS SAVERM_2689 3294558 3295202 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 5.62 23869 J regulation 3.5.2 BAC70400.1 Non-secretory protein CDS SAVERM_2690 3296987 3295851 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 6.71 40943 J miscellaneous 4.7 BAC70401.1 Non-secretory protein CDS SAVERM_2691 3298634 3297120 gltS putative glutamyl-tRNA synthetase PF00749: tRNA synthetases class I (E and Q), catalytic domain 4.99 56013 J aminoacyl-tRNA-synthetase 3.7.2 BAC70402.1 Non-secretory protein CDS SAVERM_2692 3299403 3298627 putative 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase PF01557: Fumarylacetoacetate (FAA) hydrolase family 4.89 28035 J metabolism of amino acids & related molecules 2.2 BAC70403.1 Non-secretory protein CDS SAVERM_2693 3299742 3299569 hypothetical protein 5.49 6348 J similar to unknown proteins 5 BAC70404.1 Non-secretory protein CDS SAVERM_2694 3300359 3304195 cvnA6 putative sensor-like histidine kinase multi-component regulatory system-6 9.33 133680 J sensors 1.3 BAC70405.1 Non-secretory protein CDS SAVERM_2695 3304205 3304618 cvnB6 hypothetical protein multi-component regulatory system-6, PF03259: Roadblock/LC7 domain 4.19 14331 J similar to unknown proteins 5 BAC70406.1 Non-secretory protein CDS SAVERM_2696 3304730 3305128 cvnC6 hypothetical protein multi-component regulatory system-6, PF05331: Protein of unknown function (DUF742) 5.57 14079 J similar to unknown proteins 5 BAC70407.1 Non-secretory protein CDS SAVERM_2697 3305109 3305687 cvnD6 putative ATP/GTP-binding protein multi-component regulatory system-6 4.57 20651 J miscellaneous 4.7 BAC70408.1 Non-secretory protein CDS SAVERM_2698 3306085 3309330 cvnA7 putative sensor-like histidine kinase multi-component regulatory system-7 4.86 116748 J sensors 1.3 BAC70409.1 Non-secretory protein CDS SAVERM_2699 3309341 3309754 cvnB7 hypothetical protein multi-component regulatory system-7, PF03259: Roadblock/LC7 domain 4.08 14317 J similar to unknown proteins 5 BAC70410.1 Non-secretory protein CDS SAVERM_2700 3309851 3310435 cvnC7 hypothetical protein multi-component regulatory system-7, PF05331: Protein of unknown function (DUF742) 9.49 20584 J similar to unknown proteins 5 BAC70411.1 Non-secretory protein CDS SAVERM_2701 3310473 3310997 cvnD7 putative ATP/GTP-binding protein multi-component regulatory system-7 4.42 18906 J miscellaneous 4.7 BAC70412.1 Non-secretory protein CDS SAVERM_2702 3311610 3311416 hypothetical protein 11.7 6985 J similar to unknown proteins 5 BAC70413.1 Non-secretory protein CDS SAVERM_2703 3313263 3311668 mmdA2 putative methylmalonyl-CoA decarboxylase alpha subunit PF01039: Carboxyl transferase domain 4.97 57433 J specific pathways 2.1.1 BAC70414.1 Non-secretory protein CDS SAVERM_2704 3315745 3313418 putative polysaccharide lyase (hyaluronidase), secreted Tat substrate, PF02278: Polysaccharide lyase family 8, super-sandwich domain 8.46 83584 J specific pathways 2.1.1 BAC70415.1 Signal peptide CDS SAVERM_2705 3316322 3315813 putative secreted protein 8.57 17835 J no similarity 6 BAC70416.1 Signal peptide CDS SAVERM_2706 3316560 3317180 hypothetical protein PF04264: YceI like family 4.67 22013 J similar to unknown proteins 5 BAC70417.1 Non-secretory protein CDS SAVERM_2707 3318660 3317290 putative secreted protein 4.56 47083 J similar to unknown proteins 5 BAC70418.1 Signal peptide CDS SAVERM_2708 3321801 3318766 putative glycosyl hydrolase, secreted PF00933: Glycosyl hydrolase family 3 N terminal domain 5.09 105744 J miscellaneous 4.7 BAC70419.1 Signal peptide CDS SAVERM_2709 3321963 3323906 putative glycosyl hydrolase, secreted Tat substrate, PF00652: QXW lectin repeat 7.75 68387 J miscellaneous 4.7 BAC70420.1 Signal peptide CDS SAVERM_2710 3325518 3323914 leuA1 putative 2-isopropylmalate synthase PF00682: HMGL-like 5 57657 J metabolism of amino acids & related molecules 2.2 BAC70421.1 Non-secretory protein CDS SAVERM_2711 3327138 3325807 putative transporter PF00083: Sugar (and other) transporter 9.1 47853 J transport / binding proteins & lipoproteins 1.2 BAC70422.1 Non-secretory protein CDS SAVERM_2712 3328545 3327202 hypothetical protein PF07676: WD40-like Beta Propeller Repeat 6.51 46861 J no similarity 6 BAC70423.1 Non-secretory protein CDS SAVERM_2713 3329601 3328981 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.31 23018 J regulation 3.5.2 BAC70424.1 Non-secretory protein CDS SAVERM_2714 3330653 3329613 aguA putative agmatine deiminase PF04371: Porphyromonas-type peptidyl-arginine deiminase 5.21 37578 J metabolism of amino acids & related molecules 2.2 BAC70425.1 Non-secretory protein CDS SAVERM_2715 3332333 3330663 ureC2 putative urease alpha subunit PF01979: Amidohydrolase family 6.11 58202 J metabolism of amino acids & related molecules 2.2 BAC70426.1 Non-secretory protein CDS SAVERM_2716 3333013 3332330 ureAB putative urease beta/gamma subunit fusion of urease beta and gamma subunits, PF00547: Urease gamma subunit, PF00699: Urease beta subunit 4.84 23569 J metabolism of amino acids & related molecules 2.2 BAC70427.1 Non-secretory protein CDS SAVERM_2717 3334339 3333251 ilvE putative branched-chain amino acid aminotransferase PF01063: Aminotransferase class IV 4.77 39084 J metabolism of amino acids & related molecules 2.2 BAC70428.1 Non-secretory protein CDS SAVERM_2718 3335649 3334606 leuB putative 3-isopropylmalate dehydrogenase PF00180: Isocitrate/isopropylmalate dehydrogenase 5.1 36745 J metabolism of amino acids & related molecules 2.2 BAC70429.1 Non-secretory protein CDS SAVERM_2719 3335713 3337362 ppe1 putative phosphoesterase PF00149: Calcineurin-like phosphoesterase 7.86 59505 J miscellaneous 4.7 BAC70430.1 Non-secretory protein CDS SAVERM_2720 3337599 3337468 hypothetical protein 12.05 4757 J similar to unknown proteins 5 BAC70431.1 Non-secretory protein CDS SAVERM_2721 3338587 3338018 aac1 putative aminoglycoside 2’-N-acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.02 20127 J detoxification 4.2 BAC70432.1 Non-secretory protein CDS SAVERM_2722 3338680 3339549 putative hydrolase PF00561: alpha/beta hydrolase fold 5.27 31688 J miscellaneous 4.7 BAC70433.1 Non-secretory protein CDS SAVERM_2723 3341188 3339557 rocA putative delta-1-pyrroline-5-carboxylate dehydrogenase PF00171: Aldehyde dehydrogenase family 5.07 58980 J metabolism of amino acids & related molecules 2.2 BAC70434.1 Non-secretory protein CDS SAVERM_2724 3342260 3341334 putA putative proline dehydrogenase PF01619: Proline dehydrogenase 7.17 34235 J metabolism of amino acids & related molecules 2.2 BAC70435.1 Non-secretory protein CDS SAVERM_2725 3342426 3343625 putative transcriptional regulator PF01590: GAF domain 6.19 42420 J regulation 3.5.2 BAC70436.1 Non-secretory protein CDS SAVERM_2726 3345178 3343682 hypothetical protein 4.38 54999 J no similarity 6 BAC70437.1 Non-secretory protein CDS SAVERM_2727 3345881 3345291 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.58 21466 J regulation 3.5.2 BAC70438.1 Non-secretory protein CDS SAVERM_2728 3346066 3347538 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 5.61 50253 J transport / binding proteins & lipoproteins 1.2 BAC70439.1 Non-secretory protein CDS SAVERM_2729 3347780 3350794 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 5.33 106942 J regulation 3.5.2 BAC70440.1 Non-secretory protein CDS SAVERM_2730 3352496 3350907 serA putative D-3-phosphoglycerate dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.7 55125 J metabolism of amino acids & related molecules 2.2 BAC70441.1 Non-secretory protein CDS SAVERM_2731 3353765 3352764 ilvC ketol-acid reductoisomerase PF01450: Acetohydroxy acid isomeroreductase, catalytic domain 4.56 36285 J metabolism of amino acids & related molecules 2.2 BAC70442.1 Non-secretory protein CDS SAVERM_2732 3354412 3353885 ilvN acetolactate synthase subunit small PF01842: ACT domain 9.86 19088 J metabolism of amino acids & related molecules 2.2 BAC70443.1 Non-secretory protein CDS SAVERM_2733 3356283 3354433 ilvB1 acetolactate synthase subunit large PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.98 65639 J metabolism of amino acids & related molecules 2.2 BAC70444.1 Non-secretory protein CDS SAVERM_2734 3359652 3356515 putative integral membrane phosphodiesterase PF00563: EAL domain 9.51 110873 J miscellaneous 4.7 BAC70445.1 Non-secretory protein CDS SAVERM_2735 3360825 3359884 putative dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 4.95 33629 J miscellaneous 4.7 BAC70446.1 Non-secretory protein CDS SAVERM_2736 3360967 3361899 putative oxidoreductase PF00248: Aldo/keto reductase family 9.59 33606 J miscellaneous 4.7 BAC70447.1 Non-secretory protein CDS SAVERM_2737 3362169 3363332 putative oxidoreductase PF07995: Glucose / Sorbosone dehydrogenase 8.38 40400 J miscellaneous 4.7 BAC70448.1 Signal peptide CDS SAVERM_2738 3363621 3363349 hypothetical protein 4.88 9712 J similar to unknown proteins 5 BAC70449.1 Non-secretory protein CDS SAVERM_2739 3367091 3363618 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 6.47 122539 J regulation 3.5.2 BAC70450.1 Non-secretory protein CDS SAVERM_2740 3367390 3367088 hypothetical protein 12.12 11872 J similar to unknown proteins 5 BAC70451.1 Non-secretory protein CDS SAVERM_2741 3368104 3367493 putative membrane protein 3.97 20131 J miscellaneous 4.7 BAC70452.1 Non-secretory protein CDS SAVERM_2742 3368715 3368140 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.3 21150 J miscellaneous 4.7 BAC70453.1 Non-secretory protein CDS SAVERM_2743 3370576 3369059 gatB putative aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B PF02934: PET112 family, N terminal region 4.91 54514 J aminoacyl-tRNA-synthetase 3.7.2 BAC70454.1 Non-secretory protein CDS SAVERM_2744 3370835 3370593 hypothetical protein PF06724: Domain of Unknown Function (DUF1206) 10.59 8369 J similar to unknown proteins 5 BAC70455.1 Non-secretory protein CDS SAVERM_2745 3372337 3370832 gatA putative aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A PF01425: Amidase 4.51 52779 J aminoacyl-tRNA-synthetase 3.7.2 BAC70456.1 Non-secretory protein CDS SAVERM_2746 3372639 3372343 gatC putative aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C PF02686: Glu-tRNAGln amidotransferase C subunit 4.42 10699 J aminoacyl-tRNA-synthetase 3.7.2 BAC70457.1 Non-secretory protein CDS SAVERM_2747 3375286 3372950 putative phosphodiesterase PF00563: EAL domain 7.3 82602 J metabolism of phosphates 2.6 BAC70458.1 Non-secretory protein CDS SAVERM_2748 3377715 3375523 ligA putative DNA ligase PF01653: NAD-dependent DNA ligase adenylation domain 4.93 80423 J DNA replication 3.1 BAC70459.1 Non-secretory protein CDS SAVERM_2749 3378738 3377731 hypothetical protein PF01717: Methionine synthase, vitamin-B12 independent 5.12 35117 J similar to unknown proteins 5 BAC70460.1 Non-secretory protein CDS SAVERM_2750 3379543 3378845 putative dehydrogenase PF00106: short chain dehydrogenase 6.9 24799 J miscellaneous 4.7 BAC70461.1 Non-secretory protein CDS SAVERM_2751 3380090 3379551 hypothetical protein PF03641: possible lysine decarboxylase 4.46 19286 J similar to unknown proteins 5 BAC70462.1 Non-secretory protein CDS SAVERM_2752 3380142 3380465 hypothetical protein PF04248: Domain of unknown function (DUF427) 4.72 12129 J similar to unknown proteins 5 BAC70463.1 Non-secretory protein CDS SAVERM_2753 3381738 3380608 trmU putative tRNA (5-methylaminomethyl-2-thiouridine)-methyltransferase PF03054: tRNA methyl transferase 5.46 39809 J RNA modification 3.6 BAC70464.1 Signal peptide CDS SAVERM_2754 3381799 3382455 ampD1 putative N-acetylmuramoyl-L-alanine amidase PF01510: N-acetylmuramoyl-L-alanine amidase 8.49 23940 J phage-related functions 4.4 BAC70465.1 Non-secretory protein CDS SAVERM_2755 3382802 3384250 putative multicopper oxidase, secreted Tat substrate, PF07732: Multicopper oxidase 4.17 50812 J miscellaneous 4.7 BAC70466.1 Signal peptide CDS SAVERM_2756 3385485 3384316 putative pyridoxal-phosphate-dependent aminotransferase PF00266: Aminotransferase class-V 4.94 40461 J miscellaneous 4.7 BAC70467.1 Non-secretory protein CDS SAVERM_2757 3385966 3385700 putative membrane protein 10.16 9071 J miscellaneous 4.7 BAC70468.1 Non-secretory protein CDS SAVERM_2758 3386173 3386006 putative membrane protein 12.68 5857 J miscellaneous 4.7 BAC70469.1 Non-secretory protein CDS SAVERM_2759 3386308 3386934 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.81 23027 J regulation 3.5.2 BAC70470.1 Non-secretory protein CDS SAVERM_2760 3388551 3387595 putative DeoR-family transcriptional regulator PF08279: HTH domain 9.95 35267 J regulation 3.5.2 BAC70471.1 Non-secretory protein CDS SAVERM_2761 3388666 3389250 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 4.39 20815 J similar to unknown proteins 5 BAC70472.1 Non-secretory protein CDS SAVERM_2762 3390097 3389237 hypothetical protein 4.39 30543 J similar to unknown proteins 5 BAC70473.1 Non-secretory protein CDS SAVERM_2763 3390851 3390195 hypothetical protein PF03458: UPF0126 domain 7.06 23396 J similar to unknown proteins 5 BAC70474.1 Non-secretory protein CDS SAVERM_2764 3392290 3390899 putative metallopeptidase, secreted PF01433: Peptidase family M1 6.62 50789 J protein modification 3.8 BAC70475.1 Signal peptide CDS SAVERM_2765 3393913 3392387 oppF1 putative peptide ABC transporter ATP-binding protein tetra-pentapeptide transport system, PF00005: ABC transporter 4.99 54443 J transport / binding proteins & lipoproteins 1.2 BAC70476.1 Non-secretory protein CDS SAVERM_2766 3395007 3393910 oppD1 putative peptide ABC transporter ATP-binding protein PF00005: ABC transporter 6.29 40123 J transport / binding proteins & lipoproteins 1.2 BAC70477.1 Non-secretory protein CDS SAVERM_2767 3396011 3395004 oppB1 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.44 36538 J transport / binding proteins & lipoproteins 1.2 BAC70478.1 Non-secretory protein CDS SAVERM_2768 3397853 3396081 oppA1 putative peptide ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 9.16 63841 J transport / binding proteins & lipoproteins 1.2 BAC70479.1 Signal peptide CDS SAVERM_2769 3398888 3397890 oppC1 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 5.86 35462 J transport / binding proteins & lipoproteins 1.2 BAC70480.1 Non-secretory protein CDS SAVERM_2770 3400088 3399282 hypothetical protein 5.93 28566 J similar to unknown proteins 5 BAC70481.1 Non-secretory protein CDS SAVERM_2771 3401015 3400233 hypothetical protein PF07179: SseB protein 4.42 27616 J similar to unknown proteins 5 BAC70482.1 Non-secretory protein CDS SAVERM_2772 3401854 3401168 putative ATP/GTP-binding protein PF01926: GTPase of unknown function 11.8 24563 J miscellaneous 4.7 BAC70483.1 Non-secretory protein CDS SAVERM_2773 3402270 3403388 gcvT putative glycine cleavage system protein T (aminomethyltransferase) PF01571: Glycine cleavage T-protein (aminomethyl transferase) 4.82 39087 J metabolism of amino acids & related molecules 2.2 BAC70484.1 Non-secretory protein CDS SAVERM_2774 3403534 3403911 gcvH putative glycine cleavage system protein H PF01597: Glycine cleavage H-protein 3.75 13381 J metabolism of amino acids & related molecules 2.2 BAC70485.1 Non-secretory protein CDS SAVERM_2775 3403925 3405187 glyA1 putative serine hydroxymethyltransferase PF00464: Serine hydroxymethyltransferase 6.16 44979 J metabolism of amino acids & related molecules 2.2 BAC70486.1 Non-secretory protein CDS SAVERM_2776 3405295 3406662 sdaA putative L-serine dehydratase PF03313: Serine dehydratase alpha chain 5.53 48486 J metabolism of amino acids & related molecules 2.2 BAC70487.1 Non-secretory protein CDS SAVERM_2777 3406782 3407336 putative glycosyl hydrolase PF01183: Glycosyl hydrolases family 25 6.01 20886 J miscellaneous 4.7 BAC70488.1 Non-secretory protein CDS SAVERM_2778 3407533 3407886 hypothetical protein PF03473: MOSC domain 4.42 12201 J similar to unknown proteins 5 BAC70489.1 Non-secretory protein CDS SAVERM_2779 3408601 3407939 hypothetical protein PF03807: NADP oxidoreductase coenzyme F420-dependent 4.41 22971 J similar to unknown proteins 5 BAC70490.1 Non-secretory protein CDS SAVERM_2780 3409043 3408831 cabB putative calcium-binding protein PF00036: EF hand 4.14 7750 J miscellaneous 4.7 BAC70491.1 Non-secretory protein CDS SAVERM_2781 3410020 3409094 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 4.98 33799 J regulation 3.5.2 BAC70492.1 Non-secretory protein CDS SAVERM_2782 3410077 3410793 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6.8 25296 J similar to unknown proteins 5 BAC70493.1 Non-secretory protein CDS SAVERM_2783 3411956 3410760 putative secreted protein 6.91 43492 J similar to unknown proteins 5 BAC70494.1 Non-secretory protein CDS SAVERM_2784 3412846 3411956 putative polysaccharide deacetylase PF01522: Polysaccharide deacetylase 10.68 30552 J cell wall 1.1 BAC70495.1 Non-secretory protein CDS SAVERM_2785 3413748 3413140 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 11.22 22309 J regulation 3.5.2 BAC70496.1 Non-secretory protein CDS SAVERM_2786 3414765 3413998 echA8 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.23 27293 J metabolism of lipids 2.4 BAC70497.1 Non-secretory protein CDS SAVERM_2787 3416087 3414846 putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 8.89 43673 J transport / binding proteins & lipoproteins 1.2 BAC70498.1 Non-secretory protein CDS SAVERM_2788 3417507 3416278 putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 8.26 44442 K transport / binding proteins & lipoproteins 1.2 BAC70499.1 Signal peptide CDS SAVERM_2789 3417664 3419913 glgX2 putative glycogen debranching enzyme PF02922: Carbohydrate-binding module 48 (Isoamylase N-terminal domain) 6.46 83000 K miscellaneous 4.7 BAC70500.1 Non-secretory protein CDS SAVERM_2790 3419980 3421941 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.66 70442 K transport / binding proteins & lipoproteins 1.2 BAC70501.1 Non-secretory protein CDS SAVERM_2791 3421938 3423800 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.77 66503 K transport / binding proteins & lipoproteins 1.2 BAC70502.1 Non-secretory protein CDS SAVERM_2792 3423822 3425543 putative ABC transporter permease protein PF00005: ABC transporter 8.06 60146 K transport / binding proteins & lipoproteins 1.2 BAC70503.1 Non-secretory protein CDS SAVERM_2793 3425540 3427306 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.76 61371 K transport / binding proteins & lipoproteins 1.2 BAC70504.1 Non-secretory protein CDS SAVERM_2794 3427706 3429751 zmp3 griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 8.16 70917 K protein modification 3.8 BAC70505.1 Signal peptide CDS SAVERM_2795 3430049 3431713 zmp4 putative griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 8.71 57439 K protein modification 3.8 BAC70506.1 Signal peptide CDS SAVERM_2796 3431816 3432322 hypothetical protein PF09348: Domain of unknown function (DUF1990) 7.91 18169 K similar to unknown proteins 5 BAC70507.1 Non-secretory protein CDS SAVERM_2797 3432931 3432341 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.74 21282 K regulation 3.5.2 BAC70508.1 Non-secretory protein CDS SAVERM_2798 3433035 3433889 putative DNA-binding protein PF01381: Helix-turn-helix 6.45 31914 K regulation 3.5.2 BAC70509.1 Non-secretory protein CDS SAVERM_2799 3433901 3434089 hypothetical protein PF04149: Domain of unknown function (DUF397) 7.52 6929 K no similarity 6 BAC70510.1 Non-secretory protein CDS SAVERM_2800 3437513 3434877 glgP putative glycogen phosphorylase PF00343: Carbohydrate phosphorylase 5.41 97014 K specific pathways 2.1.1 BAC70511.1 Non-secretory protein CDS SAVERM_2801 3437980 3439188 putative secreted peptidase A PF00082: Subtilase family 9.92 40554 K protein modification 3.8 BAC70512.1 Signal peptide CDS SAVERM_2802 3439435 3441540 amyA3 putative alpha-amylase PF00128: Alpha amylase, catalytic domain 6.86 77365 K specific pathways 2.1.1 BAC70513.1 Non-secretory protein CDS SAVERM_2803 3441537 3443255 treS1 putative trehalose synthase PF00128: Alpha amylase, catalytic domain 4.53 65752 K specific pathways 2.1.1 BAC70514.1 Non-secretory protein CDS SAVERM_2804 3443356 3444756 putative pep2 protein PF01636: Phosphotransferase enzyme family 6.63 50898 K miscellaneous 4.7 BAC70515.1 Non-secretory protein CDS SAVERM_2805 3444809 3447325 glgB putative 1,4-alpha-glucan branching enzyme PF02922: Isoamylase N-terminal domain 6.81 92740 K specific pathways 2.1.1 BAC70516.1 Non-secretory protein CDS SAVERM_2806 3448770 3447322 cyp12 putative cytochrome P450 CYP182A1 7 52469 K metabolism of coenzymes & prosthetic groups 2.5 BAC70517.1 Non-secretory protein CDS SAVERM_2807 3451122 3448795 hypothetical protein PF00580: UvrD/REP helicase 4.75 84692 K similar to unknown proteins 5 BAC70518.1 Non-secretory protein CDS SAVERM_2808 3451575 3451261 trxA5 putative thioredoxin PF00085: Thioredoxin 4.13 11502 K membrane bioenergetics 1.4 BAC70519.1 Non-secretory protein CDS SAVERM_2809 3452018 3451590 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 5.05 15648 K regulation 3.5.2 BAC70520.1 Non-secretory protein CDS SAVERM_2810 3452511 3452062 putative AsnC-family transcriptional regulator PF01037: AsnC family 9.19 16462 K regulation 3.5.2 BAC70521.1 Non-secretory protein CDS SAVERM_2811 3452696 3453592 putative epimerase PF01370: NAD dependent epimerase/dehydratase family 5.08 32334 K miscellaneous 4.7 BAC70522.1 Non-secretory protein CDS SAVERM_2812 3453820 3454674 prcB2 putative 20S proteasome beta-subunit PF00227: Proteasome A-type and B-type 6.1 30459 K protein modification 3.8 BAC70523.1 Non-secretory protein CDS SAVERM_2813 3456540 3454813 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 6.14 59742 K transport / binding proteins & lipoproteins 1.2 BAC70524.1 Non-secretory protein CDS SAVERM_2814 3456690 3457307 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.75 21743 K regulation 3.5.2 BAC70525.1 Non-secretory protein CDS SAVERM_2815 3458798 3457386 dctA putative sodium:dicarboxylate symporter PF00375: Sodium:dicarboxylate symporter family 7.7 49153 K transport / binding proteins & lipoproteins 1.2 BAC70526.1 Non-secretory protein CDS SAVERM_2816 3458968 3460665 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.41 59087 K sensors 1.3 BAC70527.1 Non-secretory protein CDS SAVERM_2817 3460662 3461339 citB putative two-component system response regulator PF00072: Response regulator receiver domain 9.33 24153 K regulation 3.5.2 BAC70528.1 Non-secretory protein CDS SAVERM_2818 3461710 3463107 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.6 50421 K transport / binding proteins & lipoproteins 1.2 BAC70529.1 Signal peptide CDS SAVERM_2819 3463104 3464033 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 10.92 33681 K transport / binding proteins & lipoproteins 1.2 BAC70530.1 Non-secretory protein CDS SAVERM_2820 3464035 3464874 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 8.7 29901 K transport / binding proteins & lipoproteins 1.2 BAC70531.1 Non-secretory protein CDS SAVERM_2821 3465344 3466060 hypothetical protein 6.16 26185 K similar to unknown proteins 5 BAC70532.1 Non-secretory protein CDS SAVERM_2822 3467128 3466103 pfkA1 6-phosphofructokinase PF00365: Phosphofructokinase 6.24 36498 K main glycolytic pathways 2.1.2 BAC70533.1 Non-secretory protein CDS SAVERM_2823 3467325 3469415 pta putative phosphotransacetylase PF01515: Phosphate acetyl/butaryl transferase 4.8 74274 K specific pathways 2.1.1 BAC70534.1 Non-secretory protein CDS SAVERM_2824 3469412 3470629 ackA putative acetate kinase PF00871: Acetokinase family 6.02 43242 K specific pathways 2.1.1 BAC70535.1 Non-secretory protein CDS SAVERM_2825 3470703 3472133 pykA1 putative pyruvate kinase glycolysis 5.69 51040 K main glycolytic pathways 2.1.2 BAC70536.1 Non-secretory protein CDS SAVERM_2826 3473618 3472320 hypothetical protein PF02987: Late embryogenesis abundant protein 4.36 43668 K similar to unknown proteins 5 BAC70537.1 Non-secretory protein CDS SAVERM_2827 3474174 3473608 putative membrane protein 9.73 19094 K miscellaneous 4.7 BAC70538.1 Non-secretory protein CDS SAVERM_2828 3474961 3475311 hypothetical protein 12.25 13609 K no similarity 6 BAC70540.1 Non-secretory protein CDS SAVERM_2829 3475013 3474369 putative cholesterol esterase, secreted 6.78 22590 K specific pathways 2.1.1 BAC70539.1 Signal peptide CDS SAVERM_2830 3476624 3475638 trxA6 putative thioredoxin PF00085: Thioredoxin 4.22 34656 K membrane bioenergetics 1.4 BAC70541.1 Non-secretory protein CDS SAVERM_2831 3476861 3477496 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.88 22358 K regulation 3.5.2 BAC70542.1 Non-secretory protein CDS SAVERM_2832 3479358 3477658 icmA isobutyryl-CoA mutase, chain A PF01642: Methylmalonyl-CoA mutase 4.71 62268 K metabolism of lipids 2.4 BAC70543.1 Non-secretory protein CDS SAVERM_2833 3479773 3479435 putative secreted protein 9.97 12374 K similar to unknown proteins 5 BAC70544.1 Non-secretory protein CDS SAVERM_2834 3480273 3479839 putative MarR-family transcriptional regulator PF01047: MarR family 4.78 15701 K regulation 3.5.2 BAC70545.1 Non-secretory protein CDS SAVERM_2835 3482187 3480598 sppF putative polyketide hydroxylase spore-pigment gene cluster, PF01360: Monooxygenase 5.81 56712 K antibiotic production 4.3 BAC70546.1 Non-secretory protein CDS SAVERM_2836 3482594 3483718 sppG putative WhiE I homolog spore-pigment gene cluster, PF04486: SchA / CurD like protein 5.17 40986 K antibiotic production 4.3 BAC70547.1 Non-secretory protein CDS SAVERM_2837 3483792 3484235 sppH putative WhiE II homolog spore-pigment gene cluster 5.56 16164 K antibiotic production 4.3 BAC70548.1 Non-secretory protein CDS SAVERM_2838 3484232 3485497 sppA putative 3-oxoacyl-ACP synthase I spore-pigment gene cluster, PF00109: Beta-ketoacyl synthase, N-terminal domain 6.16 44472 K antibiotic production 4.3 BAC70549.1 Non-secretory protein CDS SAVERM_2839 3485497 3486747 sppB putative chain length factor (3-oxoacyl-ACP synthase II) spore-pigment gene cluster, PF00109: Beta-ketoacyl synthase, N-terminal domain 5.29 43446 K antibiotic production 4.3 BAC70550.1 Non-secretory protein CDS SAVERM_2840 3486734 3487018 sppC putative acyl carrier protein spore-pigment gene cluster, PF00550: Phosphopantetheine attachment site 4.24 10158 K antibiotic production 4.3 BAC70551.1 Non-secretory protein CDS SAVERM_2841 3487020 3487499 sppD putative cyclase I spore-pigment gene cluster, PF03364: Streptomyces cyclase/dehydrase 4.55 18548 K antibiotic production 4.3 BAC70552.1 Non-secretory protein CDS SAVERM_2842 3487579 3487905 sppE putative cyclase II spore-pigment gene cluster, PF04673: Polyketide synthesis cyclase 5.56 12118 K antibiotic production 4.3 BAC70553.1 Non-secretory protein CDS SAVERM_2843 3488995 3488000 putative O-methyltransferase PF00891: O-methyltransferase 5.13 36302 K miscellaneous 4.7 BAC70554.1 Non-secretory protein CDS SAVERM_2844 3490139 3489081 putative secreted protein PF07602: Protein of unknown function (DUF1565) 8.73 37011 K miscellaneous 4.7 BAC70555.1 Signal peptide CDS SAVERM_2845 3491017 3490385 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.65 21960 K regulation 3.5.2 BAC70556.1 Non-secretory protein CDS SAVERM_2846 3491694 3491014 hypothetical protein 10.53 25704 K similar to unknown proteins 5 BAC70557.1 Non-secretory protein CDS SAVERM_2847 3492443 3491691 hypothetical protein 10.84 28207 K similar to unknown proteins 5 BAC70558.1 Non-secretory protein CDS SAVERM_2848 3492902 3492609 hypothetical protein PF01910: Domain of unknown function DUF77 4.84 10416 K similar to unknown proteins 5 BAC70559.1 Non-secretory protein CDS SAVERM_2849 3493243 3492899 hypothetical protein 10.65 12809 K similar to unknown proteins 5 BAC70560.1 Non-secretory protein CDS SAVERM_2850 3493420 3494052 hypothetical protein PF01987: Protein of unknown function DUF124 6.53 22234 K similar to unknown proteins 5 BAC70561.1 Non-secretory protein CDS SAVERM_2851 3494045 3494704 hypothetical protein PF01987: Protein of unknown function DUF124 6.72 23181 K similar to unknown proteins 5 BAC70562.1 Non-secretory protein CDS SAVERM_2852 3494701 3495498 hypothetical protein PF01987: Protein of unknown function DUF124 6.16 28040 K similar to unknown proteins 5 BAC70563.1 Non-secretory protein CDS SAVERM_2853 3495591 3496067 putative MarR-family transcriptional regulator PF01047: MarR family 6.96 18359 K regulation 3.5.2 BAC70564.1 Non-secretory protein CDS SAVERM_2854 3497429 3496431 hypothetical protein PF07690: Major Facilitator Superfamily 11.71 33437 K similar to unknown proteins 5 BAC70565.1 Non-secretory protein CDS SAVERM_2855 3498568 3497612 argK2 putative lysine arginine ornithine transport system kinase PF03308: ArgK protein 5.46 33286 K transport / binding proteins & lipoproteins 1.2 BAC70566.1 Non-secretory protein CDS SAVERM_2856 3499841 3498639 fadA1 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF00108: Thiolase, N-terminal domain 5.93 40943 K metabolism of lipids 2.4 BAC70567.1 Non-secretory protein CDS SAVERM_2857 3499939 3500430 mceE putative methylmalonyl-CoA epimerase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.07 18199 K similar to unknown proteins 5 BAC70568.1 Non-secretory protein CDS SAVERM_2858 3500758 3504534 putative M protein PF02370: M protein repeat 4.63 138193 K miscellaneous 4.7 BAC70569.1 Non-secretory protein CDS SAVERM_2859 3504717 3505655 abpS putative cellulose-binding protein PF06519: TolA protein 5.02 34831 K specific pathways 2.1.1 BAC70570.1 Non-secretory protein CDS SAVERM_2860 3505744 3506694 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.97 34120 K transport / binding proteins & lipoproteins 1.2 BAC70571.1 Non-secretory protein CDS SAVERM_2861 3506697 3507467 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.62 27037 K transport / binding proteins & lipoproteins 1.2 BAC70572.1 Non-secretory protein CDS SAVERM_2862 3507648 3508979 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10.48 46689 K transport / binding proteins & lipoproteins 1.2 BAC70573.1 Non-secretory protein CDS SAVERM_2863 3509005 3509874 putative ABC transporter permease protein PF01061: ABC-2 type transporter 6.94 30040 K transport / binding proteins & lipoproteins 1.2 BAC70574.1 Non-secretory protein CDS SAVERM_2864 3510236 3509904 putative ATP/GTP-binding protein 10.82 12325 K miscellaneous 4.7 BAC70575.1 Non-secretory protein CDS SAVERM_2865 3510457 3511485 putative luciferase-family protein PF00296: Luciferase-like monooxygenase 6.51 36108 K miscellaneous 4.7 BAC70576.1 Non-secretory protein CDS SAVERM_2866 3511974 3511582 hypothetical protein 4.69 14389 K similar to unknown proteins 5 BAC70577.1 Non-secretory protein CDS SAVERM_2867 3512218 3512889 hypothetical protein PF01939: Protein of unknown function DUF91 5.17 24651 K similar to unknown proteins 5 BAC70578.1 Non-secretory protein CDS SAVERM_2868 3515560 3513017 hypothetical protein PF05729: NACHT domain 4.46 87096 K similar to unknown proteins 5 BAC70579.1 Non-secretory protein CDS SAVERM_2869 3516287 3515964 putative anti-sigma factor antagonist PF01740: STAS domain 7.74 11545 K regulation 3.5.2 BAC70580.1 Non-secretory protein CDS SAVERM_2870 3517281 3516433 fadC3 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 4.84 30023 K metabolism of lipids 2.4 BAC70581.1 Non-secretory protein CDS SAVERM_2871 3518090 3517449 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.66 23487 K regulation 3.5.2 BAC70582.1 Non-secretory protein CDS SAVERM_2872 3518171 3518953 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.68 27504 K transport / binding proteins & lipoproteins 1.2 BAC70583.1 Non-secretory protein CDS SAVERM_2873 3518985 3519734 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.1 27077 K transport / binding proteins & lipoproteins 1.2 BAC70584.1 Non-secretory protein CDS SAVERM_2874 3519748 3520320 putative cobalamin adenosyltransferase PF01923: Cobalamin adenosyltransferase 4.53 20611 K metabolism of coenzymes & prosthetic groups 2.5 BAC70585.1 Non-secretory protein CDS SAVERM_2875 3520940 3520317 putative membrane protein 11.11 23035 K miscellaneous 4.7 BAC70586.1 Non-secretory protein CDS SAVERM_2876 3521015 3522199 chiS putative two-component system sensor kinase PF07730: Histidine kinase 7.18 40929 K sensors 1.3 BAC70587.1 Non-secretory protein CDS SAVERM_2877 3522196 3522837 chiR putative two-component system response regulator PF00072: Response regulator receiver domain 5.16 22967 K regulation 3.5.2 BAC70588.1 Non-secretory protein CDS SAVERM_2878 3522979 3524802 chiC1 putative secreted chitinase C precursor PF00704: Glycosyl hydrolases family 18 5.1 62627 K specific pathways 2.1.1 BAC70589.1 Signal peptide CDS SAVERM_2879 3525327 3524875 putative membrane protein 8.48 16593 K miscellaneous 4.7 BAC70590.1 Non-secretory protein CDS SAVERM_2880 3525834 3525460 atpC putative F-type proton-transporting ATPase epsilon chain PF02823: ATP synthase, Delta/Epsilon chain, beta-sandwich domain 4.54 13128 K membrane bioenergetics 1.4 BAC70591.1 Non-secretory protein CDS SAVERM_2881 3527381 3525945 atpD putative F-type proton-transporting ATPase beta chain PF00006: ATP synthase alpha/beta family, nucleotide-binding domain 4.54 52173 K membrane bioenergetics 1.4 BAC70592.1 Non-secretory protein CDS SAVERM_2882 3528298 3527381 atpG putative F-type proton-transporting ATPase gamma chain PF00231: ATP synthase 6.55 32962 K membrane bioenergetics 1.4 BAC70593.1 Non-secretory protein CDS SAVERM_2883 3529909 3528320 atpA putative F-type proton-transporting ATPase alpha chain PF00006: ATP synthase alpha/beta family, nucleotide-binding domain 4.79 57265 K membrane bioenergetics 1.4 BAC70594.1 Non-secretory protein CDS SAVERM_2884 3530860 3530039 atpH putative F-type proton-transporting ATPase delta chain PF00213: ATP synthase delta (OSCP) subunit 5.09 29171 K membrane bioenergetics 1.4 BAC70595.1 Non-secretory protein CDS SAVERM_2885 3531399 3530857 atpF putative F-type proton-transporting ATPase b chain PF00430: ATP synthase B/B' CF(0) 4.62 19781 K membrane bioenergetics 1.4 BAC70596.1 Non-secretory protein CDS SAVERM_2886 3531681 3531439 atpE putative F-type proton-transporting ATPase c chain PF00137: ATP synthase subunit C 6.35 8011 K membrane bioenergetics 1.4 BAC70597.1 Non-secretory protein CDS SAVERM_2887 3532559 3531750 atpB putative F-type proton-transporting ATPase a chain PF00119: ATP synthase A chain 8.09 30118 K membrane bioenergetics 1.4 BAC70598.1 Non-secretory protein CDS SAVERM_2888 3533195 3532782 atpI putative ATP synthase protein I PF06942: GlpM protein 10.57 14413 K membrane bioenergetics 1.4 BAC70599.1 Non-secretory protein CDS SAVERM_2889 3534304 3533486 fadC4 putative 3-hydroxyacyl-CoA dehydrogenase PF00725: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 6.37 29118 K metabolism of lipids 2.4 BAC70600.1 Non-secretory protein CDS SAVERM_2890 3535877 3534525 ccrA1 crotonyl-CoA reductase concerning oligomycin biosynthesis, PF00107: Zinc-binding dehydrogenase 7.55 48518 K metabolism of lipids 2.4 BAC70601.1 Non-secretory protein CDS SAVERM_2891 3536521 3536018 hypothetical protein 4.36 19237 K similar to unknown proteins 5 BAC70602.1 Non-secretory protein CDS SAVERM_2892 3536766 3548678 olmA4 modular polyketide synthase oligomycin gene cluster 4.75 412666 K antibiotic production 4.3 BAC70603.1 Non-secretory protein CDS SAVERM_2893 3548827 3554550 olmA5 modular polyketide synthase oligomycin gene cluster 4.77 198987 K antibiotic production 4.3 BAC70604.1 Non-secretory protein CDS SAVERM_2894 3554746 3555960 olmB cytochrome P450 hydroxylase CYP107W1, oligomycin gene cluster 4.58 43984 K metabolism of coenzymes & prosthetic groups 2.5 BAC70605.1 Non-secretory protein CDS SAVERM_2895 3567272 3556431 olmA7 modular polyketide synthase oligomycin gene cluster 4.66 379243 K antibiotic production 4.3 BAC70606.1 Non-secretory protein CDS SAVERM_2896 3581388 3567331 olmA6 modular polyketide synthase oligomycin gene cluster 4.48 489366 K antibiotic production 4.3 BAC70607.1 Non-secretory protein CDS SAVERM_2897 3593353 3581534 olmA3 modular polyketide synthase oligomycin gene cluster 4.81 410491 K antibiotic production 4.3 BAC70608.1 Non-secretory protein CDS SAVERM_2898 3607881 3593359 olmA2 modular polyketide synthase oligomycin gene cluster 4.82 504338 K antibiotic production 4.3 BAC70609.1 Non-secretory protein CDS SAVERM_2899 3626347 3607907 olmA1 modular polyketide synthase oligomycin gene cluster 4.83 637483 K antibiotic production 4.3 BAC70610.1 Non-secretory protein CDS SAVERM_2900 3626872 3626534 putative P450-like protein probably pseudogene 4.89 12247 K metabolism of coenzymes & prosthetic groups 2.5 BAC70611.1 Non-secretory protein CDS SAVERM_2901 3630147 3627319 olmRII LuxR-family transcriptional regulator oligomycin gene cluster, PF00196: Bacterial regulatory proteins, luxR family 8.03 98595 K regulation 3.5.2 BAC70612.1 Non-secretory protein CDS SAVERM_2902 3633162 3630367 olmRI LuxR-family transcriptional regulator oligomycin gene cluster, PF00196: Bacterial regulatory proteins, luxR family 8.49 101145 K regulation 3.5.2 BAC70613.1 Non-secretory protein CDS SAVERM_2903 3634592 3633834 olmC thioesterase oligomycin gene cluster 6.8 27478 K antibiotic production 4.3 BAC70614.1 Non-secretory protein CDS SAVERM_2904 3634930 3635895 putative phosphoesterase (SimX4 homolog) PF00149: Calcineurin-like phosphoesterase 7.18 35715 K miscellaneous 4.7 BAC70615.1 Non-secretory protein CDS SAVERM_2905 3635892 3636674 pptA1 putative 4’-phosphopantetheinyl transferase PF01648: 4'-phosphopantetheinyl transferase superfamily 10.26 28002 K metabolism of lipids 2.4 BAC70616.1 Non-secretory protein CDS SAVERM_2906 3636671 3637804 mcmA1 putative methylmalonyl-CoA mutase, alpha subunit PF01642: Methylmalonyl-CoA mutase 9.98 40285 K specific pathways 2.1.1 BAC70617.1 Non-secretory protein CDS SAVERM_2907 3639336 3637912 tagO putative teichoic acid linkage unit synthesis (synthesis of undecaprenylpyrophosphate-N-acetylglucosamine), secreted PF00953: Glycosyl transferase 8.36 50776 K cell wall 1.1 BAC70618.1 Non-secretory protein CDS SAVERM_2908 3640735 3639464 glyA2 putative serine hydroxymethyltransferase PF00464: Serine hydroxymethyltransferase 6.39 44072 K metabolism of amino acids & related molecules 2.2 BAC70619.1 Non-secretory protein CDS SAVERM_2909 3641545 3640880 ptpB3 putative low molecular weight protein tyrosine phosphatase PF01451: Low molecular weight phosphotyrosine protein phosphatase 5.28 23310 K protein modification 3.8 BAC70620.1 Non-secretory protein CDS SAVERM_2910 3642189 3641542 hypothetical protein PF01300: yrdC domain 4.35 22676 K similar to unknown proteins 5 BAC70621.1 Non-secretory protein CDS SAVERM_2911 3643123 3642242 hemK putative modification methyltransferase PF01170: Putative RNA methylase family UPF0020 4.83 32512 K miscellaneous 4.7 BAC70622.1 Non-secretory protein CDS SAVERM_2912 3644246 3643170 prfA putative peptide chain release factor 1 PF00472: Peptidyl-tRNA hydrolase domain 4.8 39503 K termination 3.7.5 BAC70623.1 Non-secretory protein CDS SAVERM_2913 3644642 3644421 rpmE2 putative ribosomal protein L31 PF01197: Ribosomal protein L31 9.41 7974 K ribosomal protein 3.7.1 BAC70624.1 Non-secretory protein CDS SAVERM_2914 3645978 3644839 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 10.27 39839 K regulation 3.5.2 BAC70625.1 Non-secretory protein CDS SAVERM_2915 3648401 3646335 rho1 putative transcription termination factor Rho PF00006: ATP synthase alpha/beta family, nucleotide-binding domain 9.51 74323 K DNA termination 3.5.4 BAC70626.1 Non-secretory protein CDS SAVERM_2916 3649738 3648821 thrB putative homoserine kinase PF00288: GHMP kinases N terminal domain 5.4 31358 K metabolism of amino acids & related molecules 2.2 BAC70627.1 Non-secretory protein CDS SAVERM_2917 3651134 3650076 thrC1 putative threonine synthase PF00291: Pyridoxal-phosphate dependent enzyme 6.06 36910 K metabolism of amino acids & related molecules 2.2 BAC70628.1 Non-secretory protein CDS SAVERM_2918 3652430 3651141 thrA putative homoserine dehydrogenase PF00742: Homoserine dehydrogenase 5.05 44182 K metabolism of amino acids & related molecules 2.2 BAC70629.1 Non-secretory protein CDS SAVERM_2919 3653978 3652587 lysA1 putative diaminopimelate decarboxylase PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain 5.16 49886 K metabolism of amino acids & related molecules 2.2 BAC70630.1 Non-secretory protein CDS SAVERM_2920 3655060 3654002 argS1 putative arginyl-tRNA synthetase PF05746: DALR anticodon binding domain 7.22 36746 K aminoacyl-tRNA-synthetase 3.7.2 BAC70631.1 Non-secretory protein CDS SAVERM_2921 3655813 3655220 putative two-component system response regulator PF00072: Response regulator receiver domain 4.78 20645 K regulation 3.5.2 BAC70632.1 Non-secretory protein CDS SAVERM_2922 3657742 3656330 putative integrin-like protein PF01839: FG-GAP repeat 4.18 47477 K similar to unknown proteins 5 BAC70633.1 Signal peptide CDS SAVERM_2923 3659339 3657810 putative integrin-like protein PF01839: FG-GAP repeat 4.46 51369 K similar to unknown proteins 5 BAC70634.1 Signal peptide CDS SAVERM_2924 3659419 3659685 hypothetical protein 11.71 10102 K no similarity 6 BAC70635.1 Non-secretory protein CDS SAVERM_2925 3664023 3662215 hypothetical protein 5.4 68289 N no similarity 6 BAC70636.1 Non-secretory protein CDS SAVERM_2926 3666734 3664680 hypothetical protein PF02463: RecF/RecN/SMC N terminal domain 5.68 77780 N similar to unknown proteins 5 BAC70637.1 Non-secretory protein CDS SAVERM_2927 3666895 3666731 hypothetical protein 10.2 5986 N no similarity 6 BAC70638.1 Non-secretory protein CDS SAVERM_2928 3669067 3666923 putative DNA repair helicase PF04851: Type III restriction enzyme, res subunit 6.48 79807 N DNA modification & repair 3.2 BAC70639.1 Non-secretory protein CDS SAVERM_2929 3672861 3672466 dndE putative DNA modification (phosphoribosylaminoimidazole carboxylase) PF08870: Domain of unknown function 8.22 14733 N similar to unknown proteins 5 BAC70640.1 Non-secretory protein CDS SAVERM_2930 3674863 3672836 dndD putative DNA modification (ATPase) PF02463: RecF/RecN/SMC N terminal domain 6.15 76302 N similar to unknown proteins 5 BAC70641.1 Non-secretory protein CDS SAVERM_2931 3676427 3674850 dndC putative DNA modification (sulfurtransferase) PF01507: Phosphoadenosine phosphosulfate reductase family 4.77 59936 N similar to unknown proteins 5 BAC70642.1 Non-secretory protein CDS SAVERM_2932 3677443 3676424 dndB putative DNA modification (ATPase) PF00695: POLO box duplicated 8.25 38304 N similar to unknown proteins 5 BAC70643.1 Non-secretory protein CDS SAVERM_2933 3677808 3678962 dndA putative DNA modification (L-cysteine desulfurase: pyridoxal phosphate-dependent IscS-family, PF00266: Aminotransferase class-V 6.81 41683 N metabolism of amino acids & related molecules 2.2 BAC70644.1 Non-secretory protein CDS SAVERM_2934 3680404 3678968 hypothetical protein PF08241: Methyltransferase domain 9.42 54164 N similar to unknown proteins 5 BAC70645.1 Non-secretory protein CDS SAVERM_2935 3683155 3683652 hypothetical protein 9.79 18298 N no similarity 6 BAC70646.1 Non-secretory protein CDS SAVERM_2936 3684662 3683691 int5 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 6.97 35753 N phage-related functions 4.4 BAC70647.1 Non-secretory protein CDS SAVERM_2937 3684981 3684643 int6 putative recombinase/integrase 10.22 12907 N phage-related functions 4.4 BAC70648.1 Non-secretory protein CDS SAVERM_2938 3685857 3685159 repSA3 putative replication initiation protein 6.73 25481 N DNA replication 3.1 BAC70649.1 Non-secretory protein CDS SAVERM_2939 3686846 3686010 putative snapalysin (secreted metalloprotease) PF02031: Streptomyces extracellular neutral proteinase (M7) family 5.93 28113 N protein modification 3.8 BAC70650.1 Signal peptide CDS SAVERM_2940 3688159 3687593 hypothetical protein 4.78 20083 N no similarity 6 BAC70651.1 Non-secretory protein CDS SAVERM_2941 3689026 3689523 hypothetical protein PF11697: Protein of unknown function (DUF3293) 5.62 17746 N no similarity 6 BAC70652.1 Non-secretory protein CDS SAVERM_2942 3689583 3689798 hypothetical protein 9.97 7930 N no similarity 6 BAC70653.1 Non-secretory protein CDS SAVERM_2943 3691580 3689937 hypothetical protein 10.33 60350 N no similarity 6 BAC70654.1 Non-secretory protein CDS SAVERM_2944 3692368 3693618 fabB2 putative 3-oxoacyl-ACP synthase II PF00109: Beta-ketoacyl synthase, N-terminal domain 6.68 42221 N metabolism of lipids 2.4 BAC70655.1 Non-secretory protein CDS SAVERM_2945 3694849 3693749 ku1 putative Ku70/Ku80 protein probably involving non-homologous end-joining, PF02735: Ku70/Ku80 beta-barrel domain 10.14 39584 N DNA modification & repair 3.2 BAC70656.1 Non-secretory protein CDS SAVERM_2946 3694892 3695773 ligD putative DNA ligase ATP-dependent DNA ligase 6.42 31945 N DNA replication 3.1 BAC70657.1 Non-secretory protein CDS SAVERM_2947 3696658 3695855 hypothetical protein 7.89 29103 N similar to unknown proteins 5 BAC70658.1 Non-secretory protein CDS SAVERM_2948 3696783 3697262 ptpA3 putative conventional protein tyrosine phosphatase PF00782: Dual specificity phosphatase, catalytic domain 6.3 17591 N protein modification 3.8 BAC70659.1 Non-secretory protein CDS SAVERM_2949 3697443 3698333 putative lipoprotein PF03790: KNOX1 domain 9.83 31023 N transport / binding proteins & lipoproteins 1.2 BAC70660.1 Non-secretory protein CDS SAVERM_2950 3698330 3699625 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.11 45787 N sensors 1.3 BAC70661.1 Non-secretory protein CDS SAVERM_2951 3699662 3701029 ftsW4 putative cell division membrane protein PF01098: Cell cycle protein 10.27 47896 N cell division 1.7 BAC70662.1 Non-secretory protein CDS SAVERM_2952 3701049 3702506 pbp1 putative penicillin-binding protein, secreted PF00905: Penicillin binding protein transpeptidase domain 8.7 50643 N cell wall 1.1 BAC70663.1 Signal peptide CDS SAVERM_2953 3703688 3702582 hypothetical protein PF11583: P-aminobenzoate N-oxygenase AurF 4.58 42377 N similar to unknown proteins 5 BAC70664.1 Non-secretory protein CDS SAVERM_2954 3703839 3704774 hypothetical protein PF11583: P-aminobenzoate N-oxygenase AurF 7.04 35638 N similar to unknown proteins 5 BAC70665.1 Non-secretory protein CDS SAVERM_2955 3705104 3705829 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.82 26396 N regulation 3.5.2 BAC70666.1 Non-secretory protein CDS SAVERM_2956 3705840 3706205 hypothetical protein 8.9 12829 N similar to unknown proteins 5 BAC70667.1 Non-secretory protein CDS SAVERM_2957 3706309 3707724 putative NLP/P60-family secreted protein (PgpA peptidase) PF00877: NlpC/P60 family 10.49 50171 N miscellaneous 4.7 BAC70668.1 Signal peptide CDS SAVERM_2958 3708982 3707729 putative oxygenase subunit PF01266: FAD dependent oxidoreductase 4.85 45012 N miscellaneous 4.7 BAC70669.1 Non-secretory protein CDS SAVERM_2959 3709636 3709010 cvnD8 putative ATP/GTP-binding protein multi-component regulatory system-8 4.07 22762 N miscellaneous 4.7 BAC70670.1 Non-secretory protein CDS SAVERM_2960 3710033 3709617 cvnC8 hypothetical protein multi-component regulatory system-8, PF05331: Protein of unknown function (DUF742) 11.94 15112 N similar to unknown proteins 5 BAC70671.1 Non-secretory protein CDS SAVERM_2961 3710455 3710030 cvnB8 hypothetical protein multi-component regulatory system-8, PF03259: Roadblock/LC7 domain 5.57 14352 N similar to unknown proteins 5 BAC70672.1 Non-secretory protein CDS SAVERM_2962 3713454 3710530 cvnA8 putative sensor-like histidine kinase multi-component regulatory system-8 4.85 102375 N sensors 1.3 BAC70673.1 Non-secretory protein CDS SAVERM_2963 3713815 3714603 hypothetical protein 5.66 28164 N similar to unknown proteins 5 BAC70674.1 Non-secretory protein CDS SAVERM_2964 3715434 3714919 putative MarR-family transcriptional regulator PF01047: MarR family 9.71 19000 N regulation 3.5.2 BAC70675.1 Non-secretory protein CDS SAVERM_2965 3715703 3716521 putative lysozyme precursor PF01183: Glycosyl hydrolases family 25 7.68 29146 N cell wall 1.1 BAC70676.1 Signal peptide CDS SAVERM_2966 3719048 3716613 lonA putative lon class III heat-shock ATP-dependent protease PF05362: Lon protease (S16) C-terminal proteolytic domain 4.74 87015 N adaptation to atypical conditions 4.1 BAC70677.1 Non-secretory protein CDS SAVERM_2967 3719100 3719969 hypothetical protein PF00583: Acetyltransferase (GNAT) family 10.06 30376 N no similarity 6 BAC70678.1 Non-secretory protein CDS SAVERM_2968 3721011 3720061 hypothetical protein 8.14 32817 N similar to unknown proteins 5 BAC70679.1 Non-secretory protein CDS SAVERM_2969 3721098 3721775 hypothetical protein PF01564: Spermine/spermidine synthase 4.63 23988 N similar to unknown proteins 5 BAC70680.1 Non-secretory protein CDS SAVERM_2970 3721889 3722626 putative two-component system response regulator PF00072: Response regulator receiver domain 5.91 26915 N regulation 3.5.2 BAC70681.1 Non-secretory protein CDS SAVERM_2971 3722623 3723729 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.98 39934 N sensors 1.3 BAC70682.1 Non-secretory protein CDS SAVERM_2972 3724011 3727841 sucA putative 2-oxoglutarate dehydrogenase PF02779: Transketolase, pyridine binding domain 6.08 139177 N TCA cycle 2.1.3 BAC70683.1 Non-secretory protein CDS SAVERM_2973 3731909 3727917 putative ATP/GTP-binding protein PF07721: Tetratricopeptide repeat 5.26 145612 N miscellaneous 4.7 BAC70684.1 Non-secretory protein CDS SAVERM_2974 3732001 3732165 putative secreted protein 12.1 5759 N no similarity 6 BAC70685.1 Non-secretory protein CDS SAVERM_2975 3732202 3732525 hypothetical protein 4.17 12015 N similar to unknown proteins 5 BAC70686.1 Non-secretory protein CDS SAVERM_2976 3732823 3733992 hypothetical protein 4.9 41135 N similar to unknown proteins 5 BAC70687.1 Non-secretory protein CDS SAVERM_2977 3733994 3735070 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6.17 40270 N regulation 3.5.2 BAC70688.1 Non-secretory protein CDS SAVERM_2978 3735885 3735319 hypothetical protein PF02861: Clp amino terminal domain 8.54 19776 N similar to unknown proteins 5 BAC70689.1 Non-secretory protein CDS SAVERM_2979 3736094 3735885 hypothetical protein PF08281: Sigma-70, region 4 10.79 7800 N no similarity 6 BAC70690.1 Non-secretory protein CDS SAVERM_2980 3737229 3736264 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 5.45 34241 N miscellaneous 4.7 BAC70691.1 Non-secretory protein CDS SAVERM_2981 3738724 3737501 maeB1 putative malate dehydrogenase (oxaloacetate-decarboxylating; NADP-requiring) malS3, PF03949: Malic enzyme, NAD binding domain 4.5 41961 N TCA cycle 2.1.3 BAC70692.1 Non-secretory protein CDS SAVERM_2982 3739316 3740275 aotJ putative arginine/ornithine ABC transporter substrate-binding protein gltI, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.01 33335 N transport / binding proteins & lipoproteins 1.2 BAC70693.1 Signal peptide CDS SAVERM_2983 3740309 3741247 aotM putative arginine/ornithine ABC transport permease gltK, PF00528: Binding-protein-dependent transport system inner membrane component 9.56 34315 N transport / binding proteins & lipoproteins 1.2 BAC70694.1 Non-secretory protein CDS SAVERM_2984 3741244 3742035 aotP putative arginine/ornithine ABC transport ATP-binding protein gltL, PF00005: ABC transporter 6.8 28742 N transport / binding proteins & lipoproteins 1.2 BAC70695.1 Non-secretory protein CDS SAVERM_2985 3742949 3742164 metZ putative methyltransferase PF07021: Methionine biosynthesis protein MetW 4.51 29079 N miscellaneous 4.7 BAC70696.1 Non-secretory protein CDS SAVERM_2986 3743033 3743662 hypothetical protein PF07336: Protein of unknown function (DUF1470) 6.51 22796 N similar to unknown proteins 5 BAC70697.1 Non-secretory protein CDS SAVERM_2987 3744000 3743566 putative signal peptidase protein PF00717: Peptidase S24-like 11.25 16149 N protein secretion 1.6 BAC70698.1 Non-secretory protein CDS SAVERM_2988 3744146 3744541 sodN putative superoxide dismutase Ni-containing superoxide dismutase 8.24 14686 N detoxification 4.2 BAC70699.1 Non-secretory protein CDS SAVERM_2989 3745360 3744875 ptlR putative MarR-family transcriptional regulator PF01047: MarR family, neopentalenolactone resistance gene 5.33 17902 N regulation 3.5.2 BAC70700.1 Non-secretory protein CDS SAVERM_2990 3745497 3746501 gap1 glyceraldehyde-3-phosphate dehydrogenase (insensitive to pentalenolactone) ptlK, neopentalenolactone resistance gene, PF02800: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain 4.75 35004 N main glycolytic pathways 2.1.2 BAC70701.1 Non-secretory protein CDS SAVERM_2991 3746862 3747719 ptlH 1-deoxypentalenic acid 11-beta hydroxylase; Fe(II)/alpha-ketoglutarate dependent hydroxylase neopentalenolactone gene cluster, PF05721: Phytanoyl-CoA dioxygenase (PhyH) 5.68 32264 N antibiotic production 4.3 BAC70702.1 Non-secretory protein CDS SAVERM_2992 3747777 3749231 ptlG putative transmembrane efflux protein neopentalenolactone gene cluster, PF07690: Major Facilitator Superfamily 9.97 49751 N transport / binding proteins & lipoproteins 1.2 BAC70703.1 Non-secretory protein CDS SAVERM_2993 3749307 3750119 ptlF 1-deoxy-11beta-hydroxypentalenic acid dehydrogenase neopentalenolactone gene cluster, PF00106: short chain dehydrogenase 5.24 28160 N antibiotic production 4.3 BAC70704.1 Non-secretory protein CDS SAVERM_2994 3750177 3751961 ptlE Baeyer-Villiger monooxygenase pentalenolactone gene cluster, PF00743: Flavin-binding monooxygenase-like 5.65 65925 N antibiotic production 4.3 BAC70705.1 Non-secretory protein CDS SAVERM_2995 3751962 3752882 ptlD putative dioxygenase neopentalenolactone gene cluster, PF02668: Taurine catabolism dioxygenase TauD, TfdA family 4.99 34236 N antibiotic production 4.3 BAC70706.1 Non-secretory protein CDS SAVERM_2996 3752934 3753110 ptlC hypothetical protein neopentalenolactone gene cluster 7.81 5773 N no similarity 6 BAC70707.1 Non-secretory protein CDS SAVERM_2997 3753107 3754120 ptlB farnesyl diphosphate synthase idsA2, neopentalenolactone gene cluster, PF00348: Polyprenyl synthetase 4.88 35169 N antibiotic production 4.3 BAC70708.1 Non-secretory protein CDS SAVERM_2998 3754725 3755735 ptlA pentalenene synthase neopentalenolactone gene cluster, PF03936: Terpene synthase family, metal binding domain 5.78 37897 N antibiotic production 4.3 BAC70709.1 Non-secretory protein CDS SAVERM_2999 3755792 3757141 ptlI pentalenene C13 hydroxylase; cytochrome P450 cyp13, CYP183A1, neopentalenolactone gene cluster 7.5 50756 N metabolism of coenzymes & prosthetic groups 2.5 BAC70710.1 Non-secretory protein CDS SAVERM_3000 3757201 3757662 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 10.56 16874 N regulation 3.5.2 BAC70711.1 Non-secretory protein CDS SAVERM_3001 3757659 3758093 putative lyase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.14 15717 N miscellaneous 4.7 BAC70712.1 Non-secretory protein CDS SAVERM_3002 3758163 3758933 hypothetical protein 5.61 27391 N similar to unknown proteins 5 BAC70713.1 Non-secretory protein CDS SAVERM_3003 3759571 3759224 hypothetical protein PF06108: Protein of unknown function (DUF952) 4.57 12385 N similar to unknown proteins 5 BAC70714.1 Non-secretory protein CDS SAVERM_3004 3759882 3759667 hypothetical protein 8.33 7181 N similar to unknown proteins 5 BAC70715.1 Non-secretory protein CDS SAVERM_3005 3760520 3759930 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.1 21567 N miscellaneous 4.7 BAC70716.1 Non-secretory protein CDS SAVERM_3006 3761926 3760742 idsB putative polyprenyl diphosphate synthase probably farnesyl pyrophosphate synthase, PF00348: Polyprenyl synthetase 5.17 40911 N metabolism of coenzymes & prosthetic groups 2.5 BAC70717.1 Non-secretory protein CDS SAVERM_3007 3763469 3762063 eshA putative nucleotide-binding protein PF00027: Cyclic nucleotide-binding domain 4.8 52136 N sporulation 1.8 BAC70718.1 Non-secretory protein CDS SAVERM_3008 3764080 3764757 hypothetical protein PF01510: N-acetylmuramoyl-L-alanine amidase 6.75 24807 N similar to unknown proteins 5 BAC70719.1 Non-secretory protein CDS SAVERM_3009 3764786 3765721 putative 1-aminocyclopropane-1-carboxylate deaminase PF00291: Pyridoxal-phosphate dependent enzyme 9.92 32699 N metabolism of amino acids & related molecules 2.2 BAC70720.1 Non-secretory protein CDS SAVERM_3010 3767329 3765728 putative sodium/proton antiporter PF00999: Sodium/hydrogen exchanger family 7.87 57525 N transport / binding proteins & lipoproteins 1.2 BAC70721.1 Non-secretory protein CDS SAVERM_3011 3767391 3767651 hypothetical protein PF02148: Zn-finger in ubiquitin-hydrolases and other protein 6.58 9664 N similar to unknown proteins 5 BAC70722.1 Non-secretory protein CDS SAVERM_3012 3767924 3768337 rsbW1 putative anti-sigma factor 4.19 14261 N regulation 3.5.2 BAC70723.1 Non-secretory protein CDS SAVERM_3013 3768334 3769509 sig21 putative RNA polymerase sigma factor, sigH similar to SCO5243, RNA polymerase alternative sigma factor, PF04542: Sigma-70 region 2 4.89 42622 N RNA initiation 3.5.1 BAC70724.1 Non-secretory protein CDS SAVERM_3014 3770036 3769563 putative integral membrane protein 9.14 16029 N miscellaneous 4.7 BAC70725.1 Non-secretory protein CDS SAVERM_3015 3770150 3771118 hypothetical protein PF00781: Diacylglycerol kinase catalytic domain (presumed) 8.54 34679 N similar to unknown proteins 5 BAC70726.1 Non-secretory protein CDS SAVERM_3016 3771438 3771695 wblE putative WhiB-family transcriptional regulator; putative role in cell cycle control PF02467: Transcription factor WhiB 7.13 9671 N regulation 3.5.2 BAC70727.1 Non-secretory protein CDS SAVERM_3017 3773449 3771944 putative two-component system sensor kinase PF07730: Histidine kinase 5.13 55002 N sensors 1.3 BAC70728.1 Non-secretory protein CDS SAVERM_3018 3773972 3774757 gamA putative glucosamine-6-phosphate isomerase PF01182: Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 4.69 27334 N specific pathways 2.1.1 BAC70729.1 Non-secretory protein CDS SAVERM_3019 3776454 3774850 nagZ1 putative beta-N-acetylhexosaminidase PF00933: Glycosyl hydrolase family 3 N terminal domain 5.02 54223 N cell wall 1.1 BAC70730.1 Non-secretory protein CDS SAVERM_3020 3777305 3776463 dasC1 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.97 30455 N transport / binding proteins & lipoproteins 1.2 BAC70731.1 Non-secretory protein CDS SAVERM_3021 3778291 3777302 dasB1 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.41 35595 N transport / binding proteins & lipoproteins 1.2 BAC70732.1 Non-secretory protein CDS SAVERM_3022 3779726 3778407 dasA1 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.66 46578 N transport / binding proteins & lipoproteins 1.2 BAC70733.1 Non-secretory protein CDS SAVERM_3023 3780104 3780868 dasR putative GntR-family transcriptional regulator PF07702: UTRA domain 9.17 28226 N regulation 3.5.2 BAC70734.1 Non-secretory protein CDS SAVERM_3024 3781105 3781359 hypothetical protein PF11755: Protein of unknown function (DUF3311) 9.11 9579 N similar to unknown proteins 5 BAC70735.1 Non-secretory protein CDS SAVERM_3025 3781368 3782984 putative sodium/proline symporter PF00474: Sodium:solute symporter family 8.9 57116 N transport / binding proteins & lipoproteins 1.2 BAC70736.1 Signal peptide CDS SAVERM_3026 3783420 3785801 nrdL putative ribonucleoside-diphosphate reductase alpha chain PF02867: Ribonucleotide reductase, barrel domain 5.23 87133 N metabolism of nucleotides & nucleic acids 2.3 BAC70737.1 Non-secretory protein CDS SAVERM_3027 3785798 3786814 nrdM putative ribonucleoside-diphosphate reductase beta chain PF00268: Ribonucleotide reductase, small chain 4.36 39150 N metabolism of nucleotides & nucleic acids 2.3 BAC70738.1 Non-secretory protein CDS SAVERM_3028 3786909 3787418 hypothetical protein 9.24 17035 N no similarity 6 BAC70739.1 Non-secretory protein CDS SAVERM_3029 3787609 3787379 hypothetical protein 11.72 8169 N no similarity 6 BAC70740.1 Non-secretory protein CDS SAVERM_3030 3787680 3788660 bdpB putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.44 35654 N regulation 3.5.2 BAC70741.1 Non-secretory protein CDS SAVERM_3031 3790131 3788761 cyp14 epi-isozizaene hydroxylase (cytochrome P450 hydroxylase) CYP170A2, formation of (4R) & (4S)-albaflavenol and albaflavenone 7.43 50842 N metabolism of coenzymes & prosthetic groups 2.5 BAC70742.1 Non-secretory protein CDS SAVERM_3032 3791219 3790128 ezs epi-isozizaene synthase (sesquiterpene cyclase) PF03936: Terpene synthase family, metal binding domain 6.31 41950 N metabolism of coenzymes & prosthetic groups 2.5 BAC70743.1 Non-secretory protein CDS SAVERM_3033 3792201 3791551 def1 putative polypeptide deformylase PF01327: Polypeptide deformylase 4.43 24103 N metabolism of amino acids & related molecules 2.2 BAC70744.1 Non-secretory protein CDS SAVERM_3034 3793255 3792275 hypothetical protein PF07719: Tetratricopeptide repeat 4.68 35695 N similar to unknown proteins 5 BAC70745.1 Non-secretory protein CDS SAVERM_3035 3794725 3793397 putative lipoprotein PF01966: HD domain 8.72 45941 N transport / binding proteins & lipoproteins 1.2 BAC70746.1 Non-secretory protein CDS SAVERM_3036 3796161 3794722 putative secreted protein PF01966: HD domain 10.22 50736 N similar to unknown proteins 5 BAC70747.1 Signal peptide CDS SAVERM_3037 3796648 3796337 rsrA putative anti-sigma factor 4.35 11568 N regulation 3.5.2 BAC70748.1 Non-secretory protein CDS SAVERM_3038 3797328 3796645 sig22 putative RNA polymerase ECF-subfamily sigma factor similar to SCO5126:sigR, PF04542: Sigma-70 region 2 4.82 25171 N RNA initiation 3.5.1 BAC70749.1 Non-secretory protein CDS SAVERM_3039 3798209 3797574 hypothetical protein 8.51 21832 N similar to unknown proteins 5 BAC70750.1 Non-secretory protein CDS SAVERM_3040 3799050 3798211 hypothetical protein PF02586: Uncharacterised ACR, COG2135 4.99 31120 N similar to unknown proteins 5 BAC70751.1 Non-secretory protein CDS SAVERM_3041 3799157 3799888 putative integral membrane protein 9.19 25507 N miscellaneous 4.7 BAC70752.1 Non-secretory protein CDS SAVERM_3042 3800068 3801408 aroA putative 3-phosphoshikimate 1-carboxyvinyltransferase EC:2.5.1.19, PF00275: EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 4.87 46247 N metabolism of amino acids & related molecules 2.2 BAC70753.1 Non-secretory protein CDS SAVERM_3043 3801425 3802435 hypothetical protein PF03193: Protein of unknown function, DUF258 7.94 36827 N similar to unknown proteins 5 BAC70754.1 Non-secretory protein CDS SAVERM_3044 3802556 3802879 sugE putative SMR-type multi-drug efflux transporter PF00893: Small Multidrug Resistance protein 8.77 11141 N transport / binding proteins & lipoproteins 1.2 BAC70755.1 Non-secretory protein CDS SAVERM_3045 3804689 3802902 oppD2 putative peptide ABC transporter ATP-binding protein oppF2, PF00005: ABC transporter 6.6 64783 N transport / binding proteins & lipoproteins 1.2 BAC70756.1 Non-secretory protein CDS SAVERM_3046 3805603 3804695 oppC2 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.85 32455 N transport / binding proteins & lipoproteins 1.2 BAC70757.1 Non-secretory protein CDS SAVERM_3047 3806595 3805600 oppB2 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.41 35815 N transport / binding proteins & lipoproteins 1.2 BAC70758.1 Non-secretory protein CDS SAVERM_3048 3806749 3808437 oppA2 putative peptide ABC transporter substrate-binding protein PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 8.6 61101 N transport / binding proteins & lipoproteins 1.2 BAC70759.1 Signal peptide CDS SAVERM_3049 3809056 3808424 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.79 21896 N regulation 3.5.2 BAC70760.1 Non-secretory protein CDS SAVERM_3050 3809245 3810045 putative fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family PF00459: Inositol monophosphatase family 5.18 28863 N main glycolytic pathways 2.1.2 BAC70761.1 Non-secretory protein CDS SAVERM_3051 3810212 3810604 hypothetical protein PF00571: CBS domain 6.34 13648 N similar to unknown proteins 5 BAC70762.1 Non-secretory protein CDS SAVERM_3052 3812143 3810692 katA1 putative catalase PF00199: Catalase 5.34 54180 N detoxification 4.2 BAC70763.1 Non-secretory protein CDS SAVERM_3053 3812287 3812703 catR putative hydrogen peroxide sensitive repressor PF01475: Ferric uptake regulator family 7.24 15257 N regulation 3.5.2 BAC70764.1 Non-secretory protein CDS SAVERM_3054 3815227 3813377 hypothetical protein PF00515: TPR Domain 5.75 65749 N similar to unknown proteins 5 BAC70765.1 Non-secretory protein CDS SAVERM_3055 3818571 3815575 putative integral membrane protein PF03699: Uncharacterised protein family (UPF0182) 9.04 109307 N miscellaneous 4.7 BAC70766.1 Non-secretory protein CDS SAVERM_3056 3818730 3819278 hypothetical protein 4.18 19475 N similar to unknown proteins 5 BAC70767.1 Non-secretory protein CDS SAVERM_3057 3820524 3819427 putative secreted protein PF00595: PDZ domain (Also known as DHR or GLGF) 5.44 38540 N miscellaneous 4.7 BAC70768.1 Signal peptide CDS SAVERM_3058 3820773 3820609 putative secreted protein 10.23 5716 N no similarity 6 BAC70769.1 Non-secretory protein CDS SAVERM_3059 3821375 3820914 moaE putative molybdopterin biosynthesis protein E PF02391: MoaE protein 4.88 16526 X metabolism of coenzymes & prosthetic groups 2.5 BAC70770.1 Non-secretory protein CDS SAVERM_3060 3822691 3821579 putative secreted protein PF01370: NAD dependent epimerase/dehydratase family 6.43 39263 X similar to unknown proteins 5 BAC70771.1 Non-secretory protein CDS SAVERM_3061 3822882 3824333 hypothetical protein PF10103: Uncharacterised conserved protein (DUF2342) 4.32 50966 X similar to unknown proteins 5 BAC70772.1 Non-secretory protein CDS SAVERM_3062 3824330 3824851 hypothetical protein PF00293: NUDIX domain 4.89 18974 X similar to unknown proteins 5 BAC70773.1 Non-secretory protein CDS SAVERM_3063 3825688 3824933 hypothetical protein PF01987: Protein of unknown function DUF124 5.86 27693 X similar to unknown proteins 5 BAC70774.1 Non-secretory protein CDS SAVERM_3064 3826385 3825705 hypothetical protein PF01987: Protein of unknown function DUF124 7.5 24169 X similar to unknown proteins 5 BAC70775.1 Non-secretory protein CDS SAVERM_3065 3828073 3826397 hypothetical protein PF01987: Protein of unknown function DUF124 5.11 58089 X similar to unknown proteins 5 BAC70776.1 Non-secretory protein CDS SAVERM_3066 3828642 3828199 hypothetical protein PF01863: Protein of unknown function DUF45 8.48 16784 X similar to unknown proteins 5 BAC70777.1 Non-secretory protein CDS SAVERM_3067 3829013 3830236 hypothetical protein PF00899: ThiF family 9.12 42414 X similar to unknown proteins 5 BAC70778.1 Non-secretory protein CDS SAVERM_3068 3830229 3831584 putative ABC transporter ATP-binding protein PF03109: ABC1 family 4.58 49394 X transport / binding proteins & lipoproteins 1.2 BAC70779.1 Non-secretory protein CDS SAVERM_3069 3832180 3831857 hypothetical protein 12.01 12083 X similar to unknown proteins 5 BAC70780.1 Non-secretory protein CDS SAVERM_3070 3832545 3832177 putative WhiB-family transcriptional regulator PF02467: Transcription factor WhiB 4.9 13190 X regulation 3.5.2 BAC70781.1 Non-secretory protein CDS SAVERM_3071 3833069 3832722 hypothetical protein 10.59 12287 X similar to unknown proteins 5 BAC70782.1 Non-secretory protein CDS SAVERM_3072 3835520 3833208 uvrD2 putative ATP-dependent DNA helicase PF00580: UvrD/REP helicase 6.63 83037 X DNA modification & repair 3.2 BAC70783.1 Non-secretory protein CDS SAVERM_3073 3835666 3835908 putative glutaredoxin-like protein PF00462: Glutaredoxin 4.87 8657 X miscellaneous 4.7 BAC70784.1 Non-secretory protein CDS SAVERM_3074 3836977 3836030 hypothetical protein PF00293: NUDIX domain 4.76 34694 X similar to unknown proteins 5 BAC70785.1 Non-secretory protein CDS SAVERM_3075 3838545 3837142 putative peptidase PF01546: Peptidase family M20/M25/M40 4.72 50331 X protein modification 3.8 BAC70786.1 Non-secretory protein CDS SAVERM_3076 3842164 3838556 addB putative ATP-dependent DNA helicase PF00580: UvrD/REP helicase 4.58 130424 X DNA modification & repair 3.2 BAC70787.1 Signal peptide CDS SAVERM_3077 3845605 3842216 addA putative ATP-dependent DNA helicase PF00580: UvrD/REP helicase 6.99 122111 X DNA modification & repair 3.2 BAC70788.1 Non-secretory protein CDS SAVERM_3078 3846345 3845872 hypothetical protein PF01035: 6-O-methylguanine DNA methyltransferase, DNA binding domain 10.22 17655 X similar to unknown proteins 5 BAC70789.1 Non-secretory protein CDS SAVERM_3079 3846424 3849318 putative integral membrane protein PF03706: Uncharacterised protein family (UPF0104) 6.87 103313 X miscellaneous 4.7 BAC70790.1 Non-secretory protein CDS SAVERM_3080 3849387 3850937 putative tripeptidyl-peptidase C, secreted PF00561: alpha/beta hydrolase fold 4.63 54886 X protein modification 3.8 BAC70791.1 Signal peptide CDS SAVERM_3081 3851057 3852610 putative tripeptidyl-peptidase C, secreted PF00561: alpha/beta hydrolase fold 5.36 54767 X protein modification 3.8 BAC70792.1 Signal peptide CDS SAVERM_3082 3853851 3852673 putative ThiF-family protein molybdopterin biosynthesis or thiamine biosynthesis 4.44 42587 X metabolism of coenzymes & prosthetic groups 2.5 BAC70793.1 Non-secretory protein CDS SAVERM_3083 3854664 3853915 hypothetical protein PF12138: Spherulation-specific family 4 6.43 27405 X similar to unknown proteins 5 BAC70794.1 Non-secretory protein CDS SAVERM_3084 3855611 3854652 putative NDP-hexose 4-ketoreductase PF01370: NAD dependent epimerase/dehydratase family 8.14 33018 X miscellaneous 4.7 BAC70795.1 Non-secretory protein CDS SAVERM_3085 3856843 3855812 putative membrane protein 8.51 34948 X miscellaneous 4.7 BAC70796.1 Non-secretory protein CDS SAVERM_3086 3858975 3857047 putative glycosyltransferase PF00534: Glycosyl transferases group 1 5.43 66772 X specific pathways 2.1.1 BAC70797.1 Non-secretory protein CDS SAVERM_3087 3860767 3859166 oppD3 putative peptide ABC transporter ATP-binding protein oppF3, PF00005: ABC transporter 6.26 56774 X transport / binding proteins & lipoproteins 1.2 BAC70798.1 Non-secretory protein CDS SAVERM_3088 3861762 3860764 oppB3 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 6.78 35720 X transport / binding proteins & lipoproteins 1.2 BAC70799.1 Non-secretory protein CDS SAVERM_3089 3862841 3861759 oppC3 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.81 36998 X transport / binding proteins & lipoproteins 1.2 BAC70800.1 Non-secretory protein CDS SAVERM_3090 3864564 3862846 oppA3 putative peptide ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 6.62 61201 X transport / binding proteins & lipoproteins 1.2 BAC70801.1 Signal peptide CDS SAVERM_3091 3866410 3864860 hypothetical protein PF04228: Putative neutral zinc metallopeptidase 9.23 53482 X similar to unknown proteins 5 BAC70802.1 Non-secretory protein CDS SAVERM_3092 3867456 3866419 putative hydrolase PF00561: alpha/beta hydrolase fold 7.06 36641 X miscellaneous 4.7 BAC70803.1 Non-secretory protein CDS SAVERM_3093 3867692 3867913 hypothetical protein 3.19 8001 X similar to unknown proteins 5 BAC70804.1 Non-secretory protein CDS SAVERM_3094 3868223 3868864 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.24 23298 X regulation 3.5.2 BAC70805.1 Non-secretory protein CDS SAVERM_3095 3868964 3869248 putative ATP-binding protein PF11305: Protein of unknown function (DUF3107) 9.16 10242 X similar to unknown proteins 5 BAC70806.1 Non-secretory protein CDS SAVERM_3096 3869353 3869706 hypothetical protein 12.2 12206 X similar to unknown proteins 5 BAC70807.1 Non-secretory protein CDS SAVERM_3097 3870637 3869891 hypothetical protein 4.63 26559 X similar to unknown proteins 5 BAC70808.1 Non-secretory protein CDS SAVERM_3098 3871098 3873377 rhlE putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 10.07 81238 X RNA modification 3.6 BAC70809.1 Non-secretory protein CDS SAVERM_3099 3873623 3874495 putative hydrolase PF00561: alpha/beta hydrolase fold 4.56 30937 X miscellaneous 4.7 BAC70810.1 Non-secretory protein CDS SAVERM_3100 3875514 3874618 hypothetical protein PF01936: Protein of unknown function DUF88 5.26 33159 X similar to unknown proteins 5 BAC70811.1 Non-secretory protein CDS SAVERM_3101 3875749 3875925 hypothetical protein 9.66 6511 X similar to unknown proteins 5 BAC70812.1 Non-secretory protein CDS SAVERM_3102 3876647 3876042 putative integral membrane protein PF01914: MarC family integral membrane protein 10.32 21096 X miscellaneous 4.7 BAC70813.1 Non-secretory protein CDS SAVERM_3103 3877673 3876807 hypothetical protein PF02231: PHP domain N-terminal region 4.86 30247 X similar to unknown proteins 5 BAC70814.1 Non-secretory protein CDS SAVERM_3104 3878517 3877876 hypothetical protein 4.39 22255 X similar to unknown proteins 5 BAC70815.1 Non-secretory protein CDS SAVERM_3105 3878993 3878805 hypothetical protein 12.34 6549 E no similarity 6 BAC70816.1 Signal peptide CDS SAVERM_3106 3879610 3879026 hypothetical protein PF05076: Suppressor of fused protein (SUFU) 4.38 20428 E similar to unknown proteins 5 BAC70817.1 Non-secretory protein CDS SAVERM_3107 3880153 3881268 corA2 putative metal-transport protein PF01544: CorA-like Mg2+ transporter protein 6.4 41618 E transport / binding proteins & lipoproteins 1.2 BAC70818.1 Non-secretory protein CDS SAVERM_3108 3881292 3881834 hypothetical protein 9.41 19134 E similar to unknown proteins 5 BAC70819.1 Non-secretory protein CDS SAVERM_3109 3882805 3882041 putative lipoprotein 9.95 26335 E transport / binding proteins & lipoproteins 1.2 BAC70820.1 Signal peptide CDS SAVERM_3110 3883056 3884354 mgtE putative magnesium (Mg2+) transporter PF03448: MgtE intracellular domain 4.38 47593 E transport / binding proteins & lipoproteins 1.2 BAC70821.1 Non-secretory protein CDS SAVERM_3111 3884344 3884940 hypothetical protein PF06210: Protein of unknown function (DUF1003) 7.69 22997 E similar to unknown proteins 5 BAC70822.1 Non-secretory protein CDS SAVERM_3112 3884984 3886117 putative ATP-binding protein PF01883: Domain of unknown function DUF59 4.86 38983 E miscellaneous 4.7 BAC70823.1 Non-secretory protein CDS SAVERM_3113 3886991 3886257 hypothetical protein 4.94 25991 E similar to unknown proteins 5 BAC70824.1 Non-secretory protein CDS SAVERM_3114 3887705 3887259 tatB putative sec-independent protein translocase protein TatB PF02416: mttA/Hcf106 family 4.41 16590 E protein secretion 1.6 BAC70825.1 Non-secretory protein CDS SAVERM_3115 3889769 3887910 pepD1 putative serine protease PF00089: Trypsin 11.6 64251 E protein modification 3.8 BAC70826.1 Non-secretory protein CDS SAVERM_3116 3891226 3890222 hypothetical protein 9.42 33451 E similar to unknown proteins 5 BAC70827.1 Non-secretory protein CDS SAVERM_3117 3891882 3891223 sig23 putative RNA polymerase ECF-subfamily sigma factor similaro to SCO5147, PF04542: Sigma-70 region 2 7.3 24216 E RNA initiation 3.5.1 BAC70828.1 Non-secretory protein CDS SAVERM_3118 3892325 3892849 putative O-methyltransferase PF00891: O-methyltransferase 5.8 18460 E miscellaneous 4.7 BAC70829.1 Non-secretory protein CDS SAVERM_3119 3893260 3893015 hypothetical protein PF11314: Protein of unknown function (DUF3117) 5.05 8388 E similar to unknown proteins 5 BAC70830.1 Non-secretory protein CDS SAVERM_3120 3893559 3894362 putative enoyl-CoA hydratase/isomerase PF00378: Enoyl-CoA hydratase/isomerase family 5.16 28061 E metabolism of lipids 2.4 BAC70831.1 Non-secretory protein CDS SAVERM_3121 3894963 3894382 tagA putative DNA-3-methyladenine glycosylase I PF03352: Methyladenine glycosylase 4.92 21127 E DNA modification & repair 3.2 BAC70832.1 Non-secretory protein CDS SAVERM_3122 3895316 3894960 putative secreted protein 4.27 12491 E miscellaneous 4.7 BAC70833.1 Signal peptide CDS SAVERM_3123 3895549 3896409 folP1 putative dihydropteroate synthase PF00809: Pterin binding enzyme 6 30811 E metabolism of coenzymes & prosthetic groups 2.5 BAC70834.1 Non-secretory protein CDS SAVERM_3124 3897213 3896455 hypothetical protein PF03641: Possible lysine decarboxylase 4.89 27493 E similar to unknown proteins 5 BAC70835.1 Non-secretory protein CDS SAVERM_3125 3898400 3897321 dapE putative succinyl-diaminopimelate desuccinylase PF01546: Peptidase family M20/M25/M40 4.73 38466 E metabolism of amino acids & related molecules 2.2 BAC70836.1 Non-secretory protein CDS SAVERM_3126 3898600 3899463 hypothetical protein 9.53 30042 E similar to unknown proteins 5 BAC70837.1 Non-secretory protein CDS SAVERM_3127 3899804 3900253 putative ATP-binding protein 10.88 13718 E miscellaneous 4.7 BAC70838.1 Signal peptide CDS SAVERM_3128 3901413 3900319 aspB2 putative aspartate aminotransferase PF00155: Aminotransferase class I and II 6.51 39290 E metabolism of amino acids & related molecules 2.2 BAC70839.1 Non-secretory protein CDS SAVERM_3129 3901962 3901642 fdxD putative ferredoxin PF00037: 4Fe-4S binding domain 3.85 11856 E membrane bioenergetics 1.4 BAC70840.1 Non-secretory protein CDS SAVERM_3130 3902103 3903476 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.74 46816 E miscellaneous 4.7 BAC70841.1 Non-secretory protein CDS SAVERM_3131 3903473 3904345 hypothetical protein 5.42 31188 E similar to unknown proteins 5 BAC70842.1 Non-secretory protein CDS SAVERM_3132 3904978 3904364 putative two-component system response regulator PF00072: Response regulator receiver domain 5.11 21449 E regulation 3.5.2 BAC70843.1 Non-secretory protein CDS SAVERM_3133 3906146 3904989 putative two-component system sensor kinase PF07730: Histidine kinase 9.25 40735 E sensors 1.3 BAC70844.1 Non-secretory protein CDS SAVERM_3134 3906955 3906197 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.53 27150 E transport / binding proteins & lipoproteins 1.2 BAC70845.1 Non-secretory protein CDS SAVERM_3135 3907860 3906952 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.87 31902 E transport / binding proteins & lipoproteins 1.2 BAC70846.1 Non-secretory protein CDS SAVERM_3136 3910441 3908162 hypothetical protein PF03477: ATP cone domain 9.39 74036 E similar to unknown proteins 5 BAC70847.1 Non-secretory protein CDS SAVERM_3137 3911026 3910607 putative integral membrane protein 10.73 13749 E miscellaneous 4.7 BAC70848.1 Non-secretory protein CDS SAVERM_3138 3911910 3911026 mshB putative N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase mycothiol biosynthesis, PF02585: GlcNAc-PI de-N-acetylase 4.74 31772 E adaptation to atypical conditions 4.1 BAC70849.1 Non-secretory protein CDS SAVERM_3139 3912966 3912070 hypothetical protein 11.28 31892 E similar to unknown proteins 5 BAC70850.1 Non-secretory protein CDS SAVERM_3140 3913658 3913164 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 8.07 17803 E regulation 3.5.2 BAC70851.1 Non-secretory protein CDS SAVERM_3141 3913789 3914658 putative DNA-binding protein PF01381: Helix-turn-helix 5.83 32122 E regulation 3.5.2 BAC70852.1 Non-secretory protein CDS SAVERM_3142 3914655 3914867 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.87 7351 E similar to unknown proteins 5 BAC70853.1 Non-secretory protein CDS SAVERM_3143 3915172 3914978 putative secreted protein 10.04 6692 E miscellaneous 4.7 BAC70854.1 Non-secretory protein CDS SAVERM_3144 3915360 3917492 putative peptidase PF00326: Prolyl oligopeptidase family 6.24 76365 E protein modification 3.8 BAC70855.1 Non-secretory protein CDS SAVERM_3145 3918727 3917642 oppF4 putative peptide ABC transporter ATP-binding protein PF00005: ABC transporter 7.14 39757 E transport / binding proteins & lipoproteins 1.2 BAC70856.1 Non-secretory protein CDS SAVERM_3146 3919703 3918720 oppD4 putative peptide ABC transporter ATP-binding protein PF00005: ABC transporter 6.18 35716 E transport / binding proteins & lipoproteins 1.2 BAC70857.1 Non-secretory protein CDS SAVERM_3147 3920631 3919711 oppC4 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.42 32006 E transport / binding proteins & lipoproteins 1.2 BAC70858.1 Non-secretory protein CDS SAVERM_3148 3921604 3920681 oppB4 putative peptide ABC transporter permease protein Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 9.93 33553 E transport / binding proteins & lipoproteins 1.2 BAC70859.1 Non-secretory protein CDS SAVERM_3149 3923281 3921659 oppA4 putative peptide ABC transporter substrate-binding protein PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 6.78 58574 E transport / binding proteins & lipoproteins 1.2 BAC70860.1 Non-secretory protein CDS SAVERM_3150 3923776 3924765 bldKA1 putative peptide ABC transporter permease protein oppC5, PF00528: Binding-protein-dependent transport system inner membrane component 5.41 35586 E transport / binding proteins & lipoproteins 1.2 BAC70861.1 Non-secretory protein CDS SAVERM_3151 3924847 3926610 bldKB1 putative peptide ABC transporter substrate-binding protein oppA5, Tat substrate, PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 8.84 64439 E transport / binding proteins & lipoproteins 1.2 BAC70862.1 Signal peptide CDS SAVERM_3152 3926736 3927716 bldKC1 putative peptide ABC transporter permease protein oppB5, Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 9.46 35753 E transport / binding proteins & lipoproteins 1.2 BAC70863.1 Signal peptide CDS SAVERM_3153 3927777 3928847 bldKD1 putative peptide ABC transporter ATP-binding protein oppD5, PF00005: ABC transporter 5.84 38232 E transport / binding proteins & lipoproteins 1.2 BAC70864.1 Non-secretory protein CDS SAVERM_3154 3928871 3929917 bldKE1 putative peptide ABC transporter ATP-binding protein oppF5, PF00005: ABC transporter 8.48 37976 E transport / binding proteins & lipoproteins 1.2 BAC70865.1 Non-secretory protein CDS SAVERM_3155 3930255 3930088 putative MbtH-like protein nrps3 gene cluster, PF03621: MbtH-like protein 4.17 6045 E miscellaneous 4.7 BAC70866.1 Non-secretory protein CDS SAVERM_3156 3932183 3930306 nrps3-1 putative non-ribosomal peptide synthetase nrps3 gene cluster 5.12 66928 E antibiotic production 4.3 BAC70867.1 Non-secretory protein CDS SAVERM_3157 3933553 3932261 putative export protein nrps3 gene cluster, PF07690: Major Facilitator Superfamily 11.04 44831 E transport / binding proteins & lipoproteins 1.2 BAC70868.1 Non-secretory protein CDS SAVERM_3158 3934425 3933613 nrps3-2 putative non-ribosomal peptide synthetase nrps3 gene cluster 4.44 29268 E antibiotic production 4.3 BAC70869.1 Non-secretory protein CDS SAVERM_3159 3937489 3934439 nrps3-3 putative non-ribosomal peptide synthetase nrps3 gene cluster 4.68 110963 E antibiotic production 4.3 BAC70870.1 Non-secretory protein CDS SAVERM_3160 3938730 3937627 putative aminotransferase nrps3 gene cluster, PF00155: Aminotransferase class I and II 5 40356 E miscellaneous 4.7 BAC70871.1 Non-secretory protein CDS SAVERM_3161 3939688 3938765 dapF2 putative diaminopimelate epimerase PF01678: Diaminopimelate epimerase 5.04 31935 E metabolism of amino acids & related molecules 2.2 BAC70872.1 Non-secretory protein CDS SAVERM_3162 3940430 3939735 hypothetical protein PF10014: Uncharacterized protein conserved in bacteria (DUF2257) 4.45 25946 E similar to unknown proteins 5 BAC70873.1 Non-secretory protein CDS SAVERM_3163 3941439 3940462 hypothetical protein 5.03 36785 E similar to unknown proteins 5 BAC70874.1 Non-secretory protein CDS SAVERM_3164 3942062 3941820 hypothetical protein 9.46 8314 E no similarity 6 BAC70875.1 Non-secretory protein CDS SAVERM_3165 3942121 3943161 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 6.26 38001 E regulation 3.5.2 BAC70876.1 Non-secretory protein CDS SAVERM_3166 3944108 3943089 bdpE putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 8.03 35959 E regulation 3.5.2 BAC70877.1 Non-secretory protein CDS SAVERM_3167 3944179 3944508 hypothetical protein PF07883: Cupin domain 4.43 11884 E no similarity 6 BAC70878.1 Non-secretory protein CDS SAVERM_3168 3945043 3944522 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.98 18803 E miscellaneous 4.7 BAC70879.1 Non-secretory protein CDS SAVERM_3169 3945456 3945049 hypothetical protein 4.53 14852 E similar to unknown proteins 5 BAC70880.1 Non-secretory protein CDS SAVERM_3170 3945964 3945461 hypothetical protein PF04978: Protein of unknown function (DUF664) 4.4 19145 E similar to unknown proteins 5 BAC70881.1 Non-secretory protein CDS SAVERM_3171 3946132 3946872 putative methyltransferase PF05401: Nodulation protein S (NodS) 5.38 26771 E miscellaneous 4.7 BAC70882.1 Non-secretory protein CDS SAVERM_3172 3948111 3946897 bldKE2 putative peptide ABC transporter ATP-binding protein oppF6, PF00005: ABC transporter 7.06 43295 E transport / binding proteins & lipoproteins 1.2 BAC70883.1 Non-secretory protein CDS SAVERM_3173 3949246 3948185 bldKD2 putative peptide ABC transporter ATP-binding protein oppD6, PF00005: ABC transporter 5.65 38390 E transport / binding proteins & lipoproteins 1.2 BAC70884.1 Non-secretory protein CDS SAVERM_3174 3950236 3949256 bldKC2 putative peptide ABC transporter permease protein oppB6, PF00528: Binding-protein-dependent transport system inner membrane component 8.36 36124 E transport / binding proteins & lipoproteins 1.2 BAC70885.1 Non-secretory protein CDS SAVERM_3175 3952147 3950336 bldKB2 putative peptide ABC transporter substrate-binding protein oppA6, PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 9.37 65107 E transport / binding proteins & lipoproteins 1.2 BAC70886.1 Signal peptide CDS SAVERM_3176 3953298 3952264 bldKA2 putative peptide ABC transporter permease protein oppC6, PF00528: Binding-protein-dependent transport system inner membrane component 6.97 37612 E transport / binding proteins & lipoproteins 1.2 BAC70887.1 Non-secretory protein CDS SAVERM_3177 3955803 3953896 typA putative GTP-binding elongation factor PF00009: Elongation factor Tu GTP binding domain 4.98 69214 E elongation 3.7.4 BAC70888.1 Non-secretory protein CDS SAVERM_3178 3958224 3955987 putative lipoprotein PF00497: Bacterial extracellular solute-binding proteins, family 3 9.24 79097 E transport / binding proteins & lipoproteins 1.2 BAC70889.1 Signal peptide CDS SAVERM_3179 3958634 3958921 hypothetical protein 4.71 10527 E similar to unknown proteins 5 BAC70890.1 Non-secretory protein CDS SAVERM_3180 3958978 3959799 hypothetical protein 9.58 31035 E similar to unknown proteins 5 BAC70891.1 Non-secretory protein CDS SAVERM_3181 3959816 3961819 sdhA2 putative succinate dehydrogenase flavoprotein subunit (complex II) PF00890: FAD binding domain 5.46 72941 E TCA cycle 2.1.3 BAC70892.1 Non-secretory protein CDS SAVERM_3182 3961816 3962592 sdhB2 putative succinate dehydrogenase iron-sulfur protein (complex II) PF00037: 4Fe-4S binding domain 6.64 29015 E TCA cycle 2.1.3 BAC70893.1 Non-secretory protein CDS SAVERM_3183 3963926 3962688 putative membrane protein 10.12 44816 E miscellaneous 4.7 BAC70894.1 Non-secretory protein CDS SAVERM_3184 3964078 3966321 hypothetical protein 5.21 76121 E similar to unknown proteins 5 BAC70895.1 Non-secretory protein CDS SAVERM_3185 3969351 3966409 prpM3 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 4.59 104506 E protein modification 3.8 BAC70896.1 Non-secretory protein CDS SAVERM_3186 3969975 3969517 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.36 16350 E regulation 3.5.2 BAC70897.1 Non-secretory protein CDS SAVERM_3187 3970532 3970140 putative MutT-like protein PF00293: NUDIX domain 4.53 14202 E miscellaneous 4.7 BAC70898.1 Non-secretory protein CDS SAVERM_3188 3970788 3970606 hypothetical protein PF05036: Sporulation related domain 10.1 6915 E similar to unknown proteins 5 BAC70899.1 Non-secretory protein CDS SAVERM_3189 3971868 3971116 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.16 27178 E regulation 3.5.2 BAC70900.1 Non-secretory protein CDS SAVERM_3190 3973185 3972016 putative membrane protein 4.13 41188 E miscellaneous 4.7 BAC70901.1 Non-secretory protein CDS SAVERM_3191 3973434 3974567 thrC2 putative threonine synthase PF00291: Pyridoxal-phosphate dependent enzyme 6.7 39334 E metabolism of amino acids & related molecules 2.2 BAC70902.1 Non-secretory protein CDS SAVERM_3192 3976906 3974801 putative bifunctional protein PF00176: SNF2 family N-terminal domain 6.97 76287 E miscellaneous 4.7 BAC70903.1 Non-secretory protein CDS SAVERM_3193 3977905 3977231 pptA3 putative 4’-phosphopantetheinyl transferase downstream of nrps1 cluster, PF01648: 4'-phosphopantetheinyl transferase superfamily 10.66 24046 E metabolism of lipids 2.4 BAC70904.1 Non-secretory protein CDS SAVERM_3194 3978756 3977950 putative hydrolase PF00795: Carbon-nitrogen hydrolase 4.95 27891 E miscellaneous 4.7 BAC70905.1 Non-secretory protein CDS SAVERM_3195 3979130 3978837 hypothetical protein PF06063: Domain of unknown function (DUF931) 9.52 10298 E similar to unknown proteins 5 BAC70906.1 Non-secretory protein CDS SAVERM_3196 3980047 3979154 hypothetical protein PF03591: AzlC protein 5.31 31020 E similar to unknown proteins 5 BAC70907.1 Non-secretory protein CDS SAVERM_3197 3985519 3980213 nrps1-1 putative non-ribosomal peptide synthetase nrps1 gene cluster 4.84 192450 E antibiotic production 4.3 BAC70908.1 Non-secretory protein CDS SAVERM_3198 3989339 3985548 nrps1-2 putative non-ribosomal peptide synthetase nrps1 gene cluster 5.91 135106 E antibiotic production 4.3 BAC70909.1 Non-secretory protein CDS SAVERM_3199 3992310 3989374 nrps1-3 putative non-ribosomal peptide synthetase nrps1 gene cluster 5.22 104749 E antibiotic production 4.3 BAC70910.1 Non-secretory protein CDS SAVERM_3200 3993294 3992464 putative dehydrogenase nrps1 gene cluster, PF00106: short chain dehydrogenase 5.02 29083 E miscellaneous 4.7 BAC70911.1 Non-secretory protein CDS SAVERM_3201 3994004 3993291 putative thioesterase nrps1 gene cluster 4.8 25925 E antibiotic production 4.3 BAC70912.1 Non-secretory protein CDS SAVERM_3202 3994940 3994107 putative thioesterase nrps1 gene cluster 6.51 29648 E antibiotic production 4.3 BAC70913.1 Non-secretory protein CDS SAVERM_3203 3995124 3996191 putative LuxR-family transcriptional regulator nrps1 gene cluster, PF00196: Bacterial regulatory proteins, luxR family 8.68 39433 E regulation 3.5.2 BAC70914.1 Non-secretory protein CDS SAVERM_3204 3997273 3996878 hypothetical protein 4.4 14862 E no similarity 6 BAC70915.1 Non-secretory protein CDS SAVERM_3205 3998095 3997841 yoeB putative txe/YoeB family addiction module toxin PF06769: YoeB-like toxin of bacterial type II toxin-antitoxin system 8.88 10172 E similar to unknown proteins 5 BAC70916.1 Non-secretory protein CDS SAVERM_3206 3998373 3998092 yefM putative PHD family toxin-antitoxin system, antitoxin component PF02604: Antitoxin Phd_YefM, type II toxin-antitoxin system 4.84 10075 E similar to unknown proteins 5 BAC70917.1 Non-secretory protein CDS SAVERM_3207 3999662 3998574 putative GTP binding protein PF06071: Protein of unknown function (DUF933) 4.36 39091 E miscellaneous 4.7 BAC70918.1 Non-secretory protein CDS SAVERM_3208 3999878 4000591 hypothetical protein 12.58 24524 E similar to unknown proteins 5 BAC70919.1 Non-secretory protein CDS SAVERM_3209 4001532 4000786 ppgK putative polyphosphate glucokinase PF00480: ROK family 6.03 26063 E specific pathways 2.1.1 BAC70920.1 Non-secretory protein CDS SAVERM_3210 4002578 4001562 ispH putative 4-hydroxy-3-methylbut-2-enyl diphosphate reductase lytB, MEP pathway 4.51 36591 E specific pathways 2.1.1 BAC70921.1 Non-secretory protein CDS SAVERM_3211 4002836 4004044 xseA putative exoribonuclease large subunit PF02601: Exonuclease VII, large subunit 6.86 43844 E RNA modification 3.6 BAC70922.1 Non-secretory protein CDS SAVERM_3212 4004054 4004296 xseB putative exoribonuclease small subunit PF02609: Exonuclease VII small subunit 4.07 8868 E RNA modification 3.6 BAC70923.1 Non-secretory protein CDS SAVERM_3213 4004666 4005256 putative NADH dehydrogenase/NAD(P)H nitroreductase PF00881: Nitroreductase family 4.47 21419 E membrane bioenergetics 1.4 BAC70924.1 Non-secretory protein CDS SAVERM_3214 4005979 4005458 putative secreted protein 7.82 18694 E miscellaneous 4.7 BAC70925.1 Non-secretory protein CDS SAVERM_3215 4006107 4007141 glpX putative fructose-1,6-bisphosphatase II PF03320: Bacterial fructose-1,6-bisphosphatase, glpX-encoded 4.81 36797 E main glycolytic pathways 2.1.2 BAC70926.1 Non-secretory protein CDS SAVERM_3216 4007642 4007271 wblI putative WhiB-family transcriptional regulator; putative role in cell cycle control (whiD) PF02467: Transcription factor WhiB 10.44 13658 E regulation 3.5.2 BAC70927.1 Non-secretory protein CDS SAVERM_3217 4008521 4007817 hypothetical protein PF08044: Domain of unknown function (DUF1707) 6.06 25818 E similar to unknown proteins 5 BAC70928.1 Non-secretory protein CDS SAVERM_3218 4008701 4010377 fumB putative fumarate hydratase class I PF05681: Fumarate hydratase (Fumerase) 4.81 60611 E TCA cycle 2.1.3 BAC70929.1 Non-secretory protein CDS SAVERM_3219 4010565 4011002 hypothetical protein 4.21 15085 E no similarity 6 BAC70930.1 Non-secretory protein CDS SAVERM_3220 4011015 4014206 hypothetical protein PF05729: NACHT domain 8.28 117712 E no similarity 6 BAC70931.1 Non-secretory protein CDS SAVERM_3221 4014275 4015678 fumC putative fumarate hydratase C PF00206: Lyase 5.05 49801 E TCA cycle 2.1.3 BAC70932.1 Non-secretory protein CDS SAVERM_3222 4015793 4016485 hypothetical protein PF04167: Protein of unknown function (DUF402) 5.33 26325 E similar to unknown proteins 5 BAC70933.1 Non-secretory protein CDS SAVERM_3223 4016768 4018918 prpE2 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.14 76358 E protein modification 3.8 BAC70934.1 Non-secretory protein CDS SAVERM_3224 4019075 4020538 katA2 putative catalase PF00199: Catalase 6.2 55178 E detoxification 4.2 BAC70935.1 Non-secretory protein CDS SAVERM_3225 4022949 4020616 pbp2 putative penicillin-binding protein PF00912: Transglycosylase 10.17 82658 E cell wall 1.1 BAC70936.1 Non-secretory protein CDS SAVERM_3226 4023232 4024179 putative integral membrane protein PF01145: SPFH domain / Band 7 family 5.87 33658 E miscellaneous 4.7 BAC70937.1 Non-secretory protein CDS SAVERM_3227 4024176 4024439 hypothetical protein 11.83 9367 E similar to unknown proteins 5 BAC70938.1 Non-secretory protein CDS SAVERM_3228 4024588 4025115 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6.72 19807 E regulation 3.5.2 BAC70939.1 Non-secretory protein CDS SAVERM_3229 4025112 4025798 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.16 24455 E transport / binding proteins & lipoproteins 1.2 BAC70940.1 Non-secretory protein CDS SAVERM_3230 4025795 4028131 putative ABC transporter permease protein PF02687: Predicted permease 10.6 83077 E transport / binding proteins & lipoproteins 1.2 BAC70941.1 Non-secretory protein CDS SAVERM_3231 4029202 4028192 oxyR putative hydrogen peroxide sensing regulator, LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.72 35788 E regulation 3.5.2 BAC70942.1 Non-secretory protein CDS SAVERM_3232 4029374 4029928 ahpC putative alkyl hydroperoxide reductase PF00578: AhpC/TSA family 4.36 20773 E detoxification 4.2 BAC70943.1 Non-secretory protein CDS SAVERM_3233 4029935 4030468 ahpD putative alkylhydroperoxidase PF02627: Carboxymuconolactone decarboxylase family 4.99 19021 E detoxification 4.2 BAC70944.1 Non-secretory protein CDS SAVERM_3234 4031876 4030554 putative integral membrane protein PF01594: Domain of unknown function DUF20 7.89 46546 E miscellaneous 4.7 BAC70945.1 Non-secretory protein CDS SAVERM_3235 4032742 4032029 putative secreted protein PF06737: Transglycosylase-like domain 8.19 24826 E similar to unknown proteins 5 BAC70946.1 Signal peptide CDS SAVERM_3236 4034475 4033150 putative ATP-binding protein PF02562: PhoH-like protein 6.36 48266 E miscellaneous 4.7 BAC70947.1 Non-secretory protein CDS SAVERM_3237 4035550 4034777 uppS1 putative undecaprenyl diphosphate synthase PF01255: Putative undecaprenyl diphosphate synthase 6.44 28893 E metabolism of lipids 2.4 BAC70948.1 Non-secretory protein CDS SAVERM_3238 4036211 4036801 hypothetical protein PF02643: Uncharacterized ACR, COG1430 11.98 21350 E similar to unknown proteins 5 BAC70949.1 Non-secretory protein CDS SAVERM_3239 4037259 4038419 hypothetical protein PF06224: Protein of unknown function (DUF1006) 7.8 41717 E similar to unknown proteins 5 BAC70950.1 Non-secretory protein CDS SAVERM_3240 4039337 4038477 hypothetical protein PF08241: Methyltransferase domain 6.52 30684 E similar to unknown proteins 5 BAC70951.1 Non-secretory protein CDS SAVERM_3241 4039440 4039925 hypothetical protein PF04978: Protein of unknown function (DUF664) 4.91 18069 E similar to unknown proteins 5 BAC70952.1 Non-secretory protein CDS SAVERM_3242 4040474 4039968 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.58 19331 E miscellaneous 4.7 BAC70953.1 Non-secretory protein CDS SAVERM_3243 4041377 4040505 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 4.72 30751 E miscellaneous 4.7 BAC70954.1 Non-secretory protein CDS SAVERM_3244 4042066 4041419 putative bifunctional deaminase-reductase-like protein PF01872: RibD C-terminal domain 5.08 23663 E miscellaneous 4.7 BAC70955.1 Non-secretory protein CDS SAVERM_3245 4042870 4042190 putative secreted protein Tat substrate, PF00691: OmpA family 4.82 23822 E miscellaneous 4.7 BAC70956.1 Signal peptide CDS SAVERM_3246 4043467 4042874 putative secreted protein Tat substrate 8.04 20145 E similar to unknown proteins 5 BAC70957.1 Signal peptide CDS SAVERM_3247 4044037 4043483 hypothetical protein 3.75 19153 E similar to unknown proteins 5 BAC70958.1 Signal peptide CDS SAVERM_3248 4044312 4044097 hypothetical protein 10.82 7465 E no similarity 6 BAC70959.1 Non-secretory protein CDS SAVERM_3249 4045170 4044439 putative two-component system response regulator PF00072: Response regulator receiver domain 9.14 26357 E regulation 3.5.2 BAC70960.1 Non-secretory protein CDS SAVERM_3250 4046581 4045163 putative two-component system sensor kinase PF07730: Histidine kinase 9.03 49492 E sensors 1.3 BAC70961.1 Non-secretory protein CDS SAVERM_3251 4047498 4046593 putative secreted protein PF00482: Bacterial type II secretion system protein F domain 11.43 32549 E similar to unknown proteins 5 BAC70962.1 Non-secretory protein CDS SAVERM_3252 4048451 4047510 putative secreted protein PF00482: Bacterial type II secretion system protein F domain 11.19 33182 E similar to unknown proteins 5 BAC70963.1 Non-secretory protein CDS SAVERM_3253 4049841 4048501 putative type II secretion system protein E Type II secretion system, PF00437: Type II/IV secretion system protein 6.27 48927 E protein secretion 1.6 BAC70964.1 Non-secretory protein CDS SAVERM_3254 4050083 4049931 hypothetical protein 4.26 5286 E no similarity 6 BAC70965.1 Non-secretory protein CDS SAVERM_3255 4051940 4050333 minD1 putative septum site-determining protein PF07811: TadE-like protein 4.87 55570 E cell division 1.7 BAC70966.1 Non-secretory protein CDS SAVERM_3256 4052638 4052009 hypothetical protein PF08666: SAF domain 8.82 22528 E similar to unknown proteins 5 BAC70967.1 Non-secretory protein CDS SAVERM_3257 4053688 4052801 hypothetical protein 7.46 31273 E similar to unknown proteins 5 BAC70968.1 Non-secretory protein CDS SAVERM_3258 4054020 4055759 chiA2 putative chitinase A, secreted PF00704: Glycosyl hydrolases family 18 7.79 58589 E specific pathways 2.1.1 BAC70969.1 Signal peptide CDS SAVERM_3259 4056529 4056882 hypothetical protein 4.14 12929 E no similarity 6 BAC70970.1 Non-secretory protein CDS SAVERM_3260 4056905 4057366 hypothetical protein 5.32 17505 E no similarity 6 BAC70971.1 Non-secretory protein CDS SAVERM_3261 4057820 4059073 hypothetical protein 6.74 46491 E no similarity 6 BAC70972.1 Non-secretory protein CDS SAVERM_3262 4059590 4059066 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 8.73 18400 E regulation 3.5.2 BAC70973.1 Non-secretory protein CDS SAVERM_3263 4059832 4060683 putative DNA-binding protein PF01381: Helix-turn-helix 8.12 31549 E regulation 3.5.2 BAC70974.1 Non-secretory protein CDS SAVERM_3264 4060692 4060886 hypothetical protein 4.33 7074 E similar to unknown proteins 5 BAC70975.1 Non-secretory protein CDS SAVERM_3265 4061418 4060888 hypothetical protein 8.79 19142 E similar to unknown proteins 5 BAC70976.1 Non-secretory protein CDS SAVERM_3266 4061623 4062975 putative carboxypeptidase T (secreted zinc-binding carboxypeptidase) PF00246: Zinc carboxypeptidase 5 49135 E protein modification 3.8 BAC70977.1 Signal peptide CDS SAVERM_3267 4063606 4063001 hypothetical protein 3.97 21894 E similar to unknown proteins 5 BAC70978.1 Non-secretory protein CDS SAVERM_3268 4065298 4063733 putative AAA family ATPase PF00004: ATPase family associated with various cellular activities (AAA) 5.04 57822 E miscellaneous 4.7 BAC70979.1 Non-secretory protein CDS SAVERM_3269 4066115 4065495 hypothetical protein 9.14 22353 E no similarity 6 BAC70980.1 Non-secretory protein CDS SAVERM_3270 4068242 4066470 hypothetical protein PF04956: Conjugal transfer protein TrbC 5.3 65565 E similar to unknown proteins 5 BAC70981.1 Non-secretory protein CDS SAVERM_3271 4068863 4068315 hypothetical protein 9.06 19821 E similar to unknown proteins 5 BAC70982.1 Non-secretory protein CDS SAVERM_3272 4069022 4071052 hypothetical protein PF00656: Caspase domain 5.84 70443 E similar to unknown proteins 5 BAC70983.1 Non-secretory protein CDS SAVERM_3273 4075478 4071033 hypothetical protein 4.69 159519 E similar to unknown proteins 5 BAC70984.1 Non-secretory protein CDS SAVERM_3274 4076190 4075537 hypothetical protein PF08808: RES domain 8.04 23609 E no similarity 6 BAC70985.1 Non-secretory protein CDS SAVERM_3275 4076861 4076193 hypothetical protein 4.57 23727 E no similarity 6 BAC70986.1 Non-secretory protein CDS SAVERM_3276 4078074 4076881 hypothetical protein PF01661: Appr-1-p processing enzyme family 9.65 42052 E no similarity 6 BAC70987.1 Non-secretory protein CDS SAVERM_3277 4079679 4078192 gntP putative low-affinity gluconate transporter PF02447: GntP family permease 7.21 50962 E transport / binding proteins & lipoproteins 1.2 BAC70988.1 Non-secretory protein CDS SAVERM_3278 4080219 4079800 hypothetical protein PF01042: Endoribonuclease L-PSP 4.88 15034 E similar to unknown proteins 5 BAC70989.1 Non-secretory protein CDS SAVERM_3279 4081023 4080229 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 7.17 29225 E regulation 3.5.2 BAC70990.1 Non-secretory protein CDS SAVERM_3280 4082105 4081020 kdgK putative 2-oxo-3-deoxygluconate kinase PF00294: pfkB family carbohydrate kinase 6.19 37772 E specific pathways 2.1.1 BAC70991.1 Non-secretory protein CDS SAVERM_3281 4082240 4083511 putative D-amino acid deaminase PF01168: Alanine racemase, N-terminal domain 5.43 45613 E metabolism of amino acids & related molecules 2.2 BAC70992.1 Non-secretory protein CDS SAVERM_3282 4083587 4085179 putative D-aminoacylase PF01979: Amidohydrolase family 6.01 57009 E metabolism of amino acids & related molecules 2.2 BAC70993.1 Non-secretory protein CDS SAVERM_3283 4085839 4085198 hypothetical protein 4.75 22636 E similar to unknown proteins 5 BAC70994.1 Non-secretory protein CDS SAVERM_3284 4087140 4086337 hypothetical protein 7.35 26012 E similar to unknown proteins 5 BAC70995.1 Non-secretory protein CDS SAVERM_3285 4087192 4088403 aspB3 putative aspartate aminotransferase PF00155: Aminotransferase class I and II 5.93 44101 E metabolism of amino acids & related molecules 2.2 BAC70996.1 Non-secretory protein CDS SAVERM_3286 4088541 4088960 hypothetical protein 6.98 14705 E similar to unknown proteins 5 BAC70997.1 Non-secretory protein CDS SAVERM_3287 4091318 4089495 pckA putative phosphoenolpyruvate carboxykinase PF00821: Phosphoenolpyruvate carboxykinase 4.57 67144 E main glycolytic pathways 2.1.2 BAC70998.1 Non-secretory protein CDS SAVERM_3288 4091675 4092388 hypothetical protein PF03006: Uncharacterised protein family (Hly-III / UPF0073) 9.83 25448 E similar to unknown proteins 5 BAC70999.1 Non-secretory protein CDS SAVERM_3289 4092550 4094124 putative integral membrane efflux protein similar to monensin resistance protein MonT, PF07690: Major Facilitator Superfamily 6.25 53552 E transport / binding proteins & lipoproteins 1.2 BAC71000.1 Non-secretory protein CDS SAVERM_3290 4094130 4094792 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.63 24400 E regulation 3.5.2 BAC71001.1 Non-secretory protein CDS SAVERM_3291 4094797 4095522 hypothetical protein PF01927: Protein of unknown function DUF82 6.25 26271 E similar to unknown proteins 5 BAC71002.1 Non-secretory protein CDS SAVERM_3292 4097792 4095519 hypothetical protein PF07250: Glyoxal oxidase N-terminus 5.62 81420 E similar to unknown proteins 5 BAC71003.1 Non-secretory protein CDS SAVERM_3293 4099147 4097945 dpm putative dolichol-phosphate mannosyltransferase PF00535: Glycosyl transferase 9.1 43627 E specific pathways 2.1.1 BAC71004.1 Non-secretory protein CDS SAVERM_3294 4100784 4099144 hypothetical protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 9.73 59231 E similar to unknown proteins 5 BAC71005.1 Non-secretory protein CDS SAVERM_3295 4102091 4100781 putative glycosyltransferase PF00535: Glycosyl transferase 7.52 49062 E specific pathways 2.1.1 BAC71006.1 Non-secretory protein CDS SAVERM_3296 4104274 4102247 hypothetical protein PF03190: Protein of unknown function, DUF255 4.67 72978 E similar to unknown proteins 5 BAC71007.1 Non-secretory protein CDS SAVERM_3297 4104456 4107692 putative regulatory protein PF07721: Tetratricopeptide repeat 6.91 116490 E regulation 3.5.2 BAC71008.1 Non-secretory protein CDS SAVERM_3298 4108113 4107799 putative membrane protein 9.92 10489 E miscellaneous 4.7 BAC71009.1 Non-secretory protein CDS SAVERM_3299 4108998 4108126 mca putative mycothiol conjugate amidase PF02585: GlcNAc-PI de-N-acetylase 4.64 32857 E similar to unknown proteins 5 BAC71010.1 Non-secretory protein CDS SAVERM_3300 4109154 4109552 putative membrane protein 7.06 14276 E miscellaneous 4.7 BAC71011.1 Non-secretory protein CDS SAVERM_3301 4109721 4110218 greA putative transcription elongation factor PF03449: Prokaryotic transcription elongation factor, GreA/GreB, N-terminal domain 4.24 17759 E RNA elongation 3.5.3 BAC71012.1 Non-secretory protein CDS SAVERM_3302 4111713 4110484 ilvA threonine dehydratase PF00291: Pyridoxal-phosphate dependent enzyme 6.19 42431 E metabolism of amino acids & related molecules 2.2 BAC71013.1 Non-secretory protein CDS SAVERM_3303 4111884 4112384 putative MarR-family transcriptional regulator PF01047: MarR family 7.8 18118 E regulation 3.5.2 BAC71014.1 Non-secretory protein CDS SAVERM_3304 4112753 4113253 sig59 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4960, PF04545: Sigma-70, region 4 10.95 18153 E RNA initiation 3.5.1 BAC71015.1 Non-secretory protein CDS SAVERM_3305 4114680 4113526 metB putative cystathionine gamma-synthase PF01053: Cys/Met metabolism PLP-dependent enzyme 5.38 40828 E metabolism of amino acids & related molecules 2.2 BAC71016.1 Non-secretory protein CDS SAVERM_3306 4114899 4116017 putative secreted protein 5.23 40785 E similar to unknown proteins 5 BAC71017.1 Non-secretory protein CDS SAVERM_3307 4116776 4116264 msrA putative peptide methionine sulfoxide reductase PF01625: Peptide methionine sulfoxide reductase 4.75 19146 E metabolism of amino acids & related molecules 2.2 BAC71018.1 Non-secretory protein CDS SAVERM_3308 4117077 4117670 hypothetical protein 9.08 22642 E similar to unknown proteins 5 BAC71019.1 Non-secretory protein CDS SAVERM_3309 4119991 4117931 savR1 putative Mrr restriction system protein PF04471: Restriction endonuclease 5.8 74873 E DNA modification & repair 3.2 BAC71020.1 Non-secretory protein CDS SAVERM_3310 4121085 4121843 hypothetical protein 6.68 26338 E no similarity 6 BAC71021.1 Non-secretory protein CDS SAVERM_3311 4123197 4122010 putative secreted protein 11.1 43111 E no similarity 6 BAC71022.1 Signal peptide CDS SAVERM_3312 4123347 4124225 hypothetical protein PF03575: Peptidase family S51 4.22 29967 E similar to unknown proteins 5 BAC71023.1 Non-secretory protein CDS SAVERM_3313 4124262 4125098 fecD2 putative ABC transporter iron(III)/siderophore permease protein fhuB, PF01032: FecCD transport family 12.09 27764 E transport / binding proteins & lipoproteins 1.2 BAC71024.1 Non-secretory protein CDS SAVERM_3314 4126277 4125234 adhA4 putative NADP-dependent alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 4.57 36700 E specific pathways 2.1.1 BAC71025.1 Non-secretory protein CDS SAVERM_3315 4126449 4127360 putative DNA-binding protein PF01381: Helix-turn-helix 8.27 33970 E regulation 3.5.2 BAC71026.1 Non-secretory protein CDS SAVERM_3316 4128234 4127452 hypothetical protein PF01152: Bacterial-like globin 4.73 29056 E similar to unknown proteins 5 BAC71027.1 Non-secretory protein CDS SAVERM_3317 4128601 4128332 hypothetical protein 4.82 9697 E no similarity 6 BAC71028.1 Non-secretory protein CDS SAVERM_3318 4129545 4129027 sig24 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 7.95 19423 E RNA initiation 3.5.1 BAC71029.1 Non-secretory protein CDS SAVERM_3319 4133248 4129829 putative SAM-P45 peptidase PF00082: Subtilase family 9.65 118192 E protein modification 3.8 BAC71030.1 Non-secretory protein CDS SAVERM_3320 4134036 4133353 putative ABC transporter ATP-binding protein PF00005: ABC transporter 9.39 24570 E transport / binding proteins & lipoproteins 1.2 BAC71031.1 Non-secretory protein CDS SAVERM_3321 4135542 4134070 putative ABC transporter permease protein PF02687: Predicted permease 10.82 49793 E transport / binding proteins & lipoproteins 1.2 BAC71032.1 Signal peptide CDS SAVERM_3322 4136995 4135745 putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 9.76 43311 E transport / binding proteins & lipoproteins 1.2 BAC71033.1 Signal peptide CDS SAVERM_3323 4137532 4137239 hypothetical protein 3.22 10442 E similar to unknown proteins 5 BAC71034.1 Non-secretory protein CDS SAVERM_3324 4137694 4138038 hypothetical protein 4.5 11808 E no similarity 6 BAC71035.1 Signal peptide CDS SAVERM_3325 4139724 4138180 hutH1 putative histidine ammonia-lyase EC:4.3.1.3, PF00221: Phenylalanine and histidine ammonia-lyase 5.19 53199 E metabolism of amino acids & related molecules 2.2 BAC71036.1 Non-secretory protein CDS SAVERM_3326 4140947 4139856 putative secreted protein PF00990: GGDEF domain 7.72 39207 E miscellaneous 4.7 BAC71037.1 Non-secretory protein CDS SAVERM_3327 4141893 4141081 echA9 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 6.26 28644 E metabolism of lipids 2.4 BAC71038.1 Non-secretory protein CDS SAVERM_3328 4142438 4142968 putative secreted protein 8.84 16080 E similar to unknown proteins 5 BAC71039.1 Signal peptide CDS SAVERM_3329 4144225 4143008 cyaA putative adenylate cyclase PF00211: Adenylate and Guanylate cyclase catalytic domain 4.29 43673 E metabolism of nucleotides & nucleic acids 2.3 BAC71040.1 Non-secretory protein CDS SAVERM_3330 4145296 4144421 birA putative biotin apo-protein ligase PF03099: Biotin/lipoate A/B protein ligase family 4.8 30208 E metabolism of coenzymes & prosthetic groups 2.5 BAC71041.1 Non-secretory protein CDS SAVERM_3331 4145450 4147048 accD4 putative acyl-CoA carboxylase, beta subunit PF01039: Carboxyl transferase domain 4.92 57840 E metabolism of coenzymes & prosthetic groups 2.5 BAC71042.1 Non-secretory protein CDS SAVERM_3332 4147065 4147274 putative secreted protein 11.22 7190 E similar to unknown proteins 5 BAC71043.1 Non-secretory protein CDS SAVERM_3333 4148542 4147295 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 6.71 44463 E miscellaneous 4.7 BAC71044.1 Non-secretory protein CDS SAVERM_3334 4148634 4148780 putative membrane protein 4.39 5373 E miscellaneous 4.7 BAC71045.1 Non-secretory protein CDS SAVERM_3335 4148785 4149405 putative septum formation protein PF02545: Maf-like protein 4.79 21683 E cell division 1.7 BAC71046.1 Non-secretory protein CDS SAVERM_3336 4149930 4149406 putative integral membrane protein 6.51 17882 E miscellaneous 4.7 BAC71047.1 Non-secretory protein CDS SAVERM_3337 4150323 4152095 accA3 putative acyl-CoA carboxylase, alpha subunit PF02786: Carbamoyl-phosphate synthase L chain, ATP binding domain 4.8 62229 E metabolism of lipids 2.4 BAC71048.1 Non-secretory protein CDS SAVERM_3338 4153447 4152374 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 6.57 39126 E regulation 3.5.2 BAC71049.1 Non-secretory protein CDS SAVERM_3339 4154661 4153735 putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 10.05 31935 E regulation 3.5.2 BAC71050.1 Non-secretory protein CDS SAVERM_3340 4156302 4154875 lpdA3 putative dihydrolipoamide dehydrogenase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.34 49645 E TCA cycle 2.1.3 BAC71051.1 Non-secretory protein CDS SAVERM_3341 4156420 4156857 hypothetical protein PF06094: AIG2-like family 4.98 16301 E similar to unknown proteins 5 BAC71052.1 Non-secretory protein CDS SAVERM_3342 4157159 4157983 deoD putative purine nucleoside phosphorylase PF00896: Phosphorylase family 2 5.14 28598 E metabolism of nucleotides & nucleic acids 2.3 BAC71053.1 Non-secretory protein CDS SAVERM_3343 4158185 4159816 pmmB putative phosphomannomutase PF02878: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 4.77 57996 E specific pathways 2.1.1 BAC71054.1 Non-secretory protein CDS SAVERM_3344 4161672 4159993 hypothetical protein PF01545: Cation efflux family 7.47 59529 E no similarity 6 BAC71055.1 Non-secretory protein CDS SAVERM_3345 4162571 4161915 putative integral membrane protein 10.64 23366 E miscellaneous 4.7 BAC71056.1 Non-secretory protein CDS SAVERM_3346 4162733 4163722 deoC putative deoxyribose-phosphate aldolase PF01791: Deoxyribose-phosphate aldolase 7.57 34416 E metabolism of nucleotides & nucleic acids 2.3 BAC71057.1 Non-secretory protein CDS SAVERM_3347 4163729 4165165 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.03 51191 E specific pathways 2.1.1 BAC71058.1 Non-secretory protein CDS SAVERM_3348 4165158 4166066 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 6.57 32003 E specific pathways 2.1.1 BAC71059.1 Non-secretory protein CDS SAVERM_3349 4166674 4166279 putative secreted protein 10.61 12672 E similar to unknown proteins 5 BAC71060.1 Signal peptide CDS SAVERM_3350 4166728 4167432 putative ATP-binding protein PF00485: Phosphoribulokinase / Uridine kinase family 8.6 25553 E miscellaneous 4.7 BAC71061.1 Non-secretory protein CDS SAVERM_3351 4168249 4167629 sig25 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4908, PF08281: Sigma-70, region 4 4.8 23188 E RNA initiation 3.5.1 BAC71062.1 Non-secretory protein CDS SAVERM_3352 4168730 4169407 smrA putative two-component system response regulator PF00072: Response regulator receiver domain 5.45 25105 E regulation 3.5.2 BAC71063.1 Non-secretory protein CDS SAVERM_3353 4169404 4170969 smrB putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.08 56175 E sensors 1.3 BAC71064.1 Non-secretory protein CDS SAVERM_3354 4171002 4171631 putative lipoprotein 9.06 21748 E transport / binding proteins & lipoproteins 1.2 BAC71065.1 Non-secretory protein CDS SAVERM_3355 4171759 4172310 putative integral membrane protein PF04892: VanZ like family 12.41 18978 E miscellaneous 4.7 BAC71066.1 Non-secretory protein CDS SAVERM_3356 4172399 4172602 hypothetical protein PF04024: PspC domain 11.26 7353 E similar to unknown proteins 5 BAC71067.1 Non-secretory protein CDS SAVERM_3357 4173044 4172712 putative secreted protein 10.95 10264 E miscellaneous 4.7 BAC71068.1 Signal peptide CDS SAVERM_3358 4174389 4173175 add3 putative adenosine deaminase PF00962: Adenosine/AMP deaminase 5.22 44586 E metabolism of nucleotides & nucleic acids 2.3 BAC71069.1 Non-secretory protein CDS SAVERM_3359 4174443 4175207 hypothetical protein PF00326: Prolyl oligopeptidase family 10.57 27256 E similar to unknown proteins 5 BAC71070.1 Non-secretory protein CDS SAVERM_3360 4176248 4175295 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 7.28 34609 E regulation 3.5.2 BAC71071.1 Non-secretory protein CDS SAVERM_3361 4176312 4177604 putative transport integral membrane protein PF07690: Major Facilitator Superfamily 11.1 43717 E transport / binding proteins & lipoproteins 1.2 BAC71072.1 Non-secretory protein CDS SAVERM_3362 4177745 4178875 dnaN2 putative DNA polymerase III beta subunit PF00712: DNA polymerase III beta subunit, N-terminal domain 4.64 39237 E DNA replication 3.1 BAC71073.1 Non-secretory protein CDS SAVERM_3363 4179014 4180018 sig26 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4895, PF04542: Sigma-70 region 2 4.44 36685 E RNA initiation 3.5.1 BAC71074.1 Non-secretory protein CDS SAVERM_3364 4180297 4179911 hypothetical protein 4.33 13196 E no similarity 6 BAC71075.1 Non-secretory protein CDS SAVERM_3365 4181710 4180427 deoA putative thymidine phosphorylase PF07831: Pyrimidine nucleoside phosphorylase C-terminal domain 4.72 44557 E metabolism of nucleotides & nucleic acids 2.3 BAC71076.1 Non-secretory protein CDS SAVERM_3366 4182195 4181779 cdd2 putative cytidine/deoxycytidine deaminase PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region 4.57 14207 E metabolism of nucleotides & nucleic acids 2.3 BAC71077.1 Non-secretory protein CDS SAVERM_3367 4183445 4182192 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.27 43715 E transport / binding proteins & lipoproteins 1.2 BAC71078.1 Non-secretory protein CDS SAVERM_3368 4184581 4183451 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.37 39523 E transport / binding proteins & lipoproteins 1.2 BAC71079.1 Non-secretory protein CDS SAVERM_3369 4186161 4184578 putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 4.76 56577 E transport / binding proteins & lipoproteins 1.2 BAC71080.1 Non-secretory protein CDS SAVERM_3370 4187498 4186443 putative simple sugar ABC transporter substrate-binding protein PF02608: Basic membrane protein 7.64 35580 E transport / binding proteins & lipoproteins 1.2 BAC71081.1 Signal peptide CDS SAVERM_7581 4188854 4187781 putative simple sugar ABC transporter substrate-binding protein PF02608: Basic membrane protein 6.53 37034 E transport / binding proteins & lipoproteins 1.2 BAC71082.1 Signal peptide CDS SAVERM_3371 4190340 4189087 putative metal-dependent amidase/aminoacylase/carboxypeptidase PF01546: Peptidase family M20/M25/M40 5.28 44231 E miscellaneous 4.7 BAC71083.1 Non-secretory protein CDS SAVERM_3372 4191786 4190713 hypothetical protein 10.88 39023 E similar to unknown proteins 5 BAC71084.1 Non-secretory protein CDS SAVERM_3373 4192748 4191813 neuB putative N-acetylneuraminic acid (Neu5Ac) synthase PF03102: NeuB family 5.44 34162 E specific pathways 2.1.1 BAC71085.1 Non-secretory protein CDS SAVERM_3374 4194060 4192762 putative transferase PF02348: Cytidylyltransferase 5.59 45461 E miscellaneous 4.7 BAC71086.1 Non-secretory protein CDS SAVERM_3375 4195448 4194093 hypothetical protein 9.66 48598 E similar to unknown proteins 5 BAC71087.1 Non-secretory protein CDS SAVERM_3376 4195647 4196627 putative glycosyltransferase, secreted PF00535: Glycosyl transferase 8.6 36647 E miscellaneous 4.7 BAC71088.1 Non-secretory protein CDS SAVERM_3377 4196624 4197958 hypothetical protein 6.33 48665 E similar to unknown proteins 5 BAC71089.1 Non-secretory protein CDS SAVERM_3378 4197991 4199139 putative membrane protein PF01757: Acyltransferase family 9.96 42110 E miscellaneous 4.7 BAC71090.1 Non-secretory protein CDS SAVERM_3379 4199886 4199236 putative TetR-family transcriptional regulator PF02909: Tetracyclin repressor, C-terminal all-alpha domain 5.75 23975 E regulation 3.5.2 BAC71091.1 Non-secretory protein CDS SAVERM_3380 4199925 4201361 putative FAD-binding monooxygenase PF01360: Monooxygenase 5.06 51120 E miscellaneous 4.7 BAC71092.1 Non-secretory protein CDS SAVERM_3381 4202011 4201358 putative LysE-type translocator PF01810: LysE type translocator 11.13 23029 E similar to unknown proteins 5 BAC71093.1 Non-secretory protein CDS SAVERM_3382 4203691 4202111 mcmA2 putative methylmalonyl-CoA mutase, alpha subunit PF01642: Methylmalonyl-CoA mutase 4.76 57337 E specific pathways 2.1.1 BAC71094.1 Non-secretory protein CDS SAVERM_3383 4203959 4204816 putative lipoprotein PF01471: Putative peptidoglycan binding domain 10.2 30830 E transport / binding proteins & lipoproteins 1.2 BAC71095.1 Signal peptide CDS SAVERM_3384 4206369 4205272 hypothetical protein 6.12 36291 E similar to unknown proteins 5 BAC71096.1 Non-secretory protein CDS SAVERM_3385 4207079 4206366 sig27 putative RNA polymerase ECF-subfamily sigma factor simialr to SCO4866, PF04542: Sigma-70 region 2 6.98 25698 E RNA initiation 3.5.1 BAC71097.1 Non-secretory protein CDS SAVERM_3386 4208129 4207446 hypothetical protein 11.11 23553 E similar to unknown proteins 5 BAC71098.1 Non-secretory protein CDS SAVERM_3387 4208843 4208154 sig28 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 9.65 24668 E RNA initiation 3.5.1 BAC71099.1 Non-secretory protein CDS SAVERM_3388 4209033 4211747 putative secreted protein Tat substrate, PF01839: FG-GAP repeat 4.56 90466 E similar to unknown proteins 5 BAC71100.1 Non-secretory protein CDS SAVERM_3389 4212282 4211824 hypothetical protein 7.35 16772 E similar to unknown proteins 5 BAC71101.1 Non-secretory protein CDS SAVERM_3390 4212917 4212357 hypothetical protein 4.86 19717 E similar to unknown proteins 5 BAC71102.1 Non-secretory protein CDS SAVERM_3391 4213529 4213002 hypothetical protein 3.97 18162 E similar to unknown proteins 5 BAC71103.1 Non-secretory protein CDS SAVERM_3392 4214691 4213630 hypothetical protein 7.86 37172 E similar to unknown proteins 5 BAC71104.1 Non-secretory protein CDS SAVERM_3393 4216363 4214726 nagZ2 putative beta-N-acetylhexosaminidase, secreted PF00728: Glycosyl hydrolase family 20, catalytic domain 10.29 58538 E cell wall 1.1 BAC71105.1 Non-secretory protein CDS SAVERM_3394 4216717 4217205 hypothetical protein PF09349: OHCU decarboxylase 5.31 17829 E similar to unknown proteins 5 BAC71106.1 Non-secretory protein CDS SAVERM_3395 4217404 4217784 sdhC1 putative succinate dehydrogenase cytochrome b-556 subunit (complex II) PF01127: Succinate dehydrogenase cytochrome b subunit 9.72 14223 E TCA cycle 2.1.3 BAC71107.1 Non-secretory protein CDS SAVERM_3396 4217790 4218272 sdhD putative succinate dehydrogenase hydrophobic membrane anchor protein (complex II) PF01127: Succinate dehydrogenase cytochrome b subunit 10.31 17694 E TCA cycle 2.1.3 BAC71108.1 Non-secretory protein CDS SAVERM_3397 4218295 4220049 sdhA1 putative succinate dehydrogenase flavoprotein subunit (complex II) PF00890: FAD binding domain 5.44 64683 E TCA cycle 2.1.3 BAC71109.1 Non-secretory protein CDS SAVERM_3398 4220049 4220822 sdhB1 putative succinate dehydrogenase iron-sulfur protein (complex II) PF00037: 4Fe-4S binding domain 5.85 29242 E TCA cycle 2.1.3 BAC71110.1 Non-secretory protein CDS SAVERM_3399 4221156 4220893 hypothetical protein PF05154: TM2 domain 9.25 9209 E similar to unknown proteins 5 BAC71111.1 Non-secretory protein CDS SAVERM_3400 4221835 4221425 hypothetical protein 10.38 14796 E similar to unknown proteins 5 BAC71112.1 Non-secretory protein CDS SAVERM_3401 4222328 4221828 hypothetical protein PF05154: TM2 domain 5.73 17188 E similar to unknown proteins 5 BAC71113.1 Non-secretory protein CDS SAVERM_3402 4224888 4222417 hypothetical protein 7.05 91023 E similar to unknown proteins 5 BAC71114.1 Non-secretory protein CDS SAVERM_3403 4225385 4224891 hypothetical protein 4.69 17663 E no similarity 6 BAC71115.1 Non-secretory protein CDS SAVERM_3404 4225432 4225845 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.23 14938 E similar to unknown proteins 5 BAC71116.1 Non-secretory protein CDS SAVERM_3405 4226006 4226413 hypothetical protein 6.97 14781 E similar to unknown proteins 5 BAC71117.1 Non-secretory protein CDS SAVERM_3406 4226410 4226928 hypothetical protein PF04134: Protein of unknown function, DUF393 9.03 18586 E similar to unknown proteins 5 BAC71118.1 Non-secretory protein CDS SAVERM_3407 4226939 4227736 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.27 29548 E regulation 3.5.2 BAC71119.1 Non-secretory protein CDS SAVERM_3408 4230178 4227749 putative integral membrane export protein PF03176: MMPL family 5.55 84592 E transport / binding proteins & lipoproteins 1.2 BAC71120.1 Non-secretory protein CDS SAVERM_3409 4230348 4231079 putative two-component system response regulator PF00072: Response regulator receiver domain 8.77 26909 E regulation 3.5.2 BAC71121.1 Non-secretory protein CDS SAVERM_3410 4231076 4232521 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.9 51940 E sensors 1.3 BAC71122.1 Non-secretory protein CDS SAVERM_3411 4233871 4232582 hypothetical protein PF00149: Calcineurin-like phosphoesterase 9.27 45470 E similar to unknown proteins 5 BAC71123.1 Non-secretory protein CDS SAVERM_3412 4234146 4233904 putative integral membrane protein phage attachment site is located in the coding region. 11.06 9005 E miscellaneous 4.7 BAC71124.1 Non-secretory protein CDS SAVERM_3413 4234250 4235593 dacB putative D-alanyl-D-alanine carboxypeptidase PF00768: D-alanyl-D-alanine carboxypeptidase 9.25 46528 E cell wall 1.1 BAC71125.1 Signal peptide CDS SAVERM_3414 4236575 4235541 putative membrane protein, ribonuclease BN-like family PF03631: Ribonuclease BN-like family 8.47 36722 E miscellaneous 4.7 BAC71126.1 Non-secretory protein CDS SAVERM_3415 4236669 4237433 putative dehydrogenase PF00106: short chain dehydrogenase 8.77 26801 E miscellaneous 4.7 BAC71127.1 Non-secretory protein CDS SAVERM_3416 4238429 4237848 putative secreted protein PF02834: 2',5' RNA ligase family 5.02 20571 E miscellaneous 4.7 BAC71128.1 Non-secretory protein CDS SAVERM_3417 4239579 4238566 trpS1 putative tryptophanyl-tRNA synthetase PF00579: tRNA synthetases class I (W and Y) 6.11 37096 E aminoacyl-tRNA-synthetase 3.7.2 BAC71129.1 Non-secretory protein CDS SAVERM_3418 4239779 4240402 hypothetical protein 7.7 22010 E similar to unknown proteins 5 BAC71130.1 Non-secretory protein CDS SAVERM_3419 4241875 4240427 glyA3 putative serine hydroxymethyltransferase PF00464: Serine hydroxymethyltransferase 5.62 51596 E metabolism of amino acids & related molecules 2.2 BAC71131.1 Non-secretory protein CDS SAVERM_3420 4242088 4243341 rocD1 putative ornithine aminotransferase Tat substrate, PF00202: Aminotransferase class-III 6.85 44278 E metabolism of amino acids & related molecules 2.2 BAC71132.1 Non-secretory protein CDS SAVERM_3421 4244543 4243356 putative glutathionylspermidine synthase PF03738: Glutathionylspermidine synthase 4.35 44140 E miscellaneous 4.7 BAC71133.1 Non-secretory protein CDS SAVERM_3422 4244936 4244574 putative secreted protein 10.24 11946 E similar to unknown proteins 5 BAC71134.1 Signal peptide CDS SAVERM_3423 4245054 4245878 putative integral membrane protein PF00892: Integral membrane protein DUF6 8.88 27158 E miscellaneous 4.7 BAC71135.1 Signal peptide CDS SAVERM_3424 4246339 4245920 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.57 15395 E regulation 3.5.2 BAC71136.1 Non-secretory protein CDS SAVERM_3425 4246533 4247384 putative DNA-binding protein PF01381: Helix-turn-helix 7.01 31332 E regulation 3.5.2 BAC71137.1 Non-secretory protein CDS SAVERM_3426 4247394 4247594 hypothetical protein PF04149: Domain of unknown function (DUF397) 7.62 6916 E no similarity 6 BAC71138.1 Non-secretory protein CDS SAVERM_3427 4249071 4247635 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 9.66 50879 E regulation 3.5.2 BAC71139.1 Non-secretory protein CDS SAVERM_3428 4249119 4249640 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 5.87 19322 E similar to unknown proteins 5 BAC71140.1 Non-secretory protein CDS SAVERM_3429 4249762 4250478 putative phosphonomutase PF02581: Thiamine monophosphate synthase/TENI 4.79 24587 E miscellaneous 4.7 BAC71141.1 Non-secretory protein CDS SAVERM_3430 4251499 4250525 proX putative glycine betaine ABC transporter substrate-binding protein PF04069: Substrate binding domain of ABC-type glycine betaine transport system 9.64 35994 E transport / binding proteins & lipoproteins 1.2 BAC71142.1 Signal peptide CDS SAVERM_3431 4253444 4251501 proW putative glycine betaine ABC transporter permease protein Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 10.33 66878 E transport / binding proteins & lipoproteins 1.2 BAC71143.1 Non-secretory protein CDS SAVERM_3432 4254613 4253444 proV putative glycine betaine ABC transporter ATP-binding protein PF00005: ABC transporter 4.88 41465 E transport / binding proteins & lipoproteins 1.2 BAC71144.1 Non-secretory protein CDS SAVERM_3433 4256160 4254610 putative oxidoreductase PF00732: GMC oxidoreductase 4.89 56916 E miscellaneous 4.7 BAC71145.1 Non-secretory protein CDS SAVERM_3434 4257800 4256271 gbsA2 putative glycine betaine aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.1 54201 E adaptation to atypical conditions 4.1 BAC71146.1 Non-secretory protein CDS SAVERM_3435 4259335 4258097 hypothetical protein PF04554: Extensin-like region 3.99 42403 E similar to unknown proteins 5 BAC71147.1 Non-secretory protein CDS SAVERM_3436 4260496 4259507 mdh putative malate/lactate dehydrogenase PF02866: lactate/malate dehydrogenase, alpha/beta C-terminal domain 4.76 34689 E TCA cycle 2.1.3 BAC71148.1 Non-secretory protein CDS SAVERM_3437 4262277 4261015 putative membrane protein PF01381: Helix-turn-helix 9.8 42177 E miscellaneous 4.7 BAC71149.1 Non-secretory protein CDS SAVERM_3438 4263129 4262617 putative membrane protein 6.78 18237 E miscellaneous 4.7 BAC71150.1 Non-secretory protein CDS SAVERM_3439 4263664 4264200 putative secreted protein 5.21 18791 E no similarity 6 BAC71151.1 Signal peptide CDS SAVERM_3440 4264899 4264282 putative membrane protein PF01381: Helix-turn-helix 11.14 21464 E miscellaneous 4.7 BAC71152.1 Non-secretory protein CDS SAVERM_3441 4265803 4265174 hypothetical protein PF11222: Protein of unknown function (DUF3017) 4.54 21191 E similar to unknown proteins 5 BAC71153.1 Non-secretory protein CDS SAVERM_3442 4266758 4265904 folD1 putative methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase PF02882: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain 6.25 29667 E metabolism of coenzymes & prosthetic groups 2.5 BAC71154.1 Non-secretory protein CDS SAVERM_3443 4267000 4267671 hypothetical protein PF06271: RDD family 8.73 23128 E similar to unknown proteins 5 BAC71155.1 Non-secretory protein CDS SAVERM_3444 4269417 4267834 purH putative bifunctional purine biosynthesis protein PF01808: AICARFT/IMPCHase bienzyme 5.19 55867 E metabolism of nucleotides & nucleic acids 2.3 BAC71156.1 Non-secretory protein CDS SAVERM_3445 4270043 4269414 purN putative phosphoribosylglycinamide formyltransferase PF00551: Formyl transferase 5.38 22491 E metabolism of nucleotides & nucleic acids 2.3 BAC71157.1 Non-secretory protein CDS SAVERM_3446 4270386 4271324 hypothetical protein 5.41 31794 E similar to unknown proteins 5 BAC71158.1 Non-secretory protein CDS SAVERM_3447 4271809 4271414 hypothetical protein 3.9 13235 E similar to unknown proteins 5 BAC71159.1 Non-secretory protein CDS SAVERM_3448 4272148 4271816 putative secreted protein 12.85 11029 E similar to unknown proteins 5 BAC71160.1 Non-secretory protein CDS SAVERM_3449 4273145 4272171 putative integral membrane protein 11.75 32473 E miscellaneous 4.7 BAC71161.1 Non-secretory protein CDS SAVERM_3450 4273338 4274450 hypothetical protein PF08281: Sigma-70, region 4 9.37 40142 E similar to unknown proteins 5 BAC71162.1 Non-secretory protein CDS SAVERM_3451 4275485 4274601 sucD2 putative succinyl-CoA synthetase alpha subunit PF02629: CoA binding domain 5.72 29802 E TCA cycle 2.1.3 BAC71163.1 Non-secretory protein CDS SAVERM_3452 4276685 4275507 sucC2 putative succinyl-CoA synthetase beta subunit PF08442: ATP-grasp domain 4.38 41106 E TCA cycle 2.1.3 BAC71164.1 Non-secretory protein CDS SAVERM_3453 4279029 4277143 putative secreted protein Tat substrate, threonine-rich protein 4.93 60085 E similar to unknown proteins 5 BAC71165.1 Signal peptide CDS SAVERM_3454 4280501 4279317 hypothetical protein 11.19 38921 E similar to unknown proteins 5 BAC71166.1 Non-secretory protein CDS SAVERM_3455 4281710 4280661 hypothetical protein PF05762: VWA domain containing CoxE-like protein 6.07 37587 E similar to unknown proteins 5 BAC71167.1 Non-secretory protein CDS SAVERM_3456 4284355 4281929 hypothetical protein 5.12 85928 E similar to unknown proteins 5 BAC71168.1 Non-secretory protein CDS SAVERM_3457 4285732 4284524 putative MoxR-like ATPase PF07728: ATPase family associated with various cellular activities (AAA) 4.89 42842 E miscellaneous 4.7 BAC71169.1 Non-secretory protein CDS SAVERM_3458 4286007 4287221 hypothetical protein PF04434: SWIM zinc finger 6.53 43002 E similar to unknown proteins 5 BAC71170.1 Non-secretory protein CDS SAVERM_3459 4287278 4288918 hypothetical protein 5.98 57793 E similar to unknown proteins 5 BAC71171.1 Non-secretory protein CDS SAVERM_3460 4289628 4289212 icmB isobutyryl-CoA mutase, chain B PF02310: B12 binding domain 4.91 14300 E metabolism of lipids 2.4 BAC71172.1 Non-secretory protein CDS SAVERM_3461 4290165 4291025 putative lipase PF05057: Putative serine esterase (DUF676) 7.88 30720 E metabolism of lipids 2.4 BAC71173.1 Non-secretory protein CDS SAVERM_3462 4291312 4292910 putative zoocin A (family M23 peptidase) PF01551: Peptidase family M23 4.53 55998 E protein modification 3.8 BAC71174.1 Non-secretory protein CDS SAVERM_3463 4295642 4293057 uvrD1 putative ATP-dependent DNA helicase PF00580: UvrD/REP helicase 4.86 93783 E DNA modification & repair 3.2 BAC71175.1 Non-secretory protein CDS SAVERM_3464 4296320 4297516 putative NLP/P60-family secreted protein (PgpA peptidase) Seems to have no N-terminal signal sequence, PF00877: NlpC/P60 family 9.05 42117 E miscellaneous 4.7 BAC71176.1 Signal peptide CDS SAVERM_3465 4297586 4298611 putative integral membrane protein PF03595: C4-dicarboxylate transporter/malic acid transport protein 10.57 36221 E miscellaneous 4.7 BAC71177.1 Non-secretory protein CDS SAVERM_3466 4298942 4298589 putative integral membrane protein 9.17 12433 E miscellaneous 4.7 BAC71178.1 Non-secretory protein CDS SAVERM_3467 4299352 4300428 putative NLP/P60-family secreted protein (PgpA peptidase) PF00877: NlpC/P60 family 10.43 38012 E miscellaneous 4.7 BAC71179.1 Non-secretory protein CDS SAVERM_3468 4300610 4301392 hypothetical protein 11.8 27627 E no similarity 6 BAC71180.1 Non-secretory protein CDS SAVERM_3469 4301591 4301418 hypothetical protein 4.77 5494 E no similarity 6 BAC71181.1 Non-secretory protein CDS SAVERM_3470 4302469 4301738 putative two-component system response regulator PF00196: Bacterial regulatory proteins, luxR family 5.7 26203 E regulation 3.5.2 BAC71182.1 Non-secretory protein CDS SAVERM_3471 4303755 4302466 putative two-component system sensor kinase PF04024: PspC domain 9.56 46056 E sensors 1.3 BAC71183.1 Non-secretory protein CDS SAVERM_3472 4303934 4305370 hypothetical protein PF04024: PspC domain 6 49507 E similar to unknown proteins 5 BAC71184.1 Non-secretory protein CDS SAVERM_3473 4305357 4305617 putative secreted protein 6.95 8965 E no similarity 6 BAC71185.1 Non-secretory protein CDS SAVERM_3474 4306331 4305813 hypothetical protein PF07681: DoxX 9.25 18558 E similar to unknown proteins 5 BAC71186.1 Non-secretory protein CDS SAVERM_3475 4307801 4306512 putative membrane protein 8.64 44198 E miscellaneous 4.7 BAC71187.1 Non-secretory protein CDS SAVERM_3476 4308124 4309002 hypothetical protein 5.76 32273 E similar to unknown proteins 5 BAC71188.1 Non-secretory protein CDS SAVERM_3477 4309829 4309008 fucA1 putative fuculose-1-phosphate aldolase PF00596: Class II Aldolase and Adducin N-terminal domain 5.9 30124 E miscellaneous 4.7 BAC71189.1 Non-secretory protein CDS SAVERM_3478 4310058 4310534 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 5.68 17516 E similar to unknown proteins 5 BAC71190.1 Non-secretory protein CDS SAVERM_3479 4312144 4310567 guaA putative GMP synthase PF00117: Glutamine amidotransferase class-I 4.51 56785 E metabolism of nucleotides & nucleic acids 2.3 BAC71191.1 Non-secretory protein CDS SAVERM_3480 4313571 4312291 putative two-component system sensor kinase Tat substrate, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.4 45490 E sensors 1.3 BAC71192.1 Non-secretory protein CDS SAVERM_3481 4314289 4313612 putative two-component system response regulator PF00072: Response regulator receiver domain 5.05 25077 E regulation 3.5.2 BAC71193.1 Non-secretory protein CDS SAVERM_3482 4314888 4316384 putative di-tripeptide transporter PF00854: POT family 9.69 53172 E transport / binding proteins & lipoproteins 1.2 BAC71194.1 Non-secretory protein CDS SAVERM_3483 4317110 4316481 putative phosphoglycerate mutase PF00300: Phosphoglycerate mutase family 6.9 22736 E main glycolytic pathways 2.1.2 BAC71195.1 Non-secretory protein CDS SAVERM_3484 4318536 4317304 putative secreted protein 5.01 39987 E similar to unknown proteins 5 BAC71196.1 Signal peptide CDS SAVERM_3485 4319714 4318608 putative secreted protein 10.24 38045 E similar to unknown proteins 5 BAC71197.1 Signal peptide CDS SAVERM_3486 4320781 4319729 putative secreted protein 11.2 35622 E similar to unknown proteins 5 BAC71198.1 Signal peptide CDS SAVERM_3487 4321568 4320873 putative secreted protein PF00746: Gram positive anchor 10.23 22803 E similar to unknown proteins 5 BAC71199.1 Signal peptide CDS SAVERM_3488 4322399 4321740 putative regulator protein containing histidine kinase domain similar to sigma factor regulator prsI, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.66 22211 E regulation 3.5.2 BAC71200.1 Non-secretory protein CDS SAVERM_3489 4323023 4322655 putative anti-sigma factor antagonist PF01740: STAS domain 4.48 12728 E regulation 3.5.2 BAC71201.1 Non-secretory protein CDS SAVERM_3490 4323274 4324194 sig29 putative RNA polymerase sigma factor similar to SCO3068:sigI, RNA polymerase alternative sigma factor, PF04539: Sigma-70 region 3 4.72 34066 E RNA initiation 3.5.1 BAC71202.1 Non-secretory protein CDS SAVERM_3491 4324523 4326172 hypothetical protein PF00652: QXW lectin repeat 8.97 58007 E similar to unknown proteins 5 BAC71203.1 Non-secretory protein CDS SAVERM_3492 4326262 4326837 putative secreted protein 3.63 20780 E no similarity 6 BAC71204.1 Non-secretory protein CDS SAVERM_3493 4328100 4326856 hutI putative imidazolonepropionase (imidazolone-5-propionate hydrolase) EC:3.5.2.7 5.72 43341 E metabolism of amino acids & related molecules 2.2 BAC71205.1 Non-secretory protein CDS SAVERM_3494 4329470 4328136 putative chlorohydrolase PF01979: Amidohydrolase family 6.25 46611 E miscellaneous 4.7 BAC71206.1 Non-secretory protein CDS SAVERM_3495 4330708 4329467 putative amino acid hydrolase PF01546: Peptidase family M20/M25/M40 4.98 43747 E metabolism of amino acids & related molecules 2.2 BAC71207.1 Non-secretory protein CDS SAVERM_3496 4332369 4330705 hutU putative urocanate hydratase EC:4.2.1.49 4.97 59870 E metabolism of amino acids & related molecules 2.2 BAC71208.1 Non-secretory protein CDS SAVERM_3497 4332475 4333932 lysA3 putative diaminopimelate decarboxylase PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain 6.52 49464 E miscellaneous 4.7 BAC71209.1 Non-secretory protein CDS SAVERM_3498 4334240 4334635 hypothetical protein 4.47 13938 E similar to unknown proteins 5 BAC71210.1 Non-secretory protein CDS SAVERM_3499 4334632 4335756 hypothetical protein 8.28 38874 E similar to unknown proteins 5 BAC71211.1 Non-secretory protein CDS SAVERM_3500 4335795 4336316 hypothetical protein PF03259: Roadblock/LC7 domain 10.52 17775 E similar to unknown proteins 5 BAC71212.1 Non-secretory protein CDS SAVERM_3501 4336331 4336705 hypothetical protein 6.25 13256 E similar to unknown proteins 5 BAC71213.1 Non-secretory protein CDS SAVERM_3502 4337297 4336713 putative integral membrane protein 12.47 20094 E miscellaneous 4.7 BAC71214.1 Signal peptide CDS SAVERM_3503 4338343 4337483 putative transcriptional regulator PF01418: Helix-turn-helix domain, rpiR family 5.63 30562 E regulation 3.5.2 BAC71215.1 Non-secretory protein CDS SAVERM_3504 4339986 4338340 hutH2 putative histidine ammonia-lyase EC:4.3.1.3, PF00221: Phenylalanine and histidine ammonia-lyase 5.9 56787 E metabolism of amino acids & related molecules 2.2 BAC71216.1 Non-secretory protein CDS SAVERM_3505 4340087 4341157 opuBA1 putative ABC transporter ATP-binding protein osmoprotectant transport system substrate-binding protin, PF00005: ABC transporter 6.74 38244 E transport / binding proteins & lipoproteins 1.2 BAC71217.1 Non-secretory protein CDS SAVERM_3506 4341154 4341795 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 10.61 22818 E transport / binding proteins & lipoproteins 1.2 BAC71218.1 Non-secretory protein CDS SAVERM_3507 4341774 4342493 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 9.42 25221 E transport / binding proteins & lipoproteins 1.2 BAC71219.1 Non-secretory protein CDS SAVERM_3508 4342514 4343452 putative ABC transporter substrate-binding protein Tat substrate, PF04069: Substrate binding domain of ABC-type glycine betaine transport system 6.96 32672 E transport / binding proteins & lipoproteins 1.2 BAC71220.1 Signal peptide CDS SAVERM_3509 4343554 4343979 hypothetical protein 5.27 15546 E similar to unknown proteins 5 BAC71221.1 Non-secretory protein CDS SAVERM_3510 4345772 4344378 cysM1 putative cystathionine beta-synthase PF00291: Pyridoxal-phosphate dependent enzyme 4.53 49048 E metabolism of amino acids & related molecules 2.2 BAC71222.1 Non-secretory protein CDS SAVERM_3511 4345918 4346958 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 10.23 35774 E miscellaneous 4.7 BAC71223.1 Non-secretory protein CDS SAVERM_3512 4347182 4348405 fadA2 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF00108: Thiolase, N-terminal domain 4.67 42778 E metabolism of lipids 2.4 BAC71224.1 Non-secretory protein CDS SAVERM_3513 4348715 4349512 putative secreted protein 4.33 28058 E miscellaneous 4.7 BAC71225.1 Signal peptide CDS SAVERM_3514 4349866 4349555 hypothetical protein 4.42 10990 E similar to unknown proteins 5 BAC71226.1 Non-secretory protein CDS SAVERM_3515 4349971 4350201 hypothetical protein 9.26 8885 E similar to unknown proteins 5 BAC71227.1 Non-secretory protein CDS SAVERM_3516 4351181 4350300 putative integral membrane protein PF06539: Protein of unknown function (DUF1112) 9.44 30792 E miscellaneous 4.7 BAC71228.1 Non-secretory protein CDS SAVERM_3517 4352609 4351218 pobA putative p-hydroxybenzoate hydroxylase PF01360: Monooxygenase 7.68 50969 E metabolism of coenzymes & prosthetic groups 2.5 BAC71229.1 Non-secretory protein CDS SAVERM_3518 4353613 4352756 putative secreted protein PF01040: UbiA prenyltransferase family 10.26 30789 E no similarity 6 BAC71230.1 Non-secretory protein CDS SAVERM_3519 4355043 4353631 cyp15 cytochrome P450 hydroxylase CYP107V1, pobA is located at downstream 5.77 50546 E metabolism of coenzymes & prosthetic groups 2.5 BAC71231.1 Non-secretory protein CDS SAVERM_3520 4355435 4355040 hypothetical protein PF07366: SnoaL-like polyketide cyclase 6.67 14517 E no similarity 6 BAC71232.1 Non-secretory protein CDS SAVERM_3521 4356544 4355459 fabH8 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 8.28 38767 E metabolism of lipids 2.4 BAC71233.1 Non-secretory protein CDS SAVERM_3522 4359637 4356548 ppsA putative phosphoenolpyruvate synthase PF00391: PEP-utilising enzyme, mobile domain 7.01 110163 E specific pathways 2.1.1 BAC71234.1 Non-secretory protein CDS SAVERM_3523 4360282 4359641 hypothetical protein PF04140: Isoprenylcysteine carboxyl methyltransferase (ICMT) family 10.54 23346 E similar to unknown proteins 5 BAC71235.1 Signal peptide CDS SAVERM_3524 4361172 4360279 hypothetical protein contains a half of A-factor biosynthesis repeat 9.65 32604 E no similarity 6 BAC71236.1 Non-secretory protein CDS SAVERM_3525 4361587 4362429 putative oxidoreductase PF05368: NmrA-like family 9.94 30551 E similar to unknown proteins 5 BAC71237.1 Non-secretory protein CDS SAVERM_3526 4363118 4363888 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.49 27496 E transport / binding proteins & lipoproteins 1.2 BAC71238.1 Non-secretory protein CDS SAVERM_3527 4363962 4366490 putative ABC transporter permease protein PF02687: Predicted permease 9.97 87896 E transport / binding proteins & lipoproteins 1.2 BAC71239.1 Signal peptide CDS SAVERM_3528 4367847 4366558 cfa putative cyclopropane fatty acid synthase PF02353: Cyclopropane-fatty-acyl-phospholipid synthase 8.11 47786 E metabolism of lipids 2.4 BAC71240.1 Non-secretory protein CDS SAVERM_3529 4369359 4368052 ndh2 putative NADH dehydrogenase (complex I) PF00070: Pyridine nucleotide-disulphide oxidoreductase 8.56 47435 E membrane bioenergetics 1.4 BAC71241.1 Non-secretory protein CDS SAVERM_3530 4370970 4370029 ppx1 putative exopolyphosphatase PF02541: Ppx/GppA phosphatase family 4.68 33878 E miscellaneous 4.7 BAC71242.1 Non-secretory protein CDS SAVERM_3531 4371629 4371105 hypothetical protein PF04417: Protein of unknown function (DUF501) 4.86 18653 E similar to unknown proteins 5 BAC71243.1 Non-secretory protein CDS SAVERM_3532 4372152 4371658 divIC putative part of cell division apparatus PF04977: Septum formation initiator 10.9 18902 E miscellaneous 4.7 BAC71244.1 Non-secretory protein CDS SAVERM_3533 4373537 4372251 eno putative enolase PF00113: Enolase, C-terminal TIM barrel domain 4.25 45869 E main glycolytic pathways 2.1.2 BAC71245.1 Non-secretory protein CDS SAVERM_3534 4374562 4373879 putative secreted protein PF06737: Transglycosylase-like domain 9.86 23277 E miscellaneous 4.7 BAC71246.1 Signal peptide CDS SAVERM_3535 4375882 4374923 putative secreted protein PF06737: Transglycosylase-like domain 4.19 31374 E miscellaneous 4.7 BAC71247.1 Signal peptide CDS SAVERM_3536 4376290 4377663 cyp16 putative cytochrome P450 CYP107U2 7.35 50512 E metabolism of coenzymes & prosthetic groups 2.5 BAC71248.1 Non-secretory protein CDS SAVERM_3537 4378752 4377718 putative MazG-family transcriptional regulator PF03819: MazG nucleotide pyrophosphohydrolase domain 4.44 36609 E regulation 3.5.2 BAC71249.1 Non-secretory protein CDS SAVERM_3538 4379606 4378947 putative lipoprotein 10.37 23577 E transport / binding proteins & lipoproteins 1.2 BAC71250.1 Signal peptide CDS SAVERM_3539 4380481 4379753 hypothetical protein PF08924: Domain of unknown function (DUF1906) 8.81 25834 E no similarity 6 BAC71251.1 Non-secretory protein CDS SAVERM_3540 4382199 4380736 pkn6 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.7 53368 E protein modification 3.8 BAC71252.1 Non-secretory protein CDS SAVERM_3541 4382855 4382265 putative integral membrane protein 8.23 21140 E miscellaneous 4.7 BAC71253.1 Non-secretory protein CDS SAVERM_3542 4385047 4383011 savM1 putative type II restriction-modification system DNA adenine-specific methylase weak homology to hsdM, PF02384: N-6 DNA Methylase 6.36 72329 E DNA modification & repair 3.2 BAC71254.1 Non-secretory protein CDS SAVERM_3543 4385750 4386499 putative lipoprotein 5.01 25850 E transport / binding proteins & lipoproteins 1.2 BAC71255.1 Signal peptide CDS SAVERM_3544 4387428 4386709 putative lipoprotein 9.95 25224 E transport / binding proteins & lipoproteins 1.2 BAC71256.1 Signal peptide CDS SAVERM_3545 4388547 4387621 hypothetical protein 4.81 32876 E similar to unknown proteins 5 BAC71257.1 Non-secretory protein CDS SAVERM_3546 4388666 4389268 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.42 21317 E regulation 3.5.2 BAC71258.1 Non-secretory protein CDS SAVERM_3547 4389314 4390057 putative ketoreductase PF00106: short chain dehydrogenase 6.98 25506 E miscellaneous 4.7 BAC71259.1 Non-secretory protein CDS SAVERM_3548 4390561 4390175 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 11.57 13316 E regulation 3.5.2 BAC71260.1 Non-secretory protein CDS SAVERM_3549 4394151 4390621 mfd putative transcriptional-repair coupling factor PF02559: CarD-like/TRCF domain 5.09 128708 E RNA elongation 3.5.3 BAC71261.1 Non-secretory protein CDS SAVERM_3550 4396976 4394409 putative ABC transporter permease protein PF02687: Predicted permease 10.21 89325 E transport / binding proteins & lipoproteins 1.2 BAC71262.1 Signal peptide CDS SAVERM_3551 4397761 4396973 putative ABC transporter ATP-binding protein PF00005: ABC transporter 9.06 28296 E transport / binding proteins & lipoproteins 1.2 BAC71263.1 Non-secretory protein CDS SAVERM_3552 4398149 4399708 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 10.58 54035 E transport / binding proteins & lipoproteins 1.2 BAC71264.1 Non-secretory protein CDS SAVERM_3553 4400034 4400513 hypothetical protein PF04341: Protein of unknown function, DUF485 9.98 17722 E similar to unknown proteins 5 BAC71265.1 Non-secretory protein CDS SAVERM_3554 4400510 4402156 putative sodium:solute symporter PF00474: Sodium:solute symporter family 8.66 57027 E transport / binding proteins & lipoproteins 1.2 BAC71266.1 Non-secretory protein CDS SAVERM_3555 4403131 4402232 hypothetical protein PF05103: DivIVA protein 5.11 33406 E similar to unknown proteins 5 BAC71267.1 Non-secretory protein CDS SAVERM_3556 4406136 4403425 putative secreted protein PF01391: Collagen triple helix repeat (20 copies) 5.14 87231 E similar to unknown proteins 5 BAC71268.1 Non-secretory protein CDS SAVERM_3557 4407496 4406510 hypothetical protein PF09346: SMI1 / KNR4 family 5.37 35171 E similar to unknown proteins 5 BAC71269.1 Non-secretory protein CDS SAVERM_3558 4407750 4408250 hypothetical protein 11.1 17724 E similar to unknown proteins 5 BAC71270.1 Non-secretory protein CDS SAVERM_3559 4408326 4408820 hypothetical protein 5.75 17730 E similar to unknown proteins 5 BAC71271.1 Non-secretory protein CDS SAVERM_3560 4410157 4408838 putative two-component system sensor kinase PF07730: Histidine kinase 7.71 46396 E sensors 1.3 BAC71272.1 Non-secretory protein CDS SAVERM_3561 4410718 4412166 glmU putative UDP-N-acetylglucosamine pyrophosphorylase PF00483: Nucleotidyl transferase 6.4 49998 E cell wall 1.1 BAC71273.1 Non-secretory protein CDS SAVERM_3562 4412314 4413288 prsA1 putative ribose-phosphate pyrophosphokinase PF00156: Phosphoribosyl transferase domain 6.18 35337 E metabolism of nucleotides & nucleic acids 2.3 BAC71274.1 Non-secretory protein CDS SAVERM_3563 4413467 4414060 rplY putative ribosomal protein L25 PF01386: Ribosomal L25p family 4.52 20726 E ribosomal protein 3.7.1 BAC71275.1 Non-secretory protein CDS SAVERM_3564 4414139 4414750 pth putative peptidyl-tRNA hydrolase PF00472: Peptidyl-tRNA hydrolase domain 8.94 21960 E elongation 3.7.4 BAC71276.1 Non-secretory protein CDS SAVERM_3565 4414835 4415347 hypothetical protein 11.8 17569 E similar to unknown proteins 5 BAC71277.1 Non-secretory protein CDS SAVERM_3566 4418168 4415436 ppc putative phosphoenolpyruvate carboxylase PF00311: Phosphoenolpyruvate carboxylase 6.21 101199 E main glycolytic pathways 2.1.2 BAC71278.1 Non-secretory protein CDS SAVERM_3567 4418467 4419477 fadS3 putative fatty acid desaturase PF00487: Fatty acid desaturase 9.88 37859 E metabolism of lipids 2.4 BAC71279.1 Non-secretory protein CDS SAVERM_3568 4419474 4420151 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9 24876 E regulation 3.5.2 BAC71280.1 Non-secretory protein CDS SAVERM_3569 4420634 4420266 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 7.07 13323 E similar to unknown proteins 5 BAC71281.1 Non-secretory protein CDS SAVERM_3570 4421443 4420634 putative trans-aconitate methyltransferase PF05175: Methyltransferase small domain 6.04 29324 E specific pathways 2.1.1 BAC71282.1 Non-secretory protein CDS SAVERM_3571 4421595 4422092 putative MarR-family transcriptional regulator PF01047: MarR family 6.56 18697 E regulation 3.5.2 BAC71283.1 Non-secretory protein CDS SAVERM_3572 4422830 4422051 putative two-component system response regulator PF00196: Bacterial regulatory proteins, luxR family 9.53 27212 E regulation 3.5.2 BAC71284.1 Non-secretory protein CDS SAVERM_3573 4423042 4423533 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 7.63 18902 E miscellaneous 4.7 BAC71285.1 Non-secretory protein CDS SAVERM_3574 4424671 4423526 galK putative galactokinase PF00288: GHMP kinases putative ATP-binding protein 4.81 40202 E specific pathways 2.1.1 BAC71286.1 Non-secretory protein CDS SAVERM_3575 4425634 4424675 galE1 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 5.04 33613 E specific pathways 2.1.1 BAC71287.1 Non-secretory protein CDS SAVERM_3576 4426716 4425631 galT putative galactose-1-phosphate uridylyltransferase PF01087: Galactose-1-phosphate uridyl transferase, N-terminal domain 4.79 40100 E specific pathways 2.1.1 BAC71288.1 Non-secretory protein CDS SAVERM_3577 4426894 4428603 putative Na+/galactose cotransporter PF00474: Sodium:solute symporter family 8.65 61052 E transport / binding proteins & lipoproteins 1.2 BAC71289.1 Non-secretory protein CDS SAVERM_3578 4428625 4428912 hypothetical protein 4.25 10346 E similar to unknown proteins 5 BAC71290.1 Non-secretory protein CDS SAVERM_3579 4429108 4429905 hypothetical protein PF07398: Protein of unknown function (DUF1503) 4.35 28136 E similar to unknown proteins 5 BAC71291.1 Non-secretory protein CDS SAVERM_3580 4430349 4430834 putative secreted protein 8.69 15504 E similar to unknown proteins 5 BAC71292.1 Signal peptide CDS SAVERM_3581 4431705 4430980 putative two-component system response regulator PF00196: Bacterial regulatory proteins, luxR family 7.69 24999 E regulation 3.5.2 BAC71293.1 Non-secretory protein CDS SAVERM_3582 4433449 4431956 putative membrane protein PF01011: PQQ enzyme repeat 4.86 51223 E miscellaneous 4.7 BAC71294.1 Non-secretory protein CDS SAVERM_3583 4435787 4433916 putative membrane protein PF04554: Extensin-like region 6.34 65642 E miscellaneous 4.7 BAC71295.1 Non-secretory protein CDS SAVERM_3584 4437816 4436011 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.32 66672 E transport / binding proteins & lipoproteins 1.2 BAC71296.1 Non-secretory protein CDS SAVERM_3585 4439246 4437912 hypothetical protein PF01757: Acyltransferase family 11.48 47334 E similar to unknown proteins 5 BAC71297.1 Non-secretory protein CDS SAVERM_3586 4440294 4439401 ispE putative 4-(cytidine-5’-diphospho)-2-C-methyl-D-erythritol kinase MEP pathway, EC 2.7.1.148 4.37 29713 E specific pathways 2.1.1 BAC71298.1 Non-secretory protein CDS SAVERM_3587 4441197 4440310 ksgA putative dimethyladenosine transferase PF00398: Ribosomal RNA adenine dimethylase 6.37 31021 E detoxification 4.2 BAC71299.1 Non-secretory protein CDS SAVERM_3588 4443094 4441559 hypothetical protein PF03990: Domain of unknown function (DUF348) 7.36 55139 E similar to unknown proteins 5 BAC71300.1 Non-secretory protein CDS SAVERM_3589 4444062 4443175 putative deoxyribonuclease PF01026: TatD related DNase 5.55 31324 E DNA modification & repair 3.2 BAC71301.1 Non-secretory protein CDS SAVERM_3590 4444598 4444182 hypothetical protein 7.19 15371 E similar to unknown proteins 5 BAC71302.1 Non-secretory protein CDS SAVERM_3591 4445832 4444966 putative tetrapyrrole methylase PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 4.78 30657 E metabolism of coenzymes & prosthetic groups 2.5 BAC71303.1 Non-secretory protein CDS SAVERM_3592 4445895 4447634 putative integral membrane protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 9.33 64733 E miscellaneous 4.7 BAC71304.1 Non-secretory protein CDS SAVERM_3593 4449642 4450097 hypothetical protein PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region 7.88 16658 E similar to unknown proteins 5 BAC71305.1 Non-secretory protein CDS SAVERM_3594 4450251 4451030 hypothetical protein 6.04 28935 E no similarity 6 BAC71306.1 Non-secretory protein CDS SAVERM_3595 4451252 4451962 hypothetical protein 4.48 26519 E no similarity 6 BAC71307.1 Non-secretory protein CDS SAVERM_3596 4452179 4451880 hypothetical protein 12.24 11097 E no similarity 6 BAC71308.1 Non-secretory protein CDS SAVERM_3597 4453570 4452893 hypothetical protein PF02683: Cytochrome C biogenesis protein transmembrane region 11.71 22937 E similar to unknown proteins 5 BAC71309.1 Non-secretory protein CDS SAVERM_3598 4454104 4454766 hypothetical protein 4.45 24209 E similar to unknown proteins 5 BAC71310.1 Non-secretory protein CDS SAVERM_3599 4454905 4456275 putative peroxidase PF04261: Dyp-type peroxidase family 5.93 49758 E miscellaneous 4.7 BAC71311.1 Non-secretory protein CDS SAVERM_3600 4456330 4457460 hypothetical protein 4.69 41821 E similar to unknown proteins 5 BAC71312.1 Non-secretory protein CDS SAVERM_3601 4457596 4458960 gadB1 putative glutamate decarboxylase PF00282: Pyridoxal-dependent decarboxylase conserved domain 5.01 51371 E metabolism of amino acids & related molecules 2.2 BAC71313.1 Non-secretory protein CDS SAVERM_3602 4460207 4459065 hypothetical protein 11.25 39460 E no similarity 6 BAC71314.1 Non-secretory protein CDS SAVERM_3603 4460304 4461935 pbp3 putative penicillin-binding protein, secreted PF05223: NTF2-like N-terminal transpeptidase domain 5.92 55326 E cell wall 1.1 BAC71315.1 Non-secretory protein CDS SAVERM_3604 4462029 4463702 pbp4 putative penicillin-binding protein, secreted PF05223: NTF2-like N-terminal transpeptidase domain 10.61 57916 E cell wall 1.1 BAC71316.1 Non-secretory protein CDS SAVERM_3605 4464088 4463747 ssgE putative cell division protein (probably stimulation of autolysis) PF04686: Streptomyces sporulation and cell division protein, SsgA 6.96 12724 E regulation 3.5.2 BAC71317.1 Non-secretory protein CDS SAVERM_3606 4464253 4465308 cbiM putative cobalt ABC transporter permease protein PF01891: CbiM 10.66 35501 E transport / binding proteins & lipoproteins 1.2 BAC71318.1 Non-secretory protein CDS SAVERM_3607 4465310 4466071 cbiQ putative cobalt ABC transporter permease protein PF02361: Cobalt transport protein 10.99 27611 E transport / binding proteins & lipoproteins 1.2 BAC71319.1 Non-secretory protein CDS SAVERM_3608 4466086 4466874 cbiO putative cobalt ABC transporter ATP-binding protein PF00005: ABC transporter 5.6 27819 E transport / binding proteins & lipoproteins 1.2 BAC71320.1 Non-secretory protein CDS SAVERM_3609 4466871 4467332 putative MarR-family transcriptional regulator PF01047: MarR family 5.34 16805 E regulation 3.5.2 BAC71321.1 Non-secretory protein CDS SAVERM_3610 4467529 4467933 ohrB1 putative organic hydroperoxide resistance protein PF02566: OsmC-like protein 5.59 13831 E detoxification 4.2 BAC71322.1 Non-secretory protein CDS SAVERM_3611 4467965 4469167 putative esterase PF00144: Beta-lactamase 8.05 42014 E miscellaneous 4.7 BAC71323.1 Non-secretory protein CDS SAVERM_3612 4469487 4469212 hypothetical protein PF08962: Domain of unknown function (DUF1876) 5.9 10124 E similar to unknown proteins 5 BAC71324.1 Non-secretory protein CDS SAVERM_3613 4470431 4469586 putative integral membrane protein PF00892: Integral membrane protein DUF6 10.29 28609 E miscellaneous 4.7 BAC71325.1 Non-secretory protein CDS SAVERM_3614 4470979 4470428 hypothetical protein PF04073: YbaK / prolyl-tRNA synthetases associated domain 6.12 19475 E similar to unknown proteins 5 BAC71326.1 Non-secretory protein CDS SAVERM_3615 4471199 4471011 hypothetical protein PF04149: Domain of unknown function (DUF397) 6.95 6808 E similar to unknown proteins 5 BAC71327.1 Non-secretory protein CDS SAVERM_3616 4471682 4472491 hypothetical protein 4.71 29500 E similar to unknown proteins 5 BAC71329.1 Non-secretory protein CDS SAVERM_3617 4471843 4471196 putative DNA-binding protein 7.89 23952 E regulation 3.5.2 BAC71328.1 Non-secretory protein CDS SAVERM_3618 4474799 4472574 putative transmembrane transport protein Tat substrate, PF03176: MMPL family 9.6 76945 E transport / binding proteins & lipoproteins 1.2 BAC71330.1 Signal peptide CDS SAVERM_3619 4475519 4474929 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.62 21844 E regulation 3.5.2 BAC71331.1 Non-secretory protein CDS SAVERM_3620 4475706 4479011 pepD2 putative tricorn core peptidase PF03572: Peptidase family S41 5.78 120192 E protein modification 3.8 BAC71332.1 Non-secretory protein CDS SAVERM_3621 4479247 4479074 hypothetical protein 4.63 6724 E no similarity 6 BAC71333.1 Non-secretory protein CDS SAVERM_3622 4479522 4479277 hypothetical protein 4.97 9606 E no similarity 6 BAC71334.1 Non-secretory protein CDS SAVERM_3623 4480484 4479600 putative dehydrogenase PF00106: short chain dehydrogenase 10.13 31675 E miscellaneous 4.7 BAC71335.1 Non-secretory protein CDS SAVERM_3624 4481404 4480481 putative hydrolase PF00561: alpha/beta hydrolase fold 9.08 32087 E miscellaneous 4.7 BAC71336.1 Non-secretory protein CDS SAVERM_3625 4482963 4481401 putative monooxygenase PF00743: Flavin-binding monooxygenase-like 9.78 57084 E miscellaneous 4.7 BAC71337.1 Non-secretory protein CDS SAVERM_3626 4483072 4483740 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 6.7 24540 E regulation 3.5.2 BAC71338.1 Non-secretory protein CDS SAVERM_3627 4484640 4485131 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.53 18192 E miscellaneous 4.7 BAC71340.1 Non-secretory protein CDS SAVERM_3628 4484641 4483778 exoA putative exodeoxyribonuclease PF03372: Endonuclease/Exonuclease/phosphatase family 6.32 31888 E DNA modification & repair 3.2 BAC71339.1 Non-secretory protein CDS SAVERM_3629 4485609 4485157 putative secreted protein 8.59 16082 E miscellaneous 4.7 BAC71341.1 Signal peptide CDS SAVERM_3630 4486463 4485804 putative two-component system response regulator PF00072: Response regulator receiver domain 6.37 23629 E regulation 3.5.2 BAC71342.1 Non-secretory protein CDS SAVERM_3631 4487725 4486436 putative two-component system sensor kinase PF07730: Histidine kinase 5.85 45075 E sensors 1.3 BAC71343.1 Non-secretory protein CDS SAVERM_3632 4488112 4489959 putative regulatory protein AfsR homolog, PF03704: Bacterial transcriptional activator domain 9.09 67199 E regulation 3.5.2 BAC71344.1 Non-secretory protein CDS SAVERM_3633 4490080 4490592 putative secreted protein PF00597: DedA family 12.2 17817 E similar to unknown proteins 5 BAC71345.1 Non-secretory protein CDS SAVERM_3634 4490744 4491490 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.76 26276 E transport / binding proteins & lipoproteins 1.2 BAC71346.1 Non-secretory protein CDS SAVERM_3635 4491484 4493940 putative ABC transporter permease protein PF02687: Predicted permease 9.75 85052 E transport / binding proteins & lipoproteins 1.2 BAC71347.1 Non-secretory protein CDS SAVERM_3636 4495185 4494250 putative SyrP-like protein nrps2 gene cluster, PF02668: Taurine catabolism dioxygenase TauD, TfdA family 5.4 34705 E antibiotic production 4.3 BAC71348.1 Non-secretory protein CDS SAVERM_3637 4495976 4495182 pptA4 putative 4’-phosphopantetheinyl transferase nrps2 gene cluster, PF01648: 4'-phosphopantetheinyl transferase superfamily 5.87 28779 E metabolism of lipids 2.4 BAC71349.1 Non-secretory protein CDS SAVERM_3638 4496951 4496016 putative SyrP-like protein nrps2 gene cluster, PF02668: Taurine catabolism dioxygenase TauD, TfdA family 4.38 33968 E antibiotic production 4.3 BAC71350.1 Non-secretory protein CDS SAVERM_3639 4497704 4496955 putative thioesterase nrps2 gene cluster, PF00975: Thioesterase domain 6.88 27520 E antibiotic production 4.3 BAC71351.1 Non-secretory protein CDS SAVERM_3640 4499077 4497725 putative multidrug resistance protein nrps2 gene cluster, PF07690: Major Facilitator Superfamily 11.36 46658 E transport / binding proteins & lipoproteins 1.2 BAC71352.1 Non-secretory protein CDS SAVERM_3641 4499997 4499074 putative aspartate/ornithine carbamoyltransferase nrps2 gene cluster, PF02729: Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 4.91 33103 E metabolism of amino acids & related molecules 2.2 BAC71353.1 Non-secretory protein CDS SAVERM_3642 4511144 4500084 nrps2-1 putative non-ribosomal peptide synthetase nrps2 gene cluster 4.98 395118 E antibiotic production 4.3 BAC71354.1 Non-secretory protein CDS SAVERM_3643 4516285 4511156 nrps2-2 putative non-ribosomal peptide synthetase nrps2 gene cluster, NRPS involved in dihydroxy-benzoyl-glycine biosynthesis 4.99 181216 E antibiotic production 4.3 BAC71355.1 Non-secretory protein CDS SAVERM_3644 4516595 4516329 putative MbtH-like protein nrps2 gene cluster, PF03621: MbtH-like protein 4.46 9803 E miscellaneous 4.7 BAC71356.1 Non-secretory protein CDS SAVERM_3645 4517633 4516629 arcB2 putative ornithine cyclodeaminase nrps2 gene cluster, PF02423: Ornithine cyclodeaminase/mu-crystallin family 5.24 35386 E metabolism of amino acids & related molecules 2.2 BAC71357.1 Non-secretory protein CDS SAVERM_3646 4518525 4517725 putative methyltransferase nrps2 gene cluster 4.7 28522 E miscellaneous 4.7 BAC71358.1 Non-secretory protein CDS SAVERM_3647 4519862 4518522 nrps2-3 putative non-ribosomal peptide synthetase nrps2 gene cluster 6.08 48929 E antibiotic production 4.3 BAC71359.1 Non-secretory protein CDS SAVERM_3648 4520859 4519876 cysK2 putative cysteine synthase nrps2 gene cluster, PF00291: Pyridoxal-phosphate dependent enzyme 5.24 35483 E metabolism of amino acids & related molecules 2.2 BAC71360.1 Non-secretory protein CDS SAVERM_3649 4521379 4521113 putative peptide carrier protein nrps2 gene cluster 3.75 9350 E similar to unknown proteins 5 BAC71361.1 Non-secretory protein CDS SAVERM_3650 4523208 4521379 fadE25 putative acyl-CoA dehydrogenase nrps2 gene cluster, PF02770: Acyl-CoA dehydrogenase, middle domain 7 64829 E metabolism of lipids 2.4 BAC71362.1 Non-secretory protein CDS SAVERM_3651 4526990 4523205 nrps2-4 putative non-ribosomal peptide synthetase/acyl-CoA dehydrogenase fusion protein nrps2 gene cluster 6.82 133937 E antibiotic production 4.3 BAC71363.1 Non-secretory protein CDS SAVERM_3652 4527892 4527167 putative isomerase PF01323: DSBA-like thioredoxin domain 5.17 26541 E miscellaneous 4.7 BAC71364.1 Non-secretory protein CDS SAVERM_3653 4528842 4527901 fabG4 putative 3-oxoacyl-ACP reductase pks8 gene cluster, PF00106: short chain dehydrogenase 5.53 32283 E metabolism of lipids 2.4 BAC71365.1 Non-secretory protein CDS SAVERM_3654 4529351 4528854 fabA putative 3-hydroxyacyl-ACP dehydratase pks8 gene cluster, PF07977: FabA-like domain 4.67 17560 E metabolism of lipids 2.4 BAC71366.1 Non-secretory protein CDS SAVERM_3655 4529818 4529354 putative (3R)-hydroxymyristol ACP dehydrase pks8 gene cluster, PF07977: FabA-like domain 4.54 16104 E metabolism of lipids 2.4 BAC71367.1 Non-secretory protein CDS SAVERM_3656 4530078 4529815 pks8-1 putative acyl carrier protein pks8 gene cluster, PF00550: Phosphopantetheine attachment site 3.7 9680 E metabolism of lipids 2.4 BAC71368.1 Non-secretory protein CDS SAVERM_3657 4531313 4530195 pks8-2 putative 3-oxoacyl-ACP synthase I pks8 gene cluster, PF00109: Beta-ketoacyl synthase, N-terminal domain 5.67 38182 E metabolism of lipids 2.4 BAC71369.1 Non-secretory protein CDS SAVERM_3658 4532255 4531440 pks8-3 putative 3-oxoacyl-ACP reductase pks8 gene cluster, PF00106: short chain dehydrogenase 6.42 28433 E metabolism of lipids 2.4 BAC71370.1 Non-secretory protein CDS SAVERM_3659 4533351 4532239 pks8-4 putative 3-oxoacyl-ACP synthase II pks8 gene cluster, PF00109: Beta-ketoacyl synthase, N-terminal domain 7.64 36626 E metabolism of lipids 2.4 BAC71371.1 Non-secretory protein CDS SAVERM_3660 4534696 4533377 pks8-5 putative 3-oxoacyl-ACP synthase I pks8 gene cluster, PF02801: Beta-ketoacyl synthase, C-terminal domain 5.43 43363 E metabolism of lipids 2.4 BAC71372.1 Non-secretory protein CDS SAVERM_3661 4535697 4534714 hypothetical protein pks8 gene cluster 5.27 36736 E similar to unknown proteins 5 BAC71373.1 Non-secretory protein CDS SAVERM_3662 4536419 4535694 putative hydrolase pks8 gene cluster, PF00561: alpha/beta hydrolase fold 5.25 26144 E miscellaneous 4.7 BAC71374.1 Non-secretory protein CDS SAVERM_3663 4537697 4536612 pks8-6 putative 3-oxoacyl-ACP synthase I pks8 gene cluster, PF00109: Beta-ketoacyl synthase, N-terminal domain 5.35 35783 E metabolism of lipids 2.4 BAC71375.1 Non-secretory protein CDS SAVERM_3664 4538857 4537694 pks8-7 putative 3-oxoacyl-ACP synthase II pks8 gene cluster, PF02801: Beta-ketoacyl synthase, C-terminal domain 4.79 40379 E metabolism of lipids 2.4 BAC71376.1 Non-secretory protein CDS SAVERM_3665 4540161 4538875 pks8-8 putative 3-oxoacyl-ACP synthase I pks8 gene cluster, PF02801: Beta-ketoacyl synthase, C-terminal domain 4.64 44578 E metabolism of lipids 2.4 BAC71377.1 Non-secretory protein CDS SAVERM_3666 4540450 4540196 pks8-9 putative acyl carrier protein pks8 gene cluster, PF00550: Phosphopantetheine attachment site 4.01 9391 E metabolism of lipids 2.4 BAC71378.1 Non-secretory protein CDS SAVERM_3667 4541568 4540555 putative erythropoiesis-stimulating protein PF00196: Bacterial regulatory proteins, luxR family 5.51 37034 E regulation 3.5.2 BAC71379.1 Non-secretory protein CDS SAVERM_3668 4544010 4542661 hypothetical protein 9.96 47907 E similar to unknown proteins 5 BAC71380.1 Non-secretory protein CDS SAVERM_3669 4544665 4544195 rimJ putative ribosomal-protein-alanine N-acetyltransferase PF00583: Acetyltransferase (GNAT) family 10.41 17434 E protein modification 3.8 BAC71381.1 Non-secretory protein CDS SAVERM_3670 4545390 4544851 moaB putative molybdopterin biosynthesis protein probable molybdenum cofactor biosynthesis protein, PF00994: Probable molybdopterin binding domain 4.62 17842 E metabolism of coenzymes & prosthetic groups 2.5 BAC71382.1 Non-secretory protein CDS SAVERM_3671 4545899 4545387 moaC putative molybdenum cofactor biosynthesis protein PF01967: MoaC family 6.54 17620 E metabolism of coenzymes & prosthetic groups 2.5 BAC71383.1 Non-secretory protein CDS SAVERM_3672 4547258 4545984 moaA1 putative molybdopterin biosynthesis protein PF03453: MoeA N-terminal region (domain I and II) 4.42 43541 E metabolism of coenzymes & prosthetic groups 2.5 BAC71384.1 Non-secretory protein CDS SAVERM_3673 4548213 4547311 galU putative UTP:glucose-1-phosphate uridylyltransferase PF00483: Nucleotidyl transferase 4.94 32923 E cell wall 1.1 BAC71385.1 Non-secretory protein CDS SAVERM_3674 4548308 4548931 putative ligase PF01812: 5-formyltetrahydrofolate cyclo-ligase family 9.59 21996 G1 miscellaneous 4.7 BAC71386.1 Non-secretory protein CDS SAVERM_3675 4551811 4549001 pacB1 putative penicillin acylase, secreted PF01804: Penicillin amidase 5.95 102387 G1 detoxification 4.2 BAC71387.1 Non-secretory protein CDS SAVERM_3676 4552050 4553621 putative sodium/proton antiporter PF00999: Sodium/hydrogen exchanger family 9.32 54834 G1 transport / binding proteins & lipoproteins 1.2 BAC71388.1 Non-secretory protein CDS SAVERM_3677 4553938 4555236 putative ABC transporter permease protein PF07690: Major Facilitator Superfamily 10.35 44058 G1 transport / binding proteins & lipoproteins 1.2 BAC71389.1 Non-secretory protein CDS SAVERM_3678 4555305 4555646 hypothetical protein PF09723: Putative regulatory protein (CxxC_CxxC_SSSS) 8.32 11203 G1 similar to unknown proteins 5 BAC71390.1 Non-secretory protein CDS SAVERM_3679 4555722 4556555 mtaP putative methylthioadenosine phosphorylase PF00896: Phosphorylase family 2 5.3 29535 G1 metabolism of nucleotides & nucleic acids 2.3 BAC71391.1 Non-secretory protein CDS SAVERM_3680 4556821 4557315 putative secreted protein PF06981: Flp pilus assembly protein CpaB 12.17 16958 G1 similar to unknown proteins 5 BAC71392.1 Non-secretory protein CDS SAVERM_3681 4557442 4557918 mscL putative mechanosensitive channel PF01741: Large-conductance mechanosensitive channel, MscL 10.02 17009 G1 transport / binding proteins & lipoproteins 1.2 BAC71393.1 Non-secretory protein CDS SAVERM_3682 4558150 4557974 hypothetical protein 4.28 6345 G1 similar to unknown proteins 5 BAC71394.1 Non-secretory protein CDS SAVERM_3683 4558240 4559496 hypothetical protein PF06772: Bacterial low temperature requirement A protein (LtrA) 8.14 44960 G1 similar to unknown proteins 5 BAC71395.1 Non-secretory protein CDS SAVERM_3684 4559528 4560556 hypothetical protein PF03576: peptidase family T4 5.17 33999 G1 similar to unknown proteins 5 BAC71396.1 Non-secretory protein CDS SAVERM_3685 4560793 4562019 putative lipoprotein Tat substrate, PF03734: ErfK/YbiS/YcfS/YnhG 9.97 42103 G1 transport / binding proteins & lipoproteins 1.2 BAC71397.1 Signal peptide CDS SAVERM_3686 4562200 4562949 hypothetical protein 4.95 27847 G1 similar to unknown proteins 5 BAC71398.1 Non-secretory protein CDS SAVERM_3687 4563360 4563070 hypothetical protein 12.5 10457 G1 no similarity 6 BAC71399.1 Non-secretory protein CDS SAVERM_3688 4565669 4563555 fruA putative fructose-specific permease PF02378: Phosphotransferase system, EIIC 5.03 70957 G1 transport / binding proteins & lipoproteins 1.2 BAC71400.1 Non-secretory protein CDS SAVERM_3689 4566792 4565839 fruB putative 1-phosphofructokinase PF00294: pfkB family carbohydrate kinase 4.34 31791 G1 main glycolytic pathways 2.1.2 BAC71401.1 Non-secretory protein CDS SAVERM_3690 4567550 4566789 fruR putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 5.62 27055 G1 regulation 3.5.2 BAC71402.1 Non-secretory protein CDS SAVERM_3691 4569388 4567874 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10.4 53227 G1 transport / binding proteins & lipoproteins 1.2 BAC71403.1 Non-secretory protein CDS SAVERM_3692 4569451 4570443 putative DeoR-family transcriptional regulator PF08279: HTH domain 6.33 36410 G1 regulation 3.5.2 BAC71404.1 Non-secretory protein CDS SAVERM_3693 4571203 4570496 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.78 24539 G1 regulation 3.5.2 BAC71405.1 Non-secretory protein CDS SAVERM_3694 4573081 4572086 sig30 putative RNA polymerase sigma factor similar to SCO3202:hrdD, sigma-70 family, PF04539: Sigma-70 region 3 5.05 37064 G1 RNA initiation 3.5.1 BAC71406.1 Non-secretory protein CDS SAVERM_3695 4573253 4573771 bar putative phosphinothricin N-acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.94 19336 G1 detoxification 4.2 BAC71407.1 Non-secretory protein CDS SAVERM_3696 4574562 4573801 hypothetical protein PF02900: catalytic LigB subunit of aromatic ring-opening dioxygenase 4.84 27746 G1 similar to unknown proteins 5 BAC71408.1 Non-secretory protein CDS SAVERM_3697 4574728 4575282 putative MarR-family transcriptional regulator PF01047: MarR family 7.77 20720 G1 regulation 3.5.2 BAC71409.1 Non-secretory protein CDS SAVERM_3698 4576933 4575383 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.52 53319 G1 transport / binding proteins & lipoproteins 1.2 BAC71410.1 Non-secretory protein CDS SAVERM_3699 4577794 4577150 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.69 23471 G1 regulation 3.5.2 BAC71411.1 Non-secretory protein CDS SAVERM_3700 4578033 4579352 putative secreted protein 5.13 46696 G1 similar to unknown proteins 5 BAC71412.1 Signal peptide CDS SAVERM_3701 4579518 4581236 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 6.88 61564 G1 regulation 3.5.2 BAC71413.1 Non-secretory protein CDS SAVERM_3702 4581428 4582084 avaR2 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.6 23132 G1 regulation 3.5.2 BAC71414.1 Non-secretory protein CDS SAVERM_3703 4582990 4582127 avaR3 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 11.27 30655 G1 regulation 3.5.2 BAC71415.1 Non-secretory protein CDS SAVERM_3704 4584319 4583057 cyp17 cytochrome P450 hydroxylase CYP154B2, avaR is located at upstream 4.87 45361 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71416.1 Non-secretory protein CDS SAVERM_3705 4585275 4584571 avaR1 putative gamma-butyrolactone receptor protein PF00440: Bacterial regulatory proteins, tetR family 6.53 25833 G1 regulation 3.5.2 BAC71417.1 Non-secretory protein CDS SAVERM_3706 4585720 4587741 aco putative acyl-CoA oxidase PF01756: Acyl-CoA oxidase 7.08 71212 G1 metabolism of lipids 2.4 BAC71418.1 Non-secretory protein CDS SAVERM_3707 4588309 4589343 adhA5 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 4.59 36515 G1 specific pathways 2.1.1 BAC71419.1 Non-secretory protein CDS SAVERM_3708 4591725 4590544 int7 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 11.13 45107 G1 phage-related functions 4.4 BAC71420.1 Non-secretory protein CDS SAVERM_3709 4591925 4591725 xis putative phage excisionase PF05930: Prophage CP4-57 regulatory protein (AlpA) 10.17 7502 G1 phage-related functions 4.4 BAC71421.1 Non-secretory protein CDS SAVERM_3710 4592204 4592037 hypothetical protein 6.9 5745 G1 no similarity 6 BAC71422.1 Non-secretory protein CDS SAVERM_3711 4593871 4592396 putative ATP-binding protein 6.3 53741 G1 miscellaneous 4.7 BAC71423.1 Non-secretory protein CDS SAVERM_3712 4594734 4593874 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 9.41 30357 G1 similar to unknown proteins 5 BAC71424.1 Non-secretory protein CDS SAVERM_3713 4594875 4595906 hypothetical protein 5.27 37291 G1 no similarity 6 BAC71425.1 Non-secretory protein CDS SAVERM_3714 4596389 4595934 hypothetical protein 12.06 15533 G1 similar to unknown proteins 5 BAC71426.1 Non-secretory protein CDS SAVERM_3715 4598637 4596559 traB1 putative sporulation-related protein PF01580: FtsK/SpoIIIE family 4.79 72894 G1 sporulation 1.8 BAC71427.1 Non-secretory protein CDS SAVERM_3716 4599220 4598651 traA1 putative sporulation-related protein 11.46 20184 G1 sporulation 1.8 BAC71428.1 Non-secretory protein CDS SAVERM_3717 4599740 4599240 hypothetical protein 13.08 18019 G1 similar to unknown proteins 5 BAC71429.1 Signal peptide CDS SAVERM_3718 4600851 4599769 hypothetical protein PF01507: Phosphoadenosine phosphosulfate reductase family 8.69 40381 G1 no similarity 6 BAC71430.1 Non-secretory protein CDS SAVERM_3719 4601825 4600848 putative secreted protein SpdB homolog 8.74 36005 G1 similar to unknown proteins 5 BAC71431.1 Non-secretory protein CDS SAVERM_3720 4602112 4601822 hypothetical protein 5.84 10672 G1 no similarity 6 BAC71432.1 Non-secretory protein CDS SAVERM_3721 4602727 4603485 putative GntR-family transcriptional regulator PF07702: UTRA domain 7.32 27143 G1 regulation 3.5.2 BAC71433.1 Non-secretory protein CDS SAVERM_3722 4605804 4607084 putative IS701 family ISAzvi8-like transposase IS701 family (4605752..4607177). Inverted repeat sequence (19/21 bp). Target sequence (CTAG) 8.64 50142 G1 transposon & IS 4.5 BAC71434.1 Non-secretory protein CDS SAVERM_3723 4608352 4607342 putative HNH endonuclease PF13391: HNH endonuclease 8.93 37969 G1 similar to unknown proteins 5 BAC71435.1 Non-secretory protein CDS SAVERM_3724 4609239 4608844 putative secreted protein 9.54 13451 G1 no similarity 6 BAC71436.1 Non-secretory protein CDS SAVERM_3725 4610523 4609420 hypothetical protein 6.52 41201 G1 no similarity 6 BAC71437.1 Non-secretory protein CDS SAVERM_3726 4612356 4610608 hypothetical protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.26 64923 G1 similar to unknown proteins 5 BAC71438.1 Non-secretory protein CDS SAVERM_3727 4613219 4612749 hypothetical protein 7.79 17449 G1 no similarity 6 BAC71439.1 Non-secretory protein CDS SAVERM_3728 4615940 4614801 int8 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 10.66 42031 G1 phage-related functions 4.4 BAC71440.1 Signal peptide CDS SAVERM_3729 4617458 4616145 repSA1 putative replication initiation protein 10.05 47566 G1 DNA replication 3.1 BAC71441.1 Non-secretory protein CDS SAVERM_3730 4617852 4617607 spdD1 putative SpdD protein 11.85 8435 G1 plasmid transfer 4.7.2 BAC71442.1 Non-secretory protein CDS SAVERM_3731 4618071 4617877 hypothetical protein 9.69 6742 G1 no similarity 6 BAC71443.1 Non-secretory protein CDS SAVERM_3732 4618279 4618088 spdB1 putative mobile element transfer protein SpdB PF05122: Mobile element transfer protein 10.04 6949 G1 plasmid transfer 4.7.2 BAC71444.1 Non-secretory protein CDS SAVERM_3733 4618918 4618292 spdA1 putative mobile element transfer protein SpdA 5.17 21700 G1 plasmid transfer 4.7.2 BAC71445.1 Signal peptide CDS SAVERM_3734 4620386 4619007 traSA1 putative plasmid transfer protein PF01580: FtsK/SpoIIIE family 9.53 49540 G1 plasmid transfer 4.7.2 BAC71446.1 Non-secretory protein CDS SAVERM_3735 4620742 4620386 pra1 putative replication activator protein Pra 4.82 12304 G1 DNA replication 3.1 BAC71447.1 Non-secretory protein CDS SAVERM_3736 4621708 4620920 korSA1 putative regulatory protein KorSA, GntR-family transcriptional regulator PF07702: UTRA domain 7.3 29216 G1 regulation 3.5.2 BAC71448.1 Non-secretory protein CDS SAVERM_3737 4621735 4622223 putative MutT-like protein PF00293: NUDIX domain 4.77 17630 G1 miscellaneous 4.7 BAC71449.1 Non-secretory protein CDS SAVERM_3738 4622270 4622698 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.6 14919 G1 regulation 3.5.2 BAC71450.1 Non-secretory protein CDS SAVERM_3739 4622692 4623039 hypothetical protein 5.55 13002 G1 no similarity 6 BAC71451.1 Non-secretory protein CDS SAVERM_3740 4623036 4623425 hypothetical protein 6.49 14520 G1 no similarity 6 BAC71452.1 Non-secretory protein CDS SAVERM_3741 4625235 4623466 putative IS481 family ISMav2-like transposase IS481 family (4625361..4623409). Inverted repeat sequence (22/26 bp), PF00665: Integrase core domain 10.8 64806 G1 transposon & IS 4.5 BAC71453.1 Non-secretory protein CDS SAVERM_3742 4627730 4626525 hypothetical protein 5.82 44219 G1 similar to unknown proteins 5 BAC71454.1 Non-secretory protein CDS SAVERM_3743 4631972 4630443 hypothetical protein 8.55 55737 G1 no similarity 6 BAC71455.1 Non-secretory protein CDS SAVERM_3744 4632395 4632796 hypothetical protein 5.58 14787 G1 no similarity 6 BAC71456.1 Non-secretory protein CDS SAVERM_3745 4633048 4633491 hypothetical protein 4.69 16364 G1 no similarity 6 BAC71457.1 Non-secretory protein CDS SAVERM_3746 4634597 4636144 putative HNH endonuclease PF13391: HNH endonuclease 8.37 56939 G1 similar to unknown proteins 5 BAC71458.1 Non-secretory protein CDS SAVERM_3747 4637051 4637479 hypothetical protein 6.39 16186 G1 no similarity 6 BAC71459.1 Non-secretory protein CDS SAVERM_3748 4639334 4638366 hypothetical protein 10.19 33743 G1 no similarity 6 BAC71460.1 Non-secretory protein CDS SAVERM_3749 4640202 4639693 putative secreted protein 8.05 18361 G1 no similarity 6 BAC71461.1 Signal peptide CDS SAVERM_3750 4640621 4640953 putative secreted protein 8.3 11395 G1 no similarity 6 BAC71462.1 Signal peptide CDS SAVERM_3751 4641581 4641303 hypothetical protein PF00248: Aldo/keto reductase family 8.71 10389 G1 similar to unknown proteins 5 BAC71463.1 Non-secretory protein CDS SAVERM_3752 4643474 4641822 putative integrin-like protein PF01839: FG-GAP repeat 4.27 53921 G1 transport / binding proteins & lipoproteins 1.2 BAC71464.1 Non-secretory protein CDS SAVERM_3753 4644273 4643740 putative secreted protein 10.57 19127 G1 no similarity 6 BAC71465.1 Non-secretory protein CDS SAVERM_3754 4646323 4644830 putative FAD-dependent oxygenase Tat substrate, PF01565: FAD binding domain 4.7 52819 G1 miscellaneous 4.7 BAC71466.1 Signal peptide CDS SAVERM_3755 4647099 4647371 hypothetical protein 4.21 9374 G1 no similarity 6 BAC71468.1 Non-secretory protein CDS SAVERM_3756 4647109 4646687 ptpB1 putative low molecular weight protein tyrosine phosphatase PF01451: Low molecular weight phosphotyrosine protein phosphatase 4.46 14673 G1 protein modification 3.8 BAC71467.1 Non-secretory protein CDS SAVERM_3757 4647828 4647424 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 5.74 14366 G1 regulation 3.5.2 BAC71469.1 Non-secretory protein CDS SAVERM_3758 4647908 4648378 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.45 16499 G1 similar to unknown proteins 5 BAC71470.1 Non-secretory protein CDS SAVERM_3759 4649208 4648561 hypothetical protein PF07885: Ion channel 11.95 23086 G1 similar to unknown proteins 5 BAC71471.1 Non-secretory protein CDS SAVERM_3760 4649980 4649384 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.77 22677 G1 regulation 3.5.2 BAC71472.1 Non-secretory protein CDS SAVERM_3761 4650129 4650857 hypothetical protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 8.99 26597 G1 similar to unknown proteins 5 BAC71473.1 Non-secretory protein CDS SAVERM_3762 4651512 4650952 hypothetical protein PF09346: SMI1 / KNR4 family 4.42 20723 G1 similar to unknown proteins 5 BAC71474.1 Non-secretory protein CDS SAVERM_3763 4652211 4651594 putative LysE-family efflux protein PF01810: LysE type translocator 10.26 21000 G1 miscellaneous 4.7 BAC71475.1 Non-secretory protein CDS SAVERM_3764 4652323 4652781 putative AsnC-family transcriptional regulator PF01037: AsnC family 6.26 17077 G1 regulation 3.5.2 BAC71476.1 Non-secretory protein CDS SAVERM_3765 4654066 4652819 hypothetical protein PF01041: DegT/DnrJ/EryC1/StrS aminotransferase family 8.91 45191 G1 similar to unknown proteins 5 BAC71477.1 Non-secretory protein CDS SAVERM_3766 4655296 4654181 hypothetical protein 10.18 41859 G1 similar to unknown proteins 5 BAC71478.1 Non-secretory protein CDS SAVERM_3767 4655867 4656193 putative secreted protein 10.28 11771 G1 no similarity 6 BAC71479.1 Non-secretory protein CDS SAVERM_3768 4657602 4656757 putative integral membrane protein 9.78 30845 G1 miscellaneous 4.7 BAC71480.1 Non-secretory protein CDS SAVERM_3769 4660647 4658158 pepN1 putative aminopeptidase N PF01433: Peptidase family M1 4.46 90411 G1 protein modification 3.8 BAC71481.1 Non-secretory protein CDS SAVERM_3770 4662259 4660850 hypothetical protein 8.36 52277 G1 no similarity 6 BAC71482.1 Non-secretory protein CDS SAVERM_3771 4663709 4662186 hypothetical protein PF05672: E-MAP-115 family 4.93 57695 G1 similar to unknown proteins 5 BAC71483.1 Non-secretory protein CDS SAVERM_3772 4666081 4663715 hypothetical protein 5.48 83410 G1 similar to unknown proteins 5 BAC71484.1 Non-secretory protein CDS SAVERM_3773 4666883 4666101 hypothetical protein 5.4 27702 G1 no similarity 6 BAC71485.1 Non-secretory protein CDS SAVERM_3774 4667076 4667594 hypothetical protein 9.35 17911 G1 no similarity 6 BAC71486.1 Non-secretory protein CDS SAVERM_3775 4668403 4667663 putative transcriptional regulator with cyclic nucleotide-binding domain PF00027: Cyclic nucleotide-binding domain 8.26 26515 G1 regulation 3.5.2 BAC71487.1 Non-secretory protein CDS SAVERM_3776 4669753 4668521 putative integral membrane protein PF07690: Major Facilitator Superfamily 11.72 42654 G1 miscellaneous 4.7 BAC71488.1 Non-secretory protein CDS SAVERM_3777 4669812 4670795 putative transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 10.01 35802 G1 regulation 3.5.2 BAC71489.1 Non-secretory protein CDS SAVERM_3778 4670805 4671314 bsaA putative glutathione peroxidase PF00255: Glutathione peroxidase 4.2 18052 G1 adaptation to atypical conditions 4.1 BAC71490.1 Non-secretory protein CDS SAVERM_3779 4671387 4672286 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 4.92 32853 G1 regulation 3.5.2 BAC71491.1 Non-secretory protein CDS SAVERM_3780 4674325 4672352 putative integral membrane protein PF07695: 7TM diverse intracellular signalling 8.43 71113 G1 miscellaneous 4.7 BAC71492.1 Non-secretory protein CDS SAVERM_3781 4677166 4674500 dacC putative D-alanyl-D-alanine carboxypeptidase PF00768: D-alanyl-D-alanine carboxypeptidase 4.67 89911 G1 cell wall 1.1 BAC71493.1 Non-secretory protein CDS SAVERM_3782 4677405 4678160 hypothetical protein PF05719: Golgi phosphoprotein 3 (GPP34) 11.6 26518 G1 similar to unknown proteins 5 BAC71494.1 Non-secretory protein CDS SAVERM_3783 4678590 4679447 putative DNA-binding protein PF01381: Helix-turn-helix 6.27 32434 G1 regulation 3.5.2 BAC71495.1 Non-secretory protein CDS SAVERM_3784 4679677 4679886 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.71 7119 G1 similar to unknown proteins 5 BAC71496.1 Non-secretory protein CDS SAVERM_3785 4680958 4680104 hypothetical protein 5.76 32337 G1 no similarity 6 BAC71497.1 Non-secretory protein CDS SAVERM_3786 4681048 4681833 putative dehydrogenase PF00106: short chain dehydrogenase 5.31 27268 G1 miscellaneous 4.7 BAC71498.1 Non-secretory protein CDS SAVERM_3787 4682066 4683634 putative sodium-coupled permease PF00474: Sodium:solute symporter family 8.89 56162 G1 transport / binding proteins & lipoproteins 1.2 BAC71499.1 Non-secretory protein CDS SAVERM_3788 4684790 4683675 draG3 putative ADP-ribosylglycohydrolase PF03747: ADP-ribosylglycohydrolase 6.19 38858 G1 specific pathways 2.1.1 BAC71500.1 Non-secretory protein CDS SAVERM_3789 4684952 4686358 putative integrin-like protein Tat substrate, PF01839: FG-GAP repeat 4.17 47739 G1 transport / binding proteins & lipoproteins 1.2 BAC71501.1 Signal peptide CDS SAVERM_3790 4687670 4686492 mdmB putative macrolide O-acyltransferase PF01757: Acyltransferase family 11.93 42607 G1 detoxification 4.2 BAC71502.1 Non-secretory protein CDS SAVERM_3791 4687844 4688230 hypothetical protein 12.41 13931 G1 no similarity 6 BAC71503.1 Non-secretory protein CDS SAVERM_3792 4690384 4688318 putative secreted protein 4.35 71631 G1 similar to unknown proteins 5 BAC71504.1 Non-secretory protein CDS SAVERM_3793 4690672 4691025 hypothetical protein 9.66 12049 G1 no similarity 6 BAC71505.1 Non-secretory protein CDS SAVERM_3794 4693617 4691032 cofG putative 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1 PF04055: Radical SAM superfamily 5.68 93933 G1 miscellaneous 4.7 BAC71506.1 Non-secretory protein CDS SAVERM_3795 4693843 4695351 putative secreted protein Tat substrate, PF02231: PHP domain N-terminal region 6.51 53220 G1 miscellaneous 4.7 BAC71507.1 Signal peptide CDS SAVERM_3796 4695437 4695844 hypothetical protein PF04075: Domain of unknown function (DUF385) 12.12 15348 G1 similar to unknown proteins 5 BAC71508.1 Non-secretory protein CDS SAVERM_3797 4695867 4697255 hypothetical protein PF07813: LTXXQ motif 6.66 48673 G1 similar to unknown proteins 5 BAC71509.1 Non-secretory protein CDS SAVERM_3798 4698798 4697299 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.22 51985 G1 specific pathways 2.1.1 BAC71510.1 Non-secretory protein CDS SAVERM_3799 4700525 4698795 putative D-aminoacylase PF07969: Amidohydrolase family 5.62 62106 G1 metabolism of amino acids & related molecules 2.2 BAC71511.1 Non-secretory protein CDS SAVERM_3800 4701580 4700540 hypothetical protein PF00296: Luciferase-like monooxygenase 5.13 38949 G1 similar to unknown proteins 5 BAC71512.1 Non-secretory protein CDS SAVERM_3801 4702543 4701767 putative dehydrogenase PF00106: short chain dehydrogenase 4.5 26924 G1 miscellaneous 4.7 BAC71513.1 Non-secretory protein CDS SAVERM_3802 4703481 4702552 hypothetical protein PF00296: Luciferase-like monooxygenase 7.27 33434 G1 similar to unknown proteins 5 BAC71514.1 Non-secretory protein CDS SAVERM_3803 4704737 4703478 hypothetical protein PF04909: Amidohydrolase 4.86 46633 G1 similar to unknown proteins 5 BAC71515.1 Non-secretory protein CDS SAVERM_3804 4704929 4707871 putative transcriptional regulator AfsR homolog, PF03704: Bacterial transcriptional activator domain 5.02 105242 G1 regulation 3.5.2 BAC71516.1 Non-secretory protein CDS SAVERM_3805 4708083 4708346 hypothetical protein 4.16 9274 G1 no similarity 6 BAC71517.1 Non-secretory protein CDS SAVERM_3806 4710123 4708540 fadD16 putative acyl-CoA synthetase, fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.7 55857 G1 metabolism of lipids 2.4 BAC71518.1 Non-secretory protein CDS SAVERM_3807 4710253 4711401 ltp2 putative nonspecific lipid-transfer protein PF02803: Thiolase, C-terminal domain 6.5 40593 G1 metabolism of lipids 2.4 BAC71519.1 Non-secretory protein CDS SAVERM_3808 4711403 4711819 hypothetical protein PF01796: Domain of unknown function DUF35 5.75 15191 G1 similar to unknown proteins 5 BAC71520.1 Non-secretory protein CDS SAVERM_3809 4711798 4712586 echA10 putative enoyl-CoA hydratase/isomerase PF00378: Enoyl-CoA hydratase/isomerase family 5.15 27604 G1 metabolism of lipids 2.4 BAC71521.1 Non-secretory protein CDS SAVERM_3810 4712599 4713600 ephA2 putative epoxide hydrolase PF00561: alpha/beta hydrolase fold 4.95 36541 G1 specific pathways 2.1.1 BAC71522.1 Non-secretory protein CDS SAVERM_3811 4714243 4713644 putative secreted protein 8.33 19598 G1 similar to unknown proteins 5 BAC71523.1 Non-secretory protein CDS SAVERM_3812 4714991 4714344 putative secreted protein 5.53 21931 G1 similar to unknown proteins 5 BAC71524.1 Signal peptide CDS SAVERM_3813 4715671 4715060 putative NADPH-dependent FMN reductase PF03358: NADPH-dependent FMN reductase 6.51 21239 G1 miscellaneous 4.7 BAC71525.1 Non-secretory protein CDS SAVERM_3814 4715985 4715668 hypothetical protein PF01638: Transcriptional regulator 4.86 11496 G1 similar to unknown proteins 5 BAC71526.1 Non-secretory protein CDS SAVERM_3815 4716009 4716572 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 8.32 19998 G1 miscellaneous 4.7 BAC71527.1 Non-secretory protein CDS SAVERM_3816 4719061 4716713 pkn7 putative serine/threonine protein kinase AfsK homolog, PF01011: PQQ enzyme repeat, PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.52 81881 G1 protein modification 3.8 BAC71528.1 Non-secretory protein CDS SAVERM_3817 4720068 4719274 putative hydroxylase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.46 27814 G1 miscellaneous 4.7 BAC71529.1 Non-secretory protein CDS SAVERM_3818 4720214 4720849 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.85 22976 G1 regulation 3.5.2 BAC71530.1 Non-secretory protein CDS SAVERM_3819 4721114 4721851 hypothetical protein PF00485: Phosphoribulokinase / Uridine kinase family 4.96 26929 G1 similar to unknown proteins 5 BAC71531.1 Non-secretory protein CDS SAVERM_3820 4722311 4721838 hypothetical protein PF04075: Domain of unknown function (DUF385) 12.23 17780 G1 similar to unknown proteins 5 BAC71532.1 Non-secretory protein CDS SAVERM_3821 4723552 4722311 fadE9 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.26 43120 G1 metabolism of lipids 2.4 BAC71533.1 Non-secretory protein CDS SAVERM_3822 4723667 4724836 hypothetical protein PF02803: Thiolase, C-terminal domain 6.35 40901 G1 similar to unknown proteins 5 BAC71534.1 Non-secretory protein CDS SAVERM_3823 4726046 4724859 hypothetical protein 5.68 42220 G1 no similarity 6 BAC71535.1 Non-secretory protein CDS SAVERM_3824 4726745 4727401 pdxH2 putative pyridoxamine 5’-phosphate oxidase PF01243: Pyridoxamine 5'-phosphate oxidase 4.99 24235 G1 miscellaneous 4.7 BAC71536.1 Non-secretory protein CDS SAVERM_3825 4727865 4727458 hypothetical protein PF01796: Domain of unknown function DUF35 5.64 15213 G1 similar to unknown proteins 5 BAC71537.1 Non-secretory protein CDS SAVERM_3826 4728275 4727862 hypothetical protein PF07681: DoxX 9.66 15275 G1 no similarity 6 BAC71538.1 Non-secretory protein CDS SAVERM_3827 4728525 4729730 putative monooxygenase PF00743: Flavin-binding monooxygenase-like 10.25 42748 G1 miscellaneous 4.7 BAC71539.1 Non-secretory protein CDS SAVERM_3828 4730190 4732331 putative pimeloyl-CoA synthetase PF02629: CoA binding domain 5.54 75447 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71540.1 Non-secretory protein CDS SAVERM_3829 4732417 4733256 echA11 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.19 29141 G1 metabolism of lipids 2.4 BAC71541.1 Non-secretory protein CDS SAVERM_3830 4733339 4733938 putative NADPH-flavin oxidoreductase PF01613: flavin reductase like domain 8.36 20832 G1 miscellaneous 4.7 BAC71542.1 Non-secretory protein CDS SAVERM_3831 4735298 4733988 putative integral membrane protein PF07690: Major Facilitator Superfamily 9.65 46488 G1 miscellaneous 4.7 BAC71543.1 Non-secretory protein CDS SAVERM_3832 4735370 4736383 bdpG putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.75 36303 G1 regulation 3.5.2 BAC71544.1 Non-secretory protein CDS SAVERM_3833 4737473 4736424 adhA6 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 6.59 36373 G1 specific pathways 2.1.1 BAC71545.1 Non-secretory protein CDS SAVERM_3834 4738637 4737486 fadE8 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.42 41864 G1 metabolism of lipids 2.4 BAC71546.1 Non-secretory protein CDS SAVERM_3835 4739554 4738649 putative dehydrogenase PF00106: short chain dehydrogenase 8.97 30996 G1 miscellaneous 4.7 BAC71547.1 Non-secretory protein CDS SAVERM_3836 4739639 4740574 putative cyclase PF04199: Putative cyclase 5.03 33490 G1 miscellaneous 4.7 BAC71548.1 Non-secretory protein CDS SAVERM_3837 4741661 4741128 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.38 18505 G1 regulation 3.5.2 BAC71549.1 Non-secretory protein CDS SAVERM_3838 4743026 4742154 fadE27 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.65 30704 G1 metabolism of lipids 2.4 BAC71550.1 Non-secretory protein CDS SAVERM_3839 4744186 4743032 fadE18 putative acyl-CoA dehydrogenase PF02770: Acyl-CoA dehydrogenase, middle domain 6.61 42439 G1 metabolism of lipids 2.4 BAC71551.1 Non-secretory protein CDS SAVERM_3840 4745454 4744186 hypothetical protein PF04909: Amidohydrolase 5.02 47691 G1 similar to unknown proteins 5 BAC71552.1 Non-secretory protein CDS SAVERM_3841 4745600 4747099 fadD17 putative cyclohex-1-ene-1-carboxylate:CoA ligase similar to bifunctional enzyme MbtA: salicyl-AMP ligase + salicyl-S-ArCP synthetase. PF00501: AMP-binding enzyme 5.93 54268 G1 specific pathways 2.1.1 BAC71553.1 Non-secretory protein CDS SAVERM_3842 4747615 4747103 cabA putative calcium-binding protein PF00036: EF hand 4.27 18146 G1 miscellaneous 4.7 BAC71554.1 Non-secretory protein CDS SAVERM_3843 4748177 4747797 putative anti-sigma factor antagonist PF01740: STAS domain 6.94 13640 G1 regulation 3.5.2 BAC71555.1 Non-secretory protein CDS SAVERM_3844 4748570 4749151 sig31 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4409, PF04542: Sigma-70 region 2 11.15 21681 G1 RNA initiation 3.5.1 BAC71556.1 Non-secretory protein CDS SAVERM_3845 4749148 4750632 hypothetical protein PF01391: Collagen triple helix repeat (20 copies) 4.86 51415 G1 similar to unknown proteins 5 BAC71557.1 Non-secretory protein CDS SAVERM_3846 4751640 4750759 purU putative formyltetrahydrofolate deformylase PF00551: Formyl transferase 6.51 32758 G1 metabolism of nucleotides & nucleic acids 2.3 BAC71558.1 Non-secretory protein CDS SAVERM_3847 4752272 4751772 hypothetical protein 5.6 18783 G1 similar to unknown proteins 5 BAC71559.1 Non-secretory protein CDS SAVERM_3848 4752390 4753676 putative lipoprotein 6.53 45118 G1 transport / binding proteins & lipoproteins 1.2 BAC71560.1 Signal peptide CDS SAVERM_3849 4755389 4753710 hypothetical protein PF02757: YLP motif 4.65 56127 G1 similar to unknown proteins 5 BAC71561.1 Non-secretory protein CDS SAVERM_3850 4757033 4755648 putative transcriptional regulator PF07719: Tetratricopeptide repeat 7.64 49381 G1 regulation 3.5.2 BAC71562.1 Non-secretory protein CDS SAVERM_3851 4757351 4758004 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 5.85 23570 G1 similar to unknown proteins 5 BAC71563.1 Non-secretory protein CDS SAVERM_3852 4758221 4759012 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.37 27781 G1 transport / binding proteins & lipoproteins 1.2 BAC71564.1 Non-secretory protein CDS SAVERM_3853 4759009 4760643 putative ABC transporter permease protein PF01312: FlhB HrpN YscU SpaS Family 11.17 56291 G1 transport / binding proteins & lipoproteins 1.2 BAC71565.1 Non-secretory protein CDS SAVERM_3854 4761757 4760834 putative hydrolase PF00561: alpha/beta hydrolase fold 5.28 34245 G1 miscellaneous 4.7 BAC71566.1 Non-secretory protein CDS SAVERM_3855 4762988 4762296 ideR putative iron dependent regulatory protein (DtxR) PF02742: Iron dependent repressor, metal binding and dimerisation domain 4.54 25198 G1 regulation 3.5.2 BAC71567.1 Non-secretory protein CDS SAVERM_3856 4763224 4763979 hypothetical protein PF01380: SIS domain 4.67 26200 G1 similar to unknown proteins 5 BAC71568.1 Non-secretory protein CDS SAVERM_3857 4765453 4764023 hypothetical protein PF00989: PAS domain 4.77 50093 G1 similar to unknown proteins 5 BAC71569.1 Non-secretory protein CDS SAVERM_3858 4766940 4766266 pdxH1 putative pyridoxamine 5’-phosphate oxidase PF01243: Pyridoxamine 5'-phosphate oxidase 6.52 25500 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71570.1 Non-secretory protein CDS SAVERM_3859 4767277 4768377 citA2 putative citrate synthase PF00285: Citrate synthase 5.8 39689 G1 TCA cycle 2.1.3 BAC71571.1 Non-secretory protein CDS SAVERM_3860 4769500 4768463 putative iron/acorbate-dependent oxidoreductase PF03171: 2OG-Fe(II) oxygenase superfamily 6.15 37602 G1 miscellaneous 4.7 BAC71572.1 Non-secretory protein CDS SAVERM_3861 4770511 4769864 hypothetical protein 4.09 23045 G1 similar to unknown proteins 5 BAC71573.1 Non-secretory protein CDS SAVERM_3862 4771207 4770608 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.37 21642 G1 regulation 3.5.2 BAC71574.1 Non-secretory protein CDS SAVERM_3863 4771929 4771195 echA12 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 5.36 25103 G1 metabolism of lipids 2.4 BAC71575.1 Non-secretory protein CDS SAVERM_3864 4773500 4771926 putative 4-coumarate:CoA ligase PF00501: AMP-binding enzyme 5.82 56057 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71576.1 Non-secretory protein CDS SAVERM_3865 4774716 4773556 fadE13 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.64 41360 G1 metabolism of lipids 2.4 BAC71577.1 Non-secretory protein CDS SAVERM_3866 4776650 4774800 accA2 putative acetyl/propionyl CoA carboxylase alpha subunit PF02786: Carbamoyl-phosphate synthase L chain, ATP binding domain 6.45 65800 G1 metabolism of lipids 2.4 BAC71578.1 Non-secretory protein CDS SAVERM_3867 4778259 4776661 accD2 putative acetyl/propionyl CoA carboxylase, beta subunit PF01039: Carboxyl transferase domain 6.07 56695 G1 metabolism of lipids 2.4 BAC71579.1 Non-secretory protein CDS SAVERM_3868 4779944 4778256 hypothetical protein PF07287: Protein of unknown function (DUF1446) 5.83 59590 G1 similar to unknown proteins 5 BAC71580.1 Non-secretory protein CDS SAVERM_3869 4780744 4779941 hypothetical protein PF07398: Protein of unknown function (DUF1503) 5.04 28883 G1 similar to unknown proteins 5 BAC71581.1 Non-secretory protein CDS SAVERM_3870 4782675 4780954 maeA2 putative malate dehydrogenase (oxaloacetate-decarboxylating; NAD-requiring) malS2, sfcA, PF03949: Malic enzyme, NAD binding domain 4.77 62060 G1 TCA cycle 2.1.3 BAC71582.1 Non-secretory protein CDS SAVERM_3871 4783797 4782844 putative ABC transporter permease protein PF00892: Integral membrane protein DUF6 11.67 31816 G1 transport / binding proteins & lipoproteins 1.2 BAC71583.1 Non-secretory protein CDS SAVERM_3872 4786316 4783941 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.98 84122 G1 transport / binding proteins & lipoproteins 1.2 BAC71584.1 Non-secretory protein CDS SAVERM_3873 4786449 4786634 hypothetical protein 9.83 6196 G1 no similarity 6 BAC71585.1 Non-secretory protein CDS SAVERM_3874 4787421 4786855 hypothetical protein PF03288: FemAB family 9.66 21626 G1 similar to unknown proteins 5 BAC71586.1 Non-secretory protein CDS SAVERM_3875 4787994 4787452 hypothetical protein PF03288: FemAB family 9.75 20025 G1 similar to unknown proteins 5 BAC71587.1 Non-secretory protein CDS SAVERM_3876 4791073 4788125 putative oxidoreductase PF01565: FAD binding domain 7.85 104284 G1 miscellaneous 4.7 BAC71588.1 Non-secretory protein CDS SAVERM_3877 4791417 4793657 cvnA9 putative sensor-like histidine kinase multi-component regulatory system-9 6.68 79256 G1 sensors 1.3 BAC71589.1 Non-secretory protein CDS SAVERM_3878 4793654 4794061 cvnB9 hypothetical protein multi-component regulatory system-9, PF03259: Roadblock/LC7 domain 4.38 13996 G1 similar to unknown proteins 5 BAC71590.1 Non-secretory protein CDS SAVERM_3879 4794058 4794405 cvnC9 hypothetical protein multi-component regulatory system-9, PF05331: Protein of unknown function (DUF742) 6.52 12475 G1 similar to unknown proteins 5 BAC71591.1 Non-secretory protein CDS SAVERM_3880 4794479 4795021 cvnD9 putative ATP/GTP-binding protein multi-component regulatory system-9 5.31 20058 G1 miscellaneous 4.7 BAC71592.1 Non-secretory protein CDS SAVERM_3881 4795018 4796253 cyp18 putative cytochrome P450 CYP157A2, adjacent to multi-component regulatory system-9 4.6 44510 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71593.1 Non-secretory protein CDS SAVERM_3882 4796250 4797452 cyp19 cytochrome P450 hydroxylase CYP154C2, adjacent to CYP157A2 4.78 43054 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71594.1 Non-secretory protein CDS SAVERM_3883 4797602 4798720 serC putative phosphoserine aminotransferase PF00266: Aminotransferase class-V 4.75 39454 G1 metabolism of amino acids & related molecules 2.2 BAC71595.1 Non-secretory protein CDS SAVERM_3884 4799851 4798865 putative secreted protein 5.39 34184 G1 similar to unknown proteins 5 BAC71596.1 Signal peptide CDS SAVERM_3885 4799980 4800666 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 4.41 25032 G1 similar to unknown proteins 5 BAC71597.1 Non-secretory protein CDS SAVERM_3886 4801681 4800887 hypothetical protein PF02353: Cyclopropane-fatty-acyl-phospholipid synthase 4.43 28869 G1 similar to unknown proteins 5 BAC71598.1 Non-secretory protein CDS SAVERM_3887 4803293 4801758 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.48 51600 G1 transport / binding proteins & lipoproteins 1.2 BAC71599.1 Non-secretory protein CDS SAVERM_3888 4803733 4804431 sig32 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 11.15 24993 G1 RNA initiation 3.5.1 BAC71600.1 Non-secretory protein CDS SAVERM_3889 4804428 4805537 hypothetical protein 7.37 39605 G1 no similarity 6 BAC71601.1 Non-secretory protein CDS SAVERM_3890 4806788 4805796 putative NDP-4-keto-6-deoxy-L-hexose 2,3-reductase PF00248: Aldo/keto reductase family 4.89 35882 G1 specific pathways 2.1.1 BAC71602.1 Non-secretory protein CDS SAVERM_3891 4807905 4806853 putative quinone oxidoreductase PF00107: Zinc-binding dehydrogenase 5.91 35257 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71603.1 Non-secretory protein CDS SAVERM_3892 4808809 4808237 putative 2’-5’ RNA ligase PF02834: 2',5' RNA ligase family 8.5 20669 G1 RNA modification 3.6 BAC71604.1 Non-secretory protein CDS SAVERM_3893 4808855 4809367 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6 18077 G1 similar to unknown proteins 5 BAC71605.1 Non-secretory protein CDS SAVERM_3894 4810757 4809411 putative integral membrane efflux protein PF07690: Major Facilitator Superfamily 11.65 46914 G1 transport / binding proteins & lipoproteins 1.2 BAC71606.1 Non-secretory protein CDS SAVERM_3895 4811322 4810885 putative MarR-family transcriptional regulator PF01047: MarR family 8.56 16172 G1 regulation 3.5.2 BAC71607.1 Non-secretory protein CDS SAVERM_3896 4811516 4811698 hypothetical protein PF01402: Ribbon-helix-helix protein, copG family 5.65 6942 G1 similar to unknown proteins 5 BAC71608.1 Non-secretory protein CDS SAVERM_3897 4813168 4811717 pbuG1 putative hypoxanthine/guanine permease PF00860: Permease family 6.95 50234 G1 transport / binding proteins & lipoproteins 1.2 BAC71609.1 Non-secretory protein CDS SAVERM_3898 4813428 4813694 putative integral membrane protein 6.79 9890 G1 miscellaneous 4.7 BAC71610.1 Non-secretory protein CDS SAVERM_3899 4813851 4816244 ctpE putative integral membrane ATPase PF00122: E1-E2 ATPase 6.07 85299 G1 membrane bioenergetics 1.4 BAC71611.1 Non-secretory protein CDS SAVERM_3900 4817168 4816257 putative secreted protein 7.34 31158 G1 no similarity 6 BAC71612.1 Signal peptide CDS SAVERM_3901 4820703 4817419 hypothetical protein 4.28 116127 G1 similar to unknown proteins 5 BAC71613.1 Non-secretory protein CDS SAVERM_3902 4822105 4821179 hypothetical protein PF11228: Protein of unknown function (DUF3027) 4.35 32450 G1 similar to unknown proteins 5 BAC71614.1 Non-secretory protein CDS SAVERM_3903 4822801 4824225 putative integral membrane protein PF07690: Major Facilitator Superfamily 11.87 47755 G1 miscellaneous 4.7 BAC71615.1 Non-secretory protein CDS SAVERM_3904 4824479 4824937 putative lipoprotein Tat substrate 9.53 16032 G1 transport / binding proteins & lipoproteins 1.2 BAC71616.1 Signal peptide CDS SAVERM_3905 4824994 4825665 mqnB putative futalosine hydrolase (menaquinone biosynthetic protein) PF01048: Phosphorylase family 5.76 22266 G1 similar to unknown proteins 5 BAC71617.1 Non-secretory protein CDS SAVERM_3906 4825655 4826509 mqnD putative 1,4-dihydroxy-6-naphthoate synthase (menaquinone biosynthetic protein) PF02642: Uncharacterized ACR, COG2107 4.51 30499 G1 similar to unknown proteins 5 BAC71618.1 Non-secretory protein CDS SAVERM_3907 4826945 4826562 cspB1 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 7.54 13601 G1 adaptation to atypical conditions 4.1 BAC71619.1 Non-secretory protein CDS SAVERM_3908 4827990 4827361 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.75 21954 G1 miscellaneous 4.7 BAC71620.1 Non-secretory protein CDS SAVERM_3909 4828865 4828326 hypothetical protein 10.73 18960 G1 similar to unknown proteins 5 BAC71621.1 Non-secretory protein CDS SAVERM_3910 4829201 4829344 hypothetical protein 12.65 5352 G1 no similarity 6 BAC71622.1 Non-secretory protein CDS SAVERM_3911 4829509 4832091 hypothetical protein 6.09 90116 G1 similar to unknown proteins 5 BAC71623.1 Non-secretory protein CDS SAVERM_3912 4832156 4833799 putative ATP-dependent DNA helicase PF00271: Helicase conserved C-terminal domain 6.18 60994 G1 DNA modification & repair 3.2 BAC71624.1 Non-secretory protein CDS SAVERM_3913 4834953 4833757 putative secreted protein Tat substrate 11.63 41932 G1 similar to unknown proteins 5 BAC71625.1 Non-secretory protein CDS SAVERM_3914 4835589 4835338 putative secreted protein 11.79 9112 G1 similar to unknown proteins 5 BAC71626.1 Non-secretory protein CDS SAVERM_3915 4835900 4837948 helD1 putative ATP-dependent DNA helicase PF00270: DEAD/DEAH box helicase 5.63 74237 G1 DNA modification & repair 3.2 BAC71627.1 Non-secretory protein CDS SAVERM_3916 4839290 4838061 putative secreted protein Tat substrate 9.9 43663 G1 miscellaneous 4.7 BAC71628.1 Signal peptide CDS SAVERM_3917 4840176 4839478 putative homeostasis protein PF03932: CutC family 4.34 24064 G1 adaptation to atypical conditions 4.1 BAC71629.1 Non-secretory protein CDS SAVERM_3918 4841042 4840365 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 4.73 24352 G1 similar to unknown proteins 5 BAC71630.1 Non-secretory protein CDS SAVERM_3919 4841081 4841758 hypothetical protein PF01966: HD domain 5.23 25365 G1 similar to unknown proteins 5 BAC71631.1 Non-secretory protein CDS SAVERM_3920 4841782 4842768 putative squalene/phytoene synthase PF00494: Squalene/phytoene synthase 9.62 36168 G1 metabolism of lipids 2.4 BAC71632.1 Non-secretory protein CDS SAVERM_3921 4843042 4842758 hypothetical protein 9.77 10588 G1 similar to unknown proteins 5 BAC71633.1 Non-secretory protein CDS SAVERM_3922 4843422 4843039 hypothetical protein 4.25 13432 G1 similar to unknown proteins 5 BAC71634.1 Non-secretory protein CDS SAVERM_3923 4843479 4844405 putative RpiR-family transcriptional regulator PF01380: SIS domain 6.96 31768 G1 regulation 3.5.2 BAC71635.1 Non-secretory protein CDS SAVERM_3924 4844522 4845457 putative sugar phosphate isomerase PF01380: SIS domain 4.68 31786 G1 miscellaneous 4.7 BAC71636.1 Non-secretory protein CDS SAVERM_3925 4845474 4847111 scrA putative PTS sucrose-specific enzyme IIBC component PF02378: phosphotransferase system EIIC, PF00367: phosphotransferase system EIIB 7.31 54671 G1 transport / binding proteins & lipoproteins 1.2 BAC71637.1 Non-secretory protein CDS SAVERM_3926 4847108 4847695 hypothetical protein 7.55 21957 G1 similar to unknown proteins 5 BAC71638.1 Non-secretory protein CDS SAVERM_3927 4847846 4848223 putative anti-sigma factor antagonist PF01740: STAS domain 4.68 13176 G1 regulation 3.5.2 BAC71639.1 Non-secretory protein CDS SAVERM_3928 4848241 4849965 prpJ6 putative magnesium or manganese-dependent protein phosphatase PF00989: PAS domain 5.86 61495 G1 protein modification 3.8 BAC71640.1 Non-secretory protein CDS SAVERM_3929 4851187 4850060 putative oxidoreductase PF00724: NADH:flavin oxidoreductase / NADH oxidase family 4.76 39733 G1 miscellaneous 4.7 BAC71641.1 Non-secretory protein CDS SAVERM_3930 4851568 4854066 putative secreted protein tat substrate 4.82 87708 G1 similar to unknown proteins 5 BAC71642.1 Signal peptide CDS SAVERM_3931 4855818 4854193 groEL2 putative class I heat-shock protein PF00118: TCP-1/cpn60 chaperonin family 4.53 56802 G1 protein folding 3.9 BAC71643.1 Non-secretory protein CDS SAVERM_3932 4856359 4856153 cspB2 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.56 7444 G1 adaptation to atypical conditions 4.1 BAC71644.1 Non-secretory protein CDS SAVERM_3933 4857088 4856813 hypothetical protein PF02597: ThiS family 4.7 9619 G1 similar to unknown proteins 5 BAC71645.1 Non-secretory protein CDS SAVERM_3934 4858462 4857164 thrC3 putative threonine synthase PF00291: Pyridoxal-phosphate dependent enzyme 4.5 45397 G1 metabolism of amino acids & related molecules 2.2 BAC71646.1 Non-secretory protein CDS SAVERM_3935 4858803 4859747 putative glycosyltransferase PF00535: Glycosyl transferase 6.05 34244 G1 specific pathways 2.1.1 BAC71647.1 Non-secretory protein CDS SAVERM_3936 4859857 4861248 otsA putative trehalose-6-phosphate synthase PF00982: Glycosyltransferase family 20 5.23 50435 G1 specific pathways 2.1.1 BAC71648.1 Non-secretory protein CDS SAVERM_3937 4862155 4861292 otsB putative trehalose-6-phosphatase PF02358: Trehalose-phosphatase 4.89 29666 G1 miscellaneous 4.7 BAC71649.1 Non-secretory protein CDS SAVERM_3938 4862502 4862257 hypothetical protein PF11662: Protein of unknown function (DUF3263) 11.09 9296 G1 similar to unknown proteins 5 BAC71650.1 Non-secretory protein CDS SAVERM_3939 4863861 4862584 putative ABC transporter substrate-binding protein PF01547: Bacterial extracellular solute-binding protein 5.01 44970 G1 transport / binding proteins & lipoproteins 1.2 BAC71651.1 Signal peptide CDS SAVERM_3940 4864012 4864917 putative ROK-family transcriptional regulator PF00480: ROK family 5.9 30517 G1 regulation 3.5.2 BAC71652.1 Non-secretory protein CDS SAVERM_3941 4864917 4866062 nagA putative N-acetylglucosamine-6-phosphate deacetylase PF01979: Amidohydrolase family 4.79 39480 G1 specific pathways 2.1.1 BAC71653.1 Non-secretory protein CDS SAVERM_3942 4866207 4867136 fruK putative tagatose-6-phosphate kinase PF00294: pfkB family carbohydrate kinase 7.24 32080 G1 miscellaneous 4.7 BAC71654.1 Non-secretory protein CDS SAVERM_3943 4868160 4867210 putative dimeric protein PF03422: Carbohydrate binding module (family 6) 5.99 32137 G1 miscellaneous 4.7 BAC71655.1 Non-secretory protein CDS SAVERM_3944 4869984 4868278 hypothetical protein PF00990: GGDEF domain 6.02 62452 G1 similar to unknown proteins 5 BAC71656.1 Non-secretory protein CDS SAVERM_3945 4870392 4870970 thiX2 putative flavin-dependent reductase PF01613: Flavin reductase like domain 5.23 20181 G1 miscellaneous 4.7 BAC71657.1 Non-secretory protein CDS SAVERM_3946 4871577 4871149 hypothetical protein PF00472: Peptidyl-tRNA hydrolase domain 12.01 15934 G1 similar to unknown proteins 5 BAC71658.1 Non-secretory protein CDS SAVERM_3947 4871772 4872347 terD2 putative tellurium resistance protein PF02342: Bacterial stress protein 4.29 20225 G1 detoxification 4.2 BAC71659.1 Non-secretory protein CDS SAVERM_3948 4873561 4872707 putative DNA-binding protein PF01381: Helix-turn-helix 6.69 31765 G1 regulation 3.5.2 BAC71660.1 Non-secretory protein CDS SAVERM_3949 4873781 4874197 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.34 14434 G1 regulation 3.5.2 BAC71661.1 Non-secretory protein CDS SAVERM_3950 4874208 4875164 putative MutT-like protein PF00293: NUDIX domain 4.94 35007 G1 miscellaneous 4.7 BAC71662.1 Non-secretory protein CDS SAVERM_3951 4875231 4876352 putative IS630 family ISPsy1-like transposase IS630 family (4875165..4876348). Inverted repeat sequence (10/10 bp). Target sequence (CTAG). 9.36 39584 G1 transposon & IS 4.5 BAC71663.1 Non-secretory protein CDS SAVERM_3952 4877802 4876393 putative metallopeptidase, secreted PF01433: Peptidase family M1 5.02 50789 G1 protein modification 3.8 BAC71664.1 Signal peptide CDS SAVERM_3953 4877882 4878382 hypothetical protein 4.48 19323 G1 similar to unknown proteins 5 BAC71665.1 Non-secretory protein CDS SAVERM_3954 4879224 4878430 hypothetical protein PF00805: Pentapeptide repeats (8 copies) 5.04 27428 G1 similar to unknown proteins 5 BAC71666.1 Non-secretory protein CDS SAVERM_3955 4879303 4880472 putative secreted protein PF01593: Flavin containing amine oxidoreductase 10.69 41950 G1 similar to unknown proteins 5 BAC71667.1 Signal peptide CDS SAVERM_3956 4880526 4881515 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 6.98 33991 G1 miscellaneous 4.7 BAC71668.1 Non-secretory protein CDS SAVERM_3957 4881639 4883138 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.75 52226 G1 transport / binding proteins & lipoproteins 1.2 BAC71669.1 Non-secretory protein CDS SAVERM_3958 4883690 4883217 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.88 17569 G1 miscellaneous 4.7 BAC71670.1 Non-secretory protein CDS SAVERM_3959 4885193 4883778 putative FAD-dependent oxidoreductase PF01266: FAD dependent oxidoreductase 9.24 51436 G1 miscellaneous 5 BAC71671.1 Non-secretory protein CDS SAVERM_3960 4885794 4885204 hypothetical protein PF01694: Rhomboid family 7.64 21440 G1 similar to unknown proteins 5 BAC71672.1 Non-secretory protein CDS SAVERM_3961 4885883 4886776 hur putative hydroxyurea phosphotransferase hydroxyurea resistance protein, PF04655: Aminoglycoside/hydroxyurea antibiotic resistance kinase 4.94 32945 G1 detoxification 4.2 BAC71673.1 Non-secretory protein CDS SAVERM_3962 4887143 4888279 msiK putative multiple sugar ABC transporter ATP-binding protein (cellobiose transport system ATP-binding protein; smoK) malK, PF00005: ABC transporter 5.74 40563 G1 transport / binding proteins & lipoproteins 1.2 BAC71674.1 Non-secretory protein CDS SAVERM_3963 4888508 4888966 putative secreted protein 11.91 16225 G1 similar to unknown proteins 5 BAC71675.1 Non-secretory protein CDS SAVERM_3964 4889067 4889798 putative guanyltransferase PF00483: Nucleotidyl transferase 5.63 26465 G1 miscellaneous 4.7 BAC71676.1 Non-secretory protein CDS SAVERM_3965 4891683 4889986 putative integral membrane protein PF07681: DoxX 7.18 57976 G1 miscellaneous 4.7 BAC71677.1 Non-secretory protein CDS SAVERM_3966 4892763 4891822 putative tRNA/rRNA methyltransferase PF00588: SpoU rRNA Methylase family 10.41 33000 G1 RNA modification 3.6 BAC71678.1 Non-secretory protein CDS SAVERM_3967 4894266 4892866 cysS putative cysteinyl-tRNA synthetase PF01406: tRNA synthetases class I (C) catalytic domain 5 52241 G1 aminoacyl-tRNA-synthetase 3.7.2 BAC71679.1 Non-secretory protein CDS SAVERM_3968 4895001 4894477 ispF putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase MEP pathway, EC 4.6.1.12 5.19 17499 G1 specific pathways 2.1.1 BAC71680.1 Non-secretory protein CDS SAVERM_3969 4895743 4894991 ispD putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase MEP pathway, EC 2.7.7.60 5.14 26033 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71681.1 Non-secretory protein CDS SAVERM_3970 4896579 4896097 putative CarD-like transcriptional regulator PF02559: CarD-like/TRCF domain 5.39 17829 G1 regulation 3.5.2 BAC71682.1 Non-secretory protein CDS SAVERM_3971 4897210 4897872 putative lipoprotein PF04314: Protein of unknown function (DUF461) 9.71 21226 G1 transport / binding proteins & lipoproteins 1.2 BAC71683.1 Signal peptide CDS SAVERM_3972 4898742 4898071 phoP putative two-component system response regulator PF00072: Response regulator receiver domain 4.83 24774 G1 regulation 3.5.2 BAC71684.1 Non-secretory protein CDS SAVERM_3973 4900025 4898748 phoR putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.85 45369 G1 sensors 1.3 BAC71685.1 Non-secretory protein CDS SAVERM_3974 4900250 4900939 phoU putative phosphate transport system regulatory protein PF01895: PhoU family 4.67 25429 G1 regulation 3.5.2 BAC71686.1 Non-secretory protein CDS SAVERM_3975 4901307 4901155 hypothetical protein 4.3 5042 G1 similar to unknown proteins 5 BAC71687.1 Non-secretory protein CDS SAVERM_3976 4902474 4901452 putative oxidoreductase PF00248: Aldo/keto reductase family 4.97 36473 G1 miscellaneous 4.7 BAC71688.1 Non-secretory protein CDS SAVERM_3977 4902641 4903567 putative AraC-family transcriptional regulator PF06719: AraC-type transcriptional regulator N-terminus 8.23 33267 G1 regulation 3.5.2 BAC71689.1 Non-secretory protein CDS SAVERM_3978 4904975 4903668 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 9.06 45485 G1 transport / binding proteins & lipoproteins 1.2 BAC71690.1 Non-secretory protein CDS SAVERM_3979 4905162 4905923 gpmA1 putative 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase PF00300: Phosphoglycerate mutase family 5.92 28184 G1 main glycolytic pathways 2.1.2 BAC71691.1 Non-secretory protein CDS SAVERM_3980 4907955 4906639 int9 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 10.49 48746 G1 phage-related functions 4.4 BAC71692.1 Non-secretory protein CDS SAVERM_3981 4908194 4907955 hypothetical protein 11.09 9127 G1 no similarity 6 BAC71693.1 Non-secretory protein CDS SAVERM_3982 4909554 4908187 repSA2 putative replication initiation protein 10.13 49718 G1 DNA replication 3.1 BAC71694.1 Non-secretory protein CDS SAVERM_3983 4909908 4909627 spdD2 putative SpdD protein 11.43 9841 G1 plasmid transfer 4.7.2 BAC71695.1 Non-secretory protein CDS SAVERM_3984 4910095 4909901 hypothetical protein 9.3 6994 G1 no similarity 6 BAC71696.1 Non-secretory protein CDS SAVERM_3985 4910303 4910112 spdB2 putative mobile element transfer protein SpdB PF05122: Mobile element transfer protein 11.16 7058 G1 plasmid transfer 4.7.2 BAC71697.1 Non-secretory protein CDS SAVERM_3986 4910944 4910315 spdA2 putative mobile element transfer protein SpdA 11.93 22308 G1 plasmid transfer 4.7.2 BAC71698.1 Signal peptide CDS SAVERM_3987 4912445 4911150 traSA2 putative plasmid transfer protein PF01580: FtsK/SpoIIIE family 9.17 46494 G1 plasmid transfer 4.7.2 BAC71699.1 Non-secretory protein CDS SAVERM_3988 4912801 4912445 pra2 putative replication activator protein Pra 4.81 12217 G1 DNA replication 3.1 BAC71700.1 Non-secretory protein CDS SAVERM_3989 4913759 4912971 korSA2 putative regulatory protein KorSA, GntR-family transcriptional regulator PF07702: UTRA domain 7.86 29106 G1 regulation 3.5.2 BAC71701.1 Non-secretory protein CDS SAVERM_3990 4913786 4914274 putative MutT-like protein PF00293: NUDIX domain 4.66 17508 G1 miscellaneous 4.7 BAC71702.1 Non-secretory protein CDS SAVERM_3991 4914291 4914755 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.95 16273 G1 regulation 3.5.2 BAC71703.1 Non-secretory protein CDS SAVERM_3992 4914749 4915141 hypothetical protein 9.97 14879 G1 no similarity 6 BAC71704.1 Non-secretory protein CDS SAVERM_3993 4915616 4915182 hypothetical protein 11.83 15906 G1 no similarity 6 BAC71705.1 Non-secretory protein CDS SAVERM_3994 4915779 4916903 pkn8 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.27 43141 G1 protein modification 3.8 BAC71706.1 Non-secretory protein CDS SAVERM_3995 4916980 4917876 hypothetical protein 4.75 34180 G1 similar to unknown proteins 5 BAC71707.1 Non-secretory protein CDS SAVERM_3996 4918085 4918567 hypothetical protein 12.17 17678 G1 no similarity 6 BAC71708.1 Non-secretory protein CDS SAVERM_3997 4919292 4918858 hypothetical protein PF07366: Protein of unknown function (DUF1486) 5.6 15474 G1 similar to unknown proteins 5 BAC71709.1 Non-secretory protein CDS SAVERM_3998 4919565 4920089 hypothetical protein 6.96 18025 G1 no similarity 6 BAC71710.1 Non-secretory protein CDS SAVERM_3999 4920086 4921093 hypothetical protein 6.64 36312 G1 no similarity 6 BAC71711.1 Non-secretory protein CDS SAVERM_4000 4921426 4921935 putative secreted protein Tat substrate 8.37 17778 G1 no similarity 6 BAC71712.1 Signal peptide CDS SAVERM_4001 4922481 4921900 hypothetical protein 7.17 21096 G1 similar to unknown proteins 5 BAC71713.1 Non-secretory protein CDS SAVERM_4002 4922972 4922628 hypothetical protein PF09391: Protein of unknown function (DUF2000) 7.78 12366 G1 similar to unknown proteins 5 BAC71714.1 Non-secretory protein CDS SAVERM_4003 4923144 4923956 putative AraC-family transcriptional regulator PF02311: AraC-like ligand binding domain 9.57 30423 G1 regulation 3.5.2 BAC71715.1 Non-secretory protein CDS SAVERM_4004 4925701 4923935 putative secreted protein Tat substrate 9.18 63429 G1 similar to unknown proteins 5 BAC71716.1 Signal peptide CDS SAVERM_4005 4926343 4925852 hypothetical protein PF10770: Protein of unknown function (DUF2596) 5.27 17899 G1 similar to unknown proteins 5 BAC71717.1 Non-secretory protein CDS SAVERM_4006 4927730 4926336 mshA putative glycosyltransferase (forming 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside) mycothiol biosynthesis, PF00534: Glycosyl transferases group 1 9.93 49980 G1 specific pathways 2.1.1 BAC71718.1 Non-secretory protein CDS SAVERM_4007 4927874 4928692 hypothetical protein 10.95 29825 G1 similar to unknown proteins 5 BAC71719.1 Non-secretory protein CDS SAVERM_4008 4928935 4930026 putative NLP/P60-family secreted protein (PgpA peptidase) Seems to have a cleavable N-term signal sequence, PF00877: NlpC/P60 family 9.36 38732 G1 miscellaneous 4.7 BAC71720.1 Signal peptide CDS SAVERM_4009 4930332 4931780 prpG1 putative magnesium or manganese-dependent protein phosphatase PF00072: Response regulator receiver domain 6.59 52038 G1 protein modification 3.8 BAC71721.1 Non-secretory protein CDS SAVERM_4010 4932180 4931839 putative membrane protein 11.08 12254 G1 miscellaneous 4.7 BAC71722.1 Non-secretory protein CDS SAVERM_4011 4932896 4932294 hypothetical protein PF05558: DREPP plasma membrane polypeptide 6.1 21282 G1 similar to unknown proteins 5 BAC71723.1 Non-secretory protein CDS SAVERM_4012 4933451 4932975 putative DNA-binding protein PF01381: Helix-turn-helix 4.72 17204 G1 regulation 3.5.2 BAC71724.1 Non-secretory protein CDS SAVERM_4013 4933625 4934038 putative integral membrane protein 10.03 14053 G1 miscellaneous 4.7 BAC71725.1 Non-secretory protein CDS SAVERM_4014 4935080 4934070 putative oxidoreductase PF00724: NADH:flavin oxidoreductase / NADH oxidase family 6.58 35327 G1 miscellaneous 4.7 BAC71726.1 Non-secretory protein CDS SAVERM_4015 4935246 4935623 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 7.62 13916 G1 regulation 3.5.2 BAC71727.1 Non-secretory protein CDS SAVERM_4016 4937714 4935669 helD2 putative ATP-dependent DNA helicase PF00270: DEAD/DEAH box helicase 6.91 73768 G1 DNA modification & repair 3.2 BAC71728.1 Non-secretory protein CDS SAVERM_4017 4938455 4937841 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.69 21705 G1 regulation 3.5.2 BAC71729.1 Non-secretory protein CDS SAVERM_4018 4938560 4939528 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.67 32644 G1 miscellaneous 4.7 BAC71730.1 Non-secretory protein CDS SAVERM_4019 4941824 4939587 hypothetical protein PF01636: Phosphotransferase enzyme family 9.11 81212 G1 similar to unknown proteins 5 BAC71731.1 Non-secretory protein CDS SAVERM_4020 4942890 4942087 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 7.3 29382 G1 miscellaneous 4.7 BAC71732.1 Non-secretory protein CDS SAVERM_4021 4943717 4942839 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 5.94 32701 G1 regulation 3.5.2 BAC71733.1 Non-secretory protein CDS SAVERM_4022 4943871 4944059 hypothetical protein 9.4 6280 G1 similar to unknown proteins 5 BAC71734.1 Non-secretory protein CDS SAVERM_4023 4944983 4944066 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 8.27 33962 G1 regulation 3.5.2 BAC71735.1 Non-secretory protein CDS SAVERM_4024 4946601 4945345 hypothetical protein PF00583: Acetyltransferase (GNAT) family 5.68 46000 G1 similar to unknown proteins 5 BAC71736.1 Non-secretory protein CDS SAVERM_4025 4947714 4946725 ansA2 putative L-asparaginase II PF06089: L-asparaginase II 6.31 33801 G1 similar to unknown proteins 5 BAC71737.1 Non-secretory protein CDS SAVERM_4026 4948501 4947905 amfC putative AmfC protein aerial mycelium formation 6.3 21817 G1 miscellaneous 4.7 BAC71738.1 Non-secretory protein CDS SAVERM_4027 4948672 4949109 dtd putative D-tyrosyl-tRNA(Tyr) deacylase-like protein PF02580: D-Tyr-tRNA(Tyr) deacylase 4.53 15446 G1 RNA modification 3.6 BAC71739.1 Non-secretory protein CDS SAVERM_4028 4950124 4949159 hypothetical protein PF01571: Glycine cleavage T-protein (aminomethyl transferase) 5.99 34846 G1 similar to unknown proteins 5 BAC71740.1 Non-secretory protein CDS SAVERM_4029 4950572 4950135 furA putative ferric uptake regulatory protein PF01475: Ferric uptake regulator family 7.06 16321 G1 regulation 3.5.2 BAC71741.1 Non-secretory protein CDS SAVERM_4030 4951224 4950649 hypothetical protein PF08768: Domain of unknown function 4.83 21365 G1 similar to unknown proteins 5 BAC71742.1 Non-secretory protein CDS SAVERM_4031 4952359 4951514 hypothetical protein 5.03 30229 G1 similar to unknown proteins 5 BAC71743.1 Non-secretory protein CDS SAVERM_4032 4953147 4952356 putative secreted protein 9.83 27954 G1 similar to unknown proteins 5 BAC71744.1 Non-secretory protein CDS SAVERM_4033 4954115 4953222 hypothetical protein 5.25 31976 G1 similar to unknown proteins 5 BAC71745.1 Non-secretory protein CDS SAVERM_4034 4954208 4954555 hypothetical protein PF02635: DsrE/DsrF-like family 4.15 11989 G1 similar to unknown proteins 5 BAC71746.1 Non-secretory protein CDS SAVERM_4035 4955196 4954885 hypothetical protein PF11298: Protein of unknown function (DUF3099) 10.11 11788 G1 similar to unknown proteins 5 BAC71747.1 Non-secretory protein CDS SAVERM_4036 4955521 4955234 hypothetical protein PF07210: Protein of unknown function (DUF1416) 4.42 9643 G1 similar to unknown proteins 5 BAC71748.1 Non-secretory protein CDS SAVERM_4037 4956391 4955552 sseA putative thiosulfate sulfurtransferase PF00581: Rhodanese-like domain 4.53 31592 G1 metabolism of sulfur 2.7 BAC71749.1 Non-secretory protein CDS SAVERM_4038 4957581 4956838 putative membrane protein 4.49 25577 G1 miscellaneous 4.7 BAC71750.1 Non-secretory protein CDS SAVERM_4039 4959025 4957811 putative integral membrane protein PF01925: Domain of unknown function DUF81 5.92 41681 G1 miscellaneous 4.7 BAC71751.1 Non-secretory protein CDS SAVERM_4040 4959276 4959022 moaD putative molybdopterin converting factor PF02597: ThiS family 5.08 8890 G1 metabolism of coenzymes & prosthetic groups 2.5 BAC71752.1 Non-secretory protein CDS SAVERM_4041 4960262 4959369 putative hydrolase PF00326: Prolyl oligopeptidase family 10.67 31877 G1 miscellaneous 4.7 BAC71753.1 Non-secretory protein CDS SAVERM_4042 4960555 4961364 putative two-component system response regulator PF00486: Transcriptional regulatory protein, C terminal 4.92 28732 G1 regulation 3.5.2 BAC71754.1 Non-secretory protein CDS SAVERM_4043 4961428 4962471 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.47 37410 G1 regulation 3.5.2 BAC71755.1 Non-secretory protein CDS SAVERM_4044 4964491 4962728 putative secreted trypsin-like protease PF00089: Trypsin 5.36 62542 G1 protein modification 3.8 BAC71756.1 Signal peptide CDS SAVERM_4045 4964900 4966135 putative Htra2 peptidase PF00089: Trypsin 4.47 40757 G1 protein modification 3.8 BAC71757.1 Non-secretory protein CDS SAVERM_4046 4966152 4966406 hypothetical protein 11.52 9194 G1 no similarity 6 BAC71758.1 Non-secretory protein CDS SAVERM_4047 4966793 4967524 mprA putative two-component system response regulator PF00072: Response regulator receiver domain 4.61 26859 G1 regulation 3.5.2 BAC71759.1 Non-secretory protein CDS SAVERM_4048 4967521 4969005 mprB putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.38 52184 G1 sensors 1.3 BAC71760.1 Signal peptide CDS SAVERM_4049 4969225 4969010 putative regulatory protein PF04149: Domain of unknown function (DUF397) 4.49 7443 G1 regulation 3.5.2 BAC71761.1 Non-secretory protein CDS SAVERM_4050 4970046 4969213 putative DNA-binding protein PF01381: Helix-turn-helix 5.83 31320 G1 regulation 3.5.2 BAC71762.1 Non-secretory protein CDS SAVERM_4051 4970507 4970803 hypothetical protein 5.06 10322 G1 similar to unknown proteins 5 BAC71763.1 Non-secretory protein CDS SAVERM_4052 4972535 4970862 putative ABC transporter permease protein PF03023: MviN-like protein 10.52 58851 G1 transport / binding proteins & lipoproteins 1.2 BAC71764.1 Non-secretory protein CDS SAVERM_4053 4974417 4972612 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.4 64388 G1 transport / binding proteins & lipoproteins 1.2 BAC71765.1 Non-secretory protein CDS SAVERM_4054 4974504 4974677 hypothetical protein 12.05 6012 G1 no similarity 6 BAC71766.1 Non-secretory protein CDS SAVERM_4055 4974867 4974733 hypothetical protein 12.71 4866 G1 no similarity 6 BAC71767.1 Signal peptide CDS SAVERM_4056 4976189 4975110 putative secreted protein 11.71 38965 G1 similar to unknown proteins 5 BAC71768.1 Non-secretory protein CDS SAVERM_4057 4978272 4976461 ushA putative 5’-nucleotidase, secreted PF02872: 5'-nucleotidase, C-terminal domain 6.65 62430 G1 DNA modification & repair 3.2 BAC71769.1 Signal peptide CDS SAVERM_4058 4978424 4979350 mshD putative N-cysteinyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside acetyltransferase mycothiol biosynthesis(mycothiol synthase), PF00583: Acetyltransferase (GNAT) family 6.04 32903 G1 adaptation to atypical conditions 4.1 BAC71770.1 Non-secretory protein CDS SAVERM_4059 4980002 4979424 putative ABC transporter permease protein 11.77 19711 G1 transport / binding proteins & lipoproteins 1.2 BAC71771.1 Non-secretory protein CDS SAVERM_4060 4981669 4980098 putative ABC transporter permease protein PF01478: Type IV leader peptidase family 6.32 55097 G1 transport / binding proteins & lipoproteins 1.2 BAC71772.1 Non-secretory protein CDS SAVERM_4061 4982532 4981666 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.89 30820 G1 transport / binding proteins & lipoproteins 1.2 BAC71773.1 Non-secretory protein CDS SAVERM_4062 4982830 4982624 putative secreted protein 12.4 6872 G1 no similarity 6 BAC71774.1 Non-secretory protein CDS SAVERM_4063 4983687 4982830 putative integral membrane protein PF01148: Cytidylyltransferase family 6.79 29766 G1 miscellaneous 4.7 BAC71775.1 Non-secretory protein CDS SAVERM_4064 4984223 4983684 sig33 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4146, PF04542: Sigma-70 region 2 11.04 19904 G1 RNA initiation 3.5.1 BAC71776.1 Non-secretory protein CDS SAVERM_4065 4984323 4984721 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 7.54 14635 G1 regulation 3.5.2 BAC71777.1 Non-secretory protein CDS SAVERM_4066 4984718 4985635 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.73 31872 G1 transport / binding proteins & lipoproteins 1.2 BAC71778.1 Non-secretory protein CDS SAVERM_4067 4985632 4986573 putative ABC transporter permease protein 9.83 33603 G1 transport / binding proteins & lipoproteins 1.2 BAC71779.1 Non-secretory protein CDS SAVERM_4068 4986585 4987538 putative secreted protein 7.61 33253 G1 similar to unknown proteins 5 BAC71780.1 Non-secretory protein CDS SAVERM_4069 4987758 4990112 ppk putative polyphosphate kinase PF02503: Polyphosphate kinase 6.37 87649 G1 miscellaneous 4.7 BAC71781.1 Non-secretory protein CDS SAVERM_4070 4990093 4991175 hypothetical protein PF05235: CHAD domain 9.46 38291 G1 similar to unknown proteins 5 BAC71782.1 Non-secretory protein CDS SAVERM_4071 4991242 4991655 hypothetical protein PF00293: NUDIX domain 9.68 15354 G1 similar to unknown proteins 5 BAC71783.1 Non-secretory protein CDS SAVERM_4072 4991906 4993012 pstS putative phosphate ABC transporter substrate-binding protein Tat substrate, PF01547: Bacterial extracellular solute-binding protein 8.16 37978 G1 transport / binding proteins & lipoproteins 1.2 BAC71784.1 Signal peptide CDS SAVERM_4073 4993113 4994120 pstC putative phosphate ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 8.91 35313 G1 transport / binding proteins & lipoproteins 1.2 BAC71785.1 Non-secretory protein CDS SAVERM_4074 4994117 4995178 pstA putative phosphate ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.29 37529 G1 transport / binding proteins & lipoproteins 1.2 BAC71786.1 Non-secretory protein CDS SAVERM_4075 4995253 4996029 pstB putative phosphate ABC transporter ATP-binding protein PF00005: ABC transporter 5.44 28230 G1 transport / binding proteins & lipoproteins 1.2 BAC71787.1 Non-secretory protein CDS SAVERM_4076 4997431 4996433 pitH1 putative low-affinity inorganic phosphate transporter PF01384: Phosphate transporter family 10.29 34645 G1 transport / binding proteins & lipoproteins 1.2 BAC71788.1 Non-secretory protein CDS SAVERM_4077 4998059 4997439 putative Pit accessory protein PF01865: Protein of unknown function DUF47 4.24 23229 G1 miscellaneous 4.7 BAC71789.1 Non-secretory protein CDS SAVERM_4078 4998272 4998628 hypothetical protein PF02583: Uncharacterised BCR, COG1937 6.79 12944 G1 similar to unknown proteins 5 BAC71790.1 Non-secretory protein CDS SAVERM_4079 4998918 4998730 hypothetical protein 4.06 6633 G1 no similarity 6 BAC71791.1 Non-secretory protein CDS SAVERM_4080 4999903 4999070 putative lipoprotein 10.35 28680 G1 transport / binding proteins & lipoproteins 1.2 BAC71792.1 Signal peptide CDS SAVERM_4081 5000470 5002047 putative lipoprotein Tat substrate, PF01565: FAD binding domain 10 54609 G1 transport / binding proteins & lipoproteins 1.2 BAC71793.1 Signal peptide CDS SAVERM_4082 5002833 5002135 putative integral membrane protein PF01569: PAP2 superfamily 6.52 24707 G1 miscellaneous 4.7 BAC71794.1 Non-secretory protein CDS SAVERM_4083 5004034 5003027 putative secreted transglycosylase PF00877: NlpC/P60 family 6.28 35155 G1 miscellaneous 4.7 BAC71795.1 Non-secretory protein CDS SAVERM_4084 5005890 5004166 pkn9 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 5.92 60109 G1 protein modification 3.8 BAC71796.1 Non-secretory protein CDS SAVERM_4085 5006737 5005913 putative secreted protein PF00089: Trypsin 5.04 28255 G1 similar to unknown proteins 5 BAC71797.1 Signal peptide CDS SAVERM_4086 5007181 5006750 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.94 15280 G1 regulation 3.5.2 BAC71798.1 Non-secretory protein CDS SAVERM_4087 5007367 5008239 putative DNA-binding protein PF01381: Helix-turn-helix 6.92 32448 G1 regulation 3.5.2 BAC71799.1 Non-secretory protein CDS SAVERM_4088 5008236 5008451 hypothetical protein PF04149: Domain of unknown function (DUF397) 7.58 7799 G1 no similarity 6 BAC71800.1 Non-secretory protein CDS SAVERM_4089 5008444 5008689 hypothetical protein PF04149: Domain of unknown function (DUF397) 3.71 8810 G1 no similarity 6 BAC71801.1 Non-secretory protein CDS SAVERM_4090 5009085 5008711 hypothetical protein 5.21 13815 G1 similar to unknown proteins 5 BAC71802.1 Non-secretory protein CDS SAVERM_4091 5009873 5009394 hypothetical protein 4.57 17471 G1 similar to unknown proteins 5 BAC71803.1 Non-secretory protein CDS SAVERM_4092 5010520 5009903 hypothetical protein PF00805: Pentapeptide repeats (8 copies) 4.25 21472 G1 similar to unknown proteins 5 BAC71804.1 Non-secretory protein CDS SAVERM_4093 5011432 5010521 hypothetical protein 4.68 34329 G1 no similarity 6 BAC71805.1 Non-secretory protein CDS SAVERM_4094 5013994 5011670 hypothetical protein 4.77 81274 G1 similar to unknown proteins 5 BAC71806.1 Non-secretory protein CDS SAVERM_4095 5014383 5013991 hypothetical protein 5.56 13122 G1 no similarity 6 BAC71807.1 Non-secretory protein CDS SAVERM_4096 5014741 5014424 hypothetical protein 5.88 11155 G1 no similarity 6 BAC71808.1 Non-secretory protein CDS SAVERM_4097 5015124 5014792 hypothetical protein 4.76 11480 G1 no similarity 6 BAC71809.1 Non-secretory protein CDS SAVERM_4098 5015883 5016191 putative integral membrane protein 4.8 10441 G1 miscellaneous 4.7 BAC71810.1 Non-secretory protein CDS SAVERM_4099 5016402 5017253 putative integral membrane protein 4.65 29632 G1 miscellaneous 4.7 BAC71811.1 Non-secretory protein CDS SAVERM_4100 5017243 5018577 putative integral membrane protein Tat substrate, PF04610: TrbL/VirB6 plasmid conjugal transfer protein 10.24 45173 G1 miscellaneous 4.7 BAC71812.1 Signal peptide CDS SAVERM_4101 5018592 5020133 putative membrane protein 9.65 56954 G1 miscellaneous 4.7 BAC71813.1 Non-secretory protein CDS SAVERM_4102 5020173 5021603 putative ATP/GTP-binding protein 4.79 52306 G1 miscellaneous 4.7 BAC71814.1 Non-secretory protein CDS SAVERM_4103 5021723 5023351 putative membrane protein 7.08 57168 G1 miscellaneous 4.7 BAC71815.1 Non-secretory protein CDS SAVERM_4104 5023974 5023429 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.95 19942 G1 miscellaneous 4.7 BAC71816.1 Non-secretory protein CDS SAVERM_4105 5030477 5029929 putative MarR-family transcriptional regulator PF01047: MarR family 4.75 20187 H regulation 3.5.2 BAC71817.1 Non-secretory protein CDS SAVERM_4106 5030639 5031910 putative membrane protein PF07690: Major Facilitator Superfamily 10.43 43274 H transport / binding proteins & lipoproteins 1.2 BAC71818.1 Non-secretory protein CDS SAVERM_4107 5032807 5031992 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 4.74 28361 H miscellaneous 4.7 BAC71819.1 Non-secretory protein CDS SAVERM_4108 5034567 5032918 prpI3 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.8 58628 H protein modification 3.8 BAC71820.1 Non-secretory protein CDS SAVERM_4109 5036010 5034691 ndh3 putative NADH dehydrogenase (complex I) PF00070: Pyridine nucleotide-disulphide oxidoreductase 8.95 48241 H membrane bioenergetics 1.4 BAC71821.1 Non-secretory protein CDS SAVERM_4110 5036435 5037193 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.43 26759 H regulation 3.5.2 BAC71822.1 Non-secretory protein CDS SAVERM_4111 5040880 5037479 putative transcriptional regulator PF03704: Bacterial transcriptional activator domain 4.89 122599 H regulation 3.5.2 BAC71823.1 Non-secretory protein CDS SAVERM_4112 5042774 5041026 hypothetical protein PF00733: Asparagine synthase 10.55 60113 H similar to unknown proteins 5 BAC71824.1 Non-secretory protein CDS SAVERM_4113 5043789 5045213 sap putative sporulation associated protein, secreted PF07719: Tetratricopeptide repeat 8.06 50921 H sporulation 1.8 BAC71825.1 Non-secretory protein CDS SAVERM_4114 5045350 5046591 hypothetical protein PF01266: FAD dependent oxidoreductase 9.9 44499 H similar to unknown proteins 5 BAC71826.1 Non-secretory protein CDS SAVERM_4115 5046990 5047862 trmB putative tRNA (guanine-N(7)-)-methyltransferase PF02390: Putative methyltransferase 6.68 32245 H RNA modification 3.6 BAC71827.1 Non-secretory protein CDS SAVERM_4116 5047927 5049288 putative membrane protein PF01925: Domain of unknown function DUF81 10.51 49433 H miscellaneous 4.7 BAC71828.1 Non-secretory protein CDS SAVERM_4117 5050272 5049328 putative oxidoreductase PF00248: Aldo/keto reductase family 4.76 33182 H miscellaneous 4.7 BAC71829.1 Non-secretory protein CDS SAVERM_4118 5051465 5050422 putative zoocin A PF01551: Peptidase family M23 6.41 35705 H protein modification 3.8 BAC71830.1 Non-secretory protein CDS SAVERM_4119 5053286 5052156 ribD putative diaminohydroxyphosphoribosylaminopyrimidine deaminase (N-terminal)/ 5-amino-6-(5-phosphoribosylamino) uracil reductase PF01872: RibD C-terminal domain 5.68 39881 H metabolism of coenzymes & prosthetic groups 2.5 BAC71831.1 Non-secretory protein CDS SAVERM_4120 5053338 5053838 putative MarR-family transcriptional regulator PF01047: MarR family 6.27 18691 H regulation 3.5.2 BAC71832.1 Non-secretory protein CDS SAVERM_4121 5054141 5054848 ribA3 putative GTP cyclohydrolase II riboflavin biosynthesis, PF00925: GTP cyclohydrolase II 4.85 25311 H metabolism of coenzymes & prosthetic groups 2.5 BAC71833.1 Non-secretory protein CDS SAVERM_4122 5057240 5055705 putative amino acid permease PF00324: Amino acid permease 7.12 55048 H transport / binding proteins & lipoproteins 1.2 BAC71834.1 Non-secretory protein CDS SAVERM_4123 5059710 5057467 putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 9.85 81948 H RNA modification 3.6 BAC71835.1 Non-secretory protein CDS SAVERM_4124 5060583 5060143 hypothetical protein 6.51 13486 H similar to unknown proteins 5 BAC71836.1 Non-secretory protein CDS SAVERM_4125 5061188 5060838 hypothetical protein PF06262: Domain of unknown function (DUF1025) 4.02 13238 H similar to unknown proteins 5 BAC71837.1 Non-secretory protein CDS SAVERM_4126 5061300 5062937 putative membrane protein PF00149: Calcineurin-like phosphoesterase 8.9 57993 H miscellaneous 4.7 BAC71838.1 Non-secretory protein CDS SAVERM_4127 5063566 5063889 hypothetical protein 10.23 11160 H no similarity 6 BAC71839.1 Non-secretory protein CDS SAVERM_4128 5064051 5068028 hrpA putative ATP-dependent helicase PF04408: Helicase associated domain (HA2) 7.95 149924 H DNA modification & repair 3.2 BAC71840.1 Non-secretory protein CDS SAVERM_4129 5068384 5068575 hypothetical protein 7.58 6904 H no similarity 6 BAC71841.1 Non-secretory protein CDS SAVERM_4130 5069299 5069093 bldC putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 11.4 7545 H regulation 3.5.2 BAC71842.1 Non-secretory protein CDS SAVERM_4131 5070745 5069900 hypothetical protein 7.66 31829 H similar to unknown proteins 5 BAC71843.1 Non-secretory protein CDS SAVERM_4132 5070973 5072058 vdh putative valine dehydrogenase (NADP+) PF02812: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain 5.59 38054 H metabolism of amino acids & related molecules 2.2 BAC71844.1 Non-secretory protein CDS SAVERM_4133 5072358 5072609 hypothetical protein PF11273: Protein of unknown function (DUF3073) 4 9072 H similar to unknown proteins 5 BAC71845.1 Non-secretory protein CDS SAVERM_4134 5073851 5072757 purM putative phosphoribosylaminoimidazole synthetase PF00586: AIR synthase related protein, N-terminal domain 4.46 38185 H metabolism of nucleotides & nucleic acids 2.3 BAC71846.1 Non-secretory protein CDS SAVERM_4135 5075464 5073884 purF putative phosphoribosylpyrophosphate amidotransferase PF00310: Glutamine amidotransferases class-II 5.07 56097 H metabolism of nucleotides & nucleic acids 2.3 BAC71847.1 Non-secretory protein CDS SAVERM_4136 5076371 5075496 putative secreted protein PF03724: Domain of unknown function (306) 7.54 30520 H similar to unknown proteins 5 BAC71848.1 Signal peptide CDS SAVERM_4137 5077325 5076528 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 5.37 28800 H similar to unknown proteins 5 BAC71849.1 Non-secretory protein CDS SAVERM_4138 5079798 5077540 purL putative phosphoribosyl formylglycinamidine synthase II PF00586: AIR synthase related protein, N-terminal domain 4.44 79904 H metabolism of nucleotides & nucleic acids 2.3 BAC71850.1 Non-secretory protein CDS SAVERM_4139 5080499 5079795 purQ putative phosphoribosyl formylglycinamidine synthase I PF07722: Peptidase C26 5.58 25254 H metabolism of nucleotides & nucleic acids 2.3 BAC71851.1 Non-secretory protein CDS SAVERM_4140 5080762 5080496 purS putative phosphoribosylformylglycinamidine (FGAM) synthase, PurS component PF02700: Phosphoribosylformylglycinamidine (FGAM) synthase 4.33 9752 H metabolism of nucleotides & nucleic acids 2.3 BAC71852.1 Non-secretory protein CDS SAVERM_4141 5081122 5081439 putative Lsr2-like protein 10.13 11436 H miscellaneous 4.7 BAC71853.1 Non-secretory protein CDS SAVERM_4142 5082037 5083050 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.09 36452 H transport / binding proteins & lipoproteins 1.2 BAC71854.1 Non-secretory protein CDS SAVERM_4143 5083047 5083826 putative ABC transporter permease protein PF01061: ABC-2 type transporter 9.43 27331 H transport / binding proteins & lipoproteins 1.2 BAC71855.1 Non-secretory protein CDS SAVERM_4144 5083855 5085111 putative two-component system sensor kinase PF07730: Histidine kinase 8.66 43590 H sensors 1.3 BAC71856.1 Non-secretory protein CDS SAVERM_4145 5085153 5085755 putative two-component system response regulator PF00072: Response regulator receiver domain 5.62 21026 H regulation 3.5.2 BAC71857.1 Non-secretory protein CDS SAVERM_4146 5086805 5085906 purC putative phosphoribosylaminoimidazole-succinocarboxamide synthetase PF01259: SAICAR synthetase 4.67 33180 H metabolism of nucleotides & nucleic acids 2.3 BAC71858.1 Non-secretory protein CDS SAVERM_4147 5088553 5087009 hypothetical protein 6.44 56998 H similar to unknown proteins 5 BAC71859.1 Non-secretory protein CDS SAVERM_4148 5090698 5088716 putative membrane protein similar to phage coat protein 5.49 69365 H phage-related functions 4.4 BAC71860.1 Non-secretory protein CDS SAVERM_4149 5092349 5091096 purD putative phosphoribosylglycinamide synthetase PF01071: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain 4.44 42762 H metabolism of nucleotides & nucleic acids 2.3 BAC71861.1 Non-secretory protein CDS SAVERM_4150 5094970 5092430 dnaZX putative DNA polymerase III gamma and tau subunit PF00004: ATPase family associated with various cellular activities (AAA) 10.26 87497 H DNA replication 3.1 BAC71862.1 Non-secretory protein CDS SAVERM_4151 5095612 5098305 prpC6 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 4.98 96162 H protein modification 3.8 BAC71863.1 Signal peptide CDS SAVERM_4152 5098501 5100099 putative metallopeptidase, secreted PF01433: Peptidase family M1 7.1 57428 H protein modification 3.8 BAC71864.1 Non-secretory protein CDS SAVERM_4153 5100404 5102419 putative amidase PF01510: N-acetylmuramoyl-L-alanine amidase 6.75 72707 H miscellaneous 4.7 BAC71865.1 Signal peptide CDS SAVERM_4154 5102772 5102975 cspD3 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.54 7186 H adaptation to atypical conditions 4.1 BAC71866.1 Non-secretory protein CDS SAVERM_4155 5103407 5104915 putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 11.84 53331 H RNA modification 3.6 BAC71867.1 Non-secretory protein CDS SAVERM_4156 5105027 5105323 hypothetical protein PF00571: CBS domain 4.06 10515 H similar to unknown proteins 5 BAC71868.1 Non-secretory protein CDS SAVERM_4157 5105369 5105683 hypothetical protein 10.73 11208 H similar to unknown proteins 5 BAC71869.1 Non-secretory protein CDS SAVERM_4158 5107415 5105820 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.38 56408 H sensors 1.3 BAC71870.1 Signal peptide CDS SAVERM_4159 5108241 5107519 putative two-component system response regulator PF00072: Response regulator receiver domain 6.69 26385 H regulation 3.5.2 BAC71871.1 Non-secretory protein CDS SAVERM_4160 5108379 5109572 putative secreted protein 4.58 42085 H similar to unknown proteins 5 BAC71872.1 Signal peptide CDS SAVERM_4161 5109633 5110922 putative secreted protein Tat substrate 7.66 45326 H similar to unknown proteins 5 BAC71873.1 Signal peptide CDS SAVERM_4162 5112135 5111059 hypothetical protein 9.82 39183 H similar to unknown proteins 5 BAC71874.1 Non-secretory protein CDS SAVERM_4163 5113102 5112227 putative membrane protein 8.75 31093 H miscellaneous 4.7 BAC71875.1 Non-secretory protein CDS SAVERM_4164 5114418 5113132 putative membrane protein glycine-rich protein 6.74 40554 H miscellaneous 4.7 BAC71876.1 Signal peptide CDS SAVERM_4165 5114915 5115271 hypothetical protein PF05239: PRC-barrel domain 6.53 13187 H similar to unknown proteins 5 BAC71877.1 Non-secretory protein CDS SAVERM_4166 5117165 5115396 putative membrane protein PF04234: Copper resistance protein CopC 6.54 60521 H transport / binding proteins & lipoproteins 1.2 BAC71878.1 Non-secretory protein CDS SAVERM_4167 5117910 5117503 putative dehydrogenase frameshift, PF00106: short chain dehydrogenase 7.16 13970 H miscellaneous 4.7 BAC71880.1 Non-secretory protein CDS SAVERM_4168 5118334 5117411 putative dehydrogenase frameshift 12.47 31820 H miscellaneous 4.7 BAC71879.1 Non-secretory protein CDS SAVERM_4169 5118801 5118322 hypothetical protein PF06172: Protein of unknown function (DUF985) 4.54 17175 H similar to unknown proteins 5 BAC71881.1 Non-secretory protein CDS SAVERM_4170 5119426 5118812 putative aceytltranferase PF00583: Acetyltransferase (GNAT) family 4.94 22408 H miscellaneous 4.7 BAC71882.1 Non-secretory protein CDS SAVERM_4171 5121623 5119416 pacB2 putative penicillin acylase PF01804: Penicillin amidase, putative IdeR-binding site: TCAGGTTAGGCTAACCTAA(5121642:5121660) 5.27 79011 H detoxification 4.2 BAC71883.1 Non-secretory protein CDS SAVERM_4172 5121847 5122473 hypothetical protein PF03729: Short repeat of unknown function (DUF308) 8.94 22680 H similar to unknown proteins 5 BAC71884.1 Non-secretory protein CDS SAVERM_4173 5122539 5123207 putative membrane protein PF03729: Short repeat of unknown function (DUF308) 10.02 23378 H miscellaneous 4.7 BAC71885.1 Non-secretory protein CDS SAVERM_4174 5123221 5123640 putative secreted protein 12.42 14883 H no similarity 6 BAC71886.1 Non-secretory protein CDS SAVERM_4175 5125466 5123892 hypothetical protein PF05872: Bacterial protein of unknown function (DUF853) 5.39 55992 H similar to unknown proteins 5 BAC71887.1 Non-secretory protein CDS SAVERM_4176 5125590 5125886 hypothetical protein 6.97 11279 H similar to unknown proteins 5 BAC71888.1 Non-secretory protein CDS SAVERM_4177 5126033 5126662 putative secreted protein Tat substrate 10.69 21586 H similar to unknown proteins 5 BAC71889.1 Non-secretory protein CDS SAVERM_4178 5127511 5126876 uraP putative uracil phosphoribosyltransferase upp, PF00156: Phosphoribosyl transferase domain 4.69 22815 H metabolism of nucleotides & nucleic acids 2.3 BAC71890.1 Non-secretory protein CDS SAVERM_4179 5128249 5128800 hypothetical protein 3.33 19440 H similar to unknown proteins 5 BAC71891.1 Non-secretory protein CDS SAVERM_4180 5129204 5129632 cdd3 putative cytidine/deoxycytidine deaminase PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region 6.26 15301 H metabolism of nucleotides & nucleic acids 2.3 BAC71892.1 Non-secretory protein CDS SAVERM_4181 5131628 5130705 int10 putative tyrosine-family recombinase/integrase phage integrase near tRNA gene, PF00589: Phage integrase family 10.46 34424 H phage-related functions 4.4 BAC71893.1 Non-secretory protein CDS SAVERM_4182 5131802 5132035 hypothetical protein 4.7 8566 H similar to unknown proteins 5 BAC71894.1 Non-secretory protein CDS SAVERM_4183 5133481 5133660 putative secreted protein 4.6 6336 H similar to unknown proteins 5 BAC71895.1 Signal peptide CDS SAVERM_4184 5133707 5134000 hypothetical protein PF07876: Stress responsive A/B Barrel Domain 4.56 11365 H similar to unknown proteins 5 BAC71896.1 Non-secretory protein CDS SAVERM_4185 5134202 5135131 sig34 putative RNA polymerase sigma factor similar to SCO4035:sigF, RNA polymerase alternative sigma factor, PF04542: Sigma-70 region 2 6.9 33985 H RNA initiation 3.5.1 BAC71897.1 Non-secretory protein CDS SAVERM_4186 5135376 5136299 sig35 putative RNA polymerase sigma factor RNA polymerase alternative sigma factor sigN, PF04542: Sigma-70 region 2 4.59 33558 H RNA initiation 3.5.1 BAC71898.1 Non-secretory protein CDS SAVERM_4187 5136384 5137199 putative secreted protein 9.51 25577 H similar to unknown proteins 5 BAC71899.1 Non-secretory protein CDS SAVERM_4188 5137506 5137228 putative membrane protein 4.83 9555 H miscellaneous 4.7 BAC71900.1 Non-secretory protein CDS SAVERM_4189 5137672 5138187 putative MarR-family transcriptional regulator PF01047: MarR family 6.8 18936 H regulation 3.5.2 BAC71901.1 Non-secretory protein CDS SAVERM_4190 5138210 5140771 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 5.04 87257 H transport / binding proteins & lipoproteins 1.2 BAC71902.1 Non-secretory protein CDS SAVERM_4191 5140882 5141703 hypothetical protein PF04264: YceI like family 5.29 28333 H similar to unknown proteins 5 BAC71903.1 Non-secretory protein CDS SAVERM_4192 5141773 5142243 putative ATP/GTP-binding protein PF01243: Pyridoxamine 5'-phosphate oxidase 4.71 17429 H miscellaneous 4.7 BAC71904.1 Non-secretory protein CDS SAVERM_4193 5143086 5142316 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.94 28249 H regulation 3.5.2 BAC71905.1 Non-secretory protein CDS SAVERM_4194 5144689 5143193 putative transmembrane efflux protein homolog of virginiamycin S resistance gene (varS), PF07690: Major Facilitator Superfamily 8.21 50256 H transport / binding proteins & lipoproteins 1.2 BAC71906.1 Non-secretory protein CDS SAVERM_4195 5147050 5144801 putative membrane protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 10.04 76699 H miscellaneous 4.7 BAC71907.1 Non-secretory protein CDS SAVERM_4196 5148588 5147047 putative glycosyltransferase homolog of dolichyl-phosphate beta-glucosyltransferase, PF04138: GtrA-like protein 8.48 55700 H specific pathways 2.1.1 BAC71908.1 Non-secretory protein CDS SAVERM_4197 5150222 5148603 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.94 57336 H sensors 1.3 BAC71909.1 Non-secretory protein CDS SAVERM_4198 5151028 5150219 putative two-component system response regulator PF00072: Response regulator receiver domain 5.48 29844 H regulation 3.5.2 BAC71910.1 Non-secretory protein CDS SAVERM_4199 5152112 5151183 hypothetical protein PF04909: Amidohydrolase 6 34315 H similar to unknown proteins 5 BAC71911.1 Non-secretory protein CDS SAVERM_4200 5152542 5152096 putative secreted protein PF03992: Antibiotic biosynthesis monooxygenase 6.15 16040 H similar to unknown proteins 5 BAC71912.1 Non-secretory protein CDS SAVERM_4201 5153546 5152683 hypothetical protein PF10977: Protein of unknown function (DUF2797) 6.78 30265 H similar to unknown proteins 5 BAC71913.1 Non-secretory protein CDS SAVERM_4202 5154115 5153627 putative secreted protein 9.88 18751 H no similarity 6 BAC71914.1 Non-secretory protein CDS SAVERM_4203 5154416 5154820 putative peptidoglycan-binding protein, secreted similar to cell wall lysis enzyme of phage; near tRNA genes, PF01471: Putative peptidoglycan binding domain 9.87 14100 H phage-related functions 4.4 BAC71915.1 Signal peptide CDS SAVERM_4204 5155522 5155989 putative secreted protein PF00720: Subtilisin inhibitor-like 7.98 16319 H miscellaneous 4.7 BAC71916.1 Signal peptide CDS SAVERM_4205 5156280 5160719 putative two-component system sensor kinase/response regulator, bifunctional protein PF00989: PAS fold 4.94 152215 H sensors 1.3 BAC71917.1 Non-secretory protein CDS SAVERM_4206 5162486 5160810 fadD9 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 4.94 60622 H metabolism of lipids 2.4 BAC71918.1 Non-secretory protein CDS SAVERM_4207 5163124 5162654 sig36 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4005, PF08281: Sigma-70, region 4 7.52 17581 H RNA initiation 3.5.1 BAC71919.1 Non-secretory protein CDS SAVERM_4208 5164548 5163382 ltp3 putative nonspecific lipid-transfer protein PF00108: Thiolase, N-terminal domain 5.83 40874 H metabolism of lipids 2.4 BAC71920.1 Non-secretory protein CDS SAVERM_4209 5164940 5164545 putative MaoC-like dehydratase probably involved in the lipid metabolism, PF01575: MaoC like domain 6.97 13816 H similar to unknown proteins 5 BAC71921.1 Non-secretory protein CDS SAVERM_4210 5166073 5164937 fadE28 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.12 40168 H metabolism of lipids 2.4 BAC71922.1 Non-secretory protein CDS SAVERM_4211 5167025 5166075 hypothetical protein PF01796: Domain of unknown function DUF35 5.11 34314 H similar to unknown proteins 5 BAC71923.1 Non-secretory protein CDS SAVERM_4212 5168311 5167022 fadE22 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.95 44988 H metabolism of lipids 2.4 BAC71924.1 Non-secretory protein CDS SAVERM_4213 5168808 5168572 putative secreted protein 9.3 7939 H similar to unknown proteins 5 BAC71925.1 Signal peptide CDS SAVERM_4214 5169189 5170106 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 10.62 32082 H similar to unknown proteins 5 BAC71926.1 Non-secretory protein CDS SAVERM_4215 5172976 5172533 putative IS5 family IS1647-like transposase IS5 family (5173387..5172525) Inverted repeat sequence (18/19) Target sequence (CTTAN); Translation will be controlled by frameshift with SAV4216. Extremely similar to SAV7554. 11.71 16874 H transposon & IS 4.5 BAC71927.1 Non-secretory protein CDS SAVERM_4216 5173350 5172868 putative IS5 family IS1647-like transposase IS5 family (5173387..5172525) Inverted repeat sequence (18/19) Target sequence (CTTAN) 10.64 7013 H transposon & IS 4.5 BAC71928.1 Non-secretory protein CDS SAVERM_4217 5173661 5174278 hypothetical protein 4.22 22311 H no similarity 6 BAC71929.1 Non-secretory protein CDS SAVERM_4218 5174863 5174345 hypothetical protein 12.13 17457 H similar to unknown proteins 5 BAC71930.1 Non-secretory protein CDS SAVERM_4219 5174965 5176368 hypothetical protein PF01580: FtsK/SpoIIIE family 6.54 50346 H similar to unknown proteins 5 BAC71931.1 Non-secretory protein CDS SAVERM_4220 5176576 5176899 hypothetical protein 9.67 10960 H no similarity 6 BAC71932.1 Non-secretory protein CDS SAVERM_4221 5176989 5177345 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 10.41 12825 H similar to unknown proteins 5 BAC71933.1 Non-secretory protein CDS SAVERM_4222 5177342 5177554 hypothetical protein 10.7 7494 H no similarity 6 BAC71934.1 Non-secretory protein CDS SAVERM_4223 5179259 5177841 pepD3 putative serine protease, secreted PF00089: Trypsin 4.93 46086 H protein modification 3.8 BAC71935.1 Non-secretory protein CDS SAVERM_4224 5179544 5180353 glpQ2 putative glycerophosphoryl diester phosphodiesterase F03009: Glycerophosphoryl diester phosphodiesterase family 7.23 29841 H metabolism of lipids 2.4 BAC71936.1 Non-secretory protein CDS SAVERM_4225 5180472 5181125 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.64 23011 H regulation 3.5.2 BAC71937.1 Non-secretory protein CDS SAVERM_4226 5181331 5182296 hypothetical protein PF02810: SEC-C motif 5.01 34266 H similar to unknown proteins 5 BAC71938.1 Non-secretory protein CDS SAVERM_4227 5183207 5182632 putative secreted protein Tat substrate 7.3 19792 H similar to unknown proteins 5 BAC71939.1 Signal peptide CDS SAVERM_4228 5183928 5183263 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 7.97 23778 H similar to unknown proteins 5 BAC71940.1 Non-secretory protein CDS SAVERM_4229 5184516 5185910 prpB7 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.21 48874 H protein modification 3.8 BAC71941.1 Non-secretory protein CDS SAVERM_4230 5185995 5187458 pepP putative Xaa-Pro aminopeptidase aminopeptidase P) PF00557: metallopeptidase family M24 4.47 53838 H protein modification 3.8 BAC71942.1 Non-secretory protein CDS SAVERM_4231 5187590 5189005 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 8.91 50609 H regulation 3.5.2 BAC71943.1 Non-secretory protein CDS SAVERM_4232 5189096 5190565 putative membrane protein PF07690: Major Facilitator Superfamily 10.75 49477 H miscellaneous 4.7 BAC71944.1 Non-secretory protein CDS SAVERM_4233 5191379 5190540 mdcB putative 2-(5”-triphosphoribosyl)-3’-dephospho-CoA synthase PF01874: ATP:dephospho-CoA triphosphoribosyl transferase 11.24 28556 H metabolism of coenzymes & prosthetic groups 2.5 BAC71945.1 Non-secretory protein CDS SAVERM_4234 5192423 5191389 putative protocatechuate dioxygenase Tat substrate, PF00775: Dioxygenase 4.41 35028 H miscellaneous 4.7 BAC71946.1 Non-secretory protein CDS SAVERM_4235 5195684 5192478 hypothetical protein PF01885: RNA 2'-phosphotransferase, Tpt1 / KptA family 7.74 120072 H similar to unknown proteins 5 BAC71947.1 Non-secretory protein CDS SAVERM_4236 5196249 5195791 hypothetical protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.14 16097 H similar to unknown proteins 5 BAC71948.1 Non-secretory protein CDS SAVERM_4237 5196492 5197385 putative secreted protein 12.17 29484 H similar to unknown proteins 5 BAC71949.1 Signal peptide CDS SAVERM_4238 5197592 5198326 putative secreted protein PF07987: Domain of unkown function (DUF1775) 4.97 25254 H similar to unknown proteins 5 BAC71950.1 Signal peptide CDS SAVERM_4239 5198431 5199084 putative electron transport protein PF02630: SCO1/SenC 6.78 23245 H miscellaneous 4.7 BAC71951.1 Signal peptide CDS SAVERM_4240 5199081 5199548 putative secreted protein PF04314: Protein of unknown function (DUF461) 6.68 15682 H similar to unknown proteins 5 BAC71952.1 Signal peptide CDS SAVERM_4241 5199736 5201820 copC putative copper resistance protein, secreted PF04234: Copper resistance protein CopC 5.74 70907 H detoxification 4.2 BAC71953.1 Signal peptide CDS SAVERM_4242 5201829 5203190 putative peroxidase PF04261: Dyp-type peroxidase family 9.06 47694 H miscellaneous 4.7 BAC71954.1 Non-secretory protein CDS SAVERM_4243 5203261 5204193 pheA putative prephenate dehydratase PF00800: Prephenate dehydratase 4.77 33392 H metabolism of amino acids & related molecules 2.2 BAC71955.1 Non-secretory protein CDS SAVERM_4244 5204797 5206074 serS1 putative seryl-tRNA synthetase PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 4.97 47241 H aminoacyl-tRNA-synthetase 3.7.2 BAC71956.1 Non-secretory protein CDS SAVERM_4245 5206071 5206901 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.63 28471 H miscellaneous 4.7 BAC71957.1 Non-secretory protein CDS SAVERM_4246 5207524 5207285 hypothetical protein 6.9 9357 H no similarity 6 BAC71958.1 Non-secretory protein CDS SAVERM_4247 5208390 5207671 putative ABC transporter permease protein Tat substrate, PF01061: ABC-2 type transporter 10.02 24744 H transport / binding proteins & lipoproteins 1.2 BAC71959.1 Non-secretory protein CDS SAVERM_4248 5209312 5208401 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.81 33438 H transport / binding proteins & lipoproteins 1.2 BAC71960.1 Non-secretory protein CDS SAVERM_4249 5210238 5209309 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.27 32667 H transport / binding proteins & lipoproteins 1.2 BAC71961.1 Non-secretory protein CDS SAVERM_4250 5211190 5210228 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.72 34433 H transport / binding proteins & lipoproteins 1.2 BAC71962.1 Non-secretory protein CDS SAVERM_4251 5211430 5212308 hypothetical protein PF00557: metallopeptidase family M24 9.4 33461 H similar to unknown proteins 5 BAC71963.1 Non-secretory protein CDS SAVERM_4252 5212305 5214059 putative dehydrogenase PF00106: short chain dehydrogenase 9.75 63785 H miscellaneous 4.7 BAC71964.1 Non-secretory protein CDS SAVERM_4253 5214056 5214985 hypothetical protein PF10118: Predicted metal-dependent hydrolase 9.53 34317 H similar to unknown proteins 5 BAC71965.1 Non-secretory protein CDS SAVERM_4254 5215099 5216022 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 5.58 33663 H regulation 3.5.2 BAC71966.1 Non-secretory protein CDS SAVERM_4255 5216144 5217214 hypothetical protein PF00296: Luciferase-like monooxygenase 8.06 38985 H similar to unknown proteins 5 BAC71967.1 Non-secretory protein CDS SAVERM_4256 5217388 5218305 hypothetical protein PF00702: haloacid dehalogenase-like hydrolase 5.08 32476 H similar to unknown proteins 5 BAC71968.1 Non-secretory protein CDS SAVERM_4257 5220092 5218386 putative two-component system sensor kinase PF01590: GAF domain 5.21 60296 H sensors 1.3 BAC71969.1 Non-secretory protein CDS SAVERM_4258 5223721 5220167 cydCD putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.84 124343 H transport / binding proteins & lipoproteins 1.2 BAC71970.1 Non-secretory protein CDS SAVERM_4259 5224786 5223782 cydB1 putative cytochrome bd-I oxidase subunit II cytochrome bd complex) PF02322: Cytochrome oxidase subunit II 8.98 36978 H membrane bioenergetics 1.4 BAC71971.1 Non-secretory protein CDS SAVERM_4260 5226314 5224806 cydA1 putative cytochrome bd-I oxidase subunit I (cytochrome bd complex) PF01654: Bacterial Cytochrome Ubiquinol Oxidase 9.22 55943 H membrane bioenergetics 1.4 BAC71972.1 Non-secretory protein CDS SAVERM_4261 5227810 5226731 hisC2 putative histidinol-phosphate aminotransferase EC:2.6.1.9 4.92 38741 H metabolism of amino acids & related molecules 2.2 BAC71973.1 Non-secretory protein CDS SAVERM_4262 5228198 5229310 rstP putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 6.32 39501 H regulation 3.5.2 BAC71974.1 Non-secretory protein CDS SAVERM_4263 5229540 5230649 prpA2 putative serine/threonine protein phosphatase PF00149: Calcineurin-like phosphoesterase 4.22 39497 H protein modification 3.8 BAC71975.1 Non-secretory protein CDS SAVERM_4264 5230838 5231695 putative transmembrane protein 4.79 29882 H miscellaneous 4.7 BAC71976.1 Non-secretory protein CDS SAVERM_4265 5233686 5231881 thiC putative thiamine biosynthesis protein PF01964: ThiC family 5.18 66485 H metabolism of coenzymes & prosthetic groups 2.5 BAC71977.1 Non-secretory protein CDS SAVERM_4266 5233907 5235349 putative membrane protein PF07907: YibE/F-like protein 8.5 49394 H miscellaneous 4.7 BAC71978.1 Non-secretory protein CDS SAVERM_4267 5235924 5235517 ssgA putative cell division protein, sporulation-specific cell division PF04686: Streptomyces sporulation and cell division protein, SsgA 4.15 14780 H cell division 1.7 BAC71979.1 Non-secretory protein CDS SAVERM_4268 5236778 5236053 ssgR putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 6.72 26444 H regulation 3.5.2 BAC71980.1 Non-secretory protein CDS SAVERM_4269 5237385 5237173 putative membrane spanning protein 11.06 7682 H miscellaneous 4.7 BAC71981.1 Non-secretory protein CDS SAVERM_4270 5237866 5237549 hypothetical protein PF00190: Cupin 5.12 11627 H similar to unknown proteins 5 BAC71982.1 Non-secretory protein CDS SAVERM_4271 5237980 5238360 putative membrane protein PF04020: Membrane protein of unknown function 9.18 13530 H miscellaneous 4.7 BAC71983.1 Non-secretory protein CDS SAVERM_4272 5238369 5238860 ptpB2 putative low molecular weight protein tyrosine phosphatase PF01451: Low molecular weight phosphotyrosine protein phosphatase 4.49 17497 H protein modification 3.8 BAC71984.1 Non-secretory protein CDS SAVERM_4273 5238857 5240002 cysA putative cystathionine/methionine gamma-synthase/lyase PF01053: Cys/Met metabolism PLP-dependent enzyme 5.02 40481 H metabolism of amino acids & related molecules 2.2 BAC71985.1 Non-secretory protein CDS SAVERM_4274 5240218 5241123 abaB1 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.74 32172 H regulation 3.5.2 BAC71986.1 Non-secretory protein CDS SAVERM_4275 5241186 5241668 hypothetical protein PF00293: NUDIX domain 5.03 17529 H similar to unknown proteins 5 BAC71987.1 Non-secretory protein CDS SAVERM_4276 5243389 5241692 fhbA putative flavohemoprotein PF00042: Globin 5.71 60946 H miscellaneous 4.7 BAC71988.1 Non-secretory protein CDS SAVERM_4277 5244447 5243788 hypothetical protein PF00702: haloacid dehalogenase-like hydrolase 5.58 24158 H similar to unknown proteins 5 BAC71989.1 Non-secretory protein CDS SAVERM_4278 5244596 5245462 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6.04 31063 H similar to unknown proteins 5 BAC71990.1 Non-secretory protein CDS SAVERM_4279 5245992 5245573 hypothetical protein PF03928: Domain of unknown function (DUF336) 6.09 14096 H similar to unknown proteins 5 BAC71991.1 Non-secretory protein CDS SAVERM_4280 5247343 5246135 putative transmembrane efflux protein similar to cmlR, PF07690: Major Facilitator Superfamily 10.59 40714 H transport / binding proteins & lipoproteins 1.2 BAC71992.1 Non-secretory protein CDS SAVERM_4281 5247484 5247942 putative MarR-family transcriptional regulator PF01047: MarR family 6.68 16500 H regulation 3.5.2 BAC71993.1 Non-secretory protein CDS SAVERM_4282 5247952 5248404 putative acetyltransferase, secreted PF00583: Acetyltransferase (GNAT) family 5.65 16474 H regulation 3.5.2 BAC71994.1 Non-secretory protein CDS SAVERM_4283 5249911 5248526 blaA2 putative beta-lactamase PF00144: Beta-lactamase 5.02 49363 H detoxification 4.2 BAC71995.1 Non-secretory protein CDS SAVERM_4284 5251463 5249988 dnaB putative replicative DNA helicase PF03796: DnaB-like helicase C terminal domain 4.84 54295 H DNA replication 3.1 BAC71996.1 Non-secretory protein CDS SAVERM_4285 5251914 5253260 dinF putative DNA-damage-inducible protein F PF01554: MatE 10.31 45989 H DNA modification & repair 3.2 BAC71997.1 Non-secretory protein CDS SAVERM_4286 5253904 5253458 rplI putative ribosomal protein L9 PF03948: Ribosomal protein L9, C-terminal domain 10.31 15996 H ribosomal protein 3.7.1 BAC71998.1 Non-secretory protein CDS SAVERM_4287 5254159 5253923 rpsR1 putative ribosomal protein S18 PF01084: Ribosomal protein S18 11.05 8989 H ribosomal protein 3.7.1 BAC71999.1 Non-secretory protein CDS SAVERM_4288 5254825 5254217 ssb1 putative single-stranded DNA-binding protein PF00436: Single-strand binding protein family 5.01 20244 H DNA replication 3.1 BAC72000.1 Non-secretory protein CDS SAVERM_4289 5255195 5254905 rpsF putative ribosomal protein S6 PF01250: Ribosomal protein S6 6.54 11201 H ribosomal protein 3.7.1 BAC72001.1 Non-secretory protein CDS SAVERM_4290 5255517 5255831 putative membrane protein 9.3 10639 H miscellaneous 4.7 BAC72002.1 Non-secretory protein CDS SAVERM_4291 5256054 5257175 hypothetical protein PF02388: FemAB family 8.99 42908 H similar to unknown proteins 5 BAC72003.1 Non-secretory protein CDS SAVERM_4292 5257274 5258305 hypothetical protein PF01168: alanine racemase, N-terminal domain 9.3 38105 H similar to unknown proteins 5 BAC72004.1 Non-secretory protein CDS SAVERM_4293 5259906 5258389 putative transmembrane protein PF05007: Mannosyltransferase (PIG-M) 7.52 55301 H miscellaneous 4.7 BAC72005.1 Non-secretory protein CDS SAVERM_4294 5262805 5260016 pbp5 putative penicillin-binding protein PF00912: Transglycosylase 9.61 98944 H cell wall 1.1 BAC72006.1 Non-secretory protein CDS SAVERM_4295 5263084 5263767 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6.7 25637 H regulation 3.5.2 BAC72007.1 Non-secretory protein CDS SAVERM_4296 5263812 5264894 ino1 1L-myo-inositol-1-phosphate synthase PF01658: Myo-inositol-1-phosphate synthase 4.96 39442 H main glycolytic pathways 2.1.2 BAC72008.1 Non-secretory protein CDS SAVERM_4297 5264972 5266234 putative membrane protein PF07690: Major Facilitator Superfamily 10.02 43920 H miscellaneous 4.7 BAC72009.1 Non-secretory protein CDS SAVERM_4298 5266349 5266840 hypothetical protein 5.7 17125 H similar to unknown proteins 5 BAC72010.1 Non-secretory protein CDS SAVERM_4299 5268401 5266959 pcnA putative RNA nucleotidyltransferase PF01743: Poly A polymerase family 5.31 53875 H RNA modification 3.6 BAC72011.1 Non-secretory protein CDS SAVERM_4300 5268648 5271065 putative membrane protein 4.55 84760 H miscellaneous 4.7 BAC72012.1 Signal peptide CDS SAVERM_4301 5271112 5273379 putative transmembrane protein PF03023: MviN-like protein 6.96 78905 H miscellaneous 4.7 BAC72013.1 Non-secretory protein CDS SAVERM_4302 5273498 5275219 hypothetical protein PF00069: Protein kinase domain 7.21 61253 H similar to unknown proteins 5 BAC72014.1 Non-secretory protein CDS SAVERM_4303 5275249 5275962 sig37 putative RNA polymerase ECF-subfamily sigma factor similar to SCO3892:sigT, PF04542: Sigma-70 region 2 7.74 25145 H RNA initiation 3.5.1 BAC72015.1 Non-secretory protein CDS SAVERM_4304 5275959 5276882 hypothetical protein 6.25 31629 H similar to unknown proteins 5 BAC72016.1 Non-secretory protein CDS SAVERM_4305 5277067 5278038 trxB1 putative thioredoxin reductase (NADPH) PF00070: Pyridine nucleotide-disulphide oxidoreductase 4.61 34185 H membrane bioenergetics 1.4 BAC72017.1 Non-secretory protein CDS SAVERM_4306 5278082 5278414 trxA1 putative thioredoxin PF00085: Thioredoxin 4.28 11871 H membrane bioenergetics 1.4 BAC72018.1 Non-secretory protein CDS SAVERM_4307 5279171 5278554 hypothetical protein PF00583: Acetyltransferase (GNAT) family 8.32 22562 H similar to unknown proteins 5 BAC72019.1 Non-secretory protein CDS SAVERM_4308 5280604 5279501 parB putative ParB homolog Tat substrate, PF02195: ParB-like nuclease domain 5.35 39148 H miscellaneous 4.7 BAC72020.1 Signal peptide CDS SAVERM_4309 5281674 5280601 parA1 putative partitioning or sporulation protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 4.29 37927 H sporulation 1.8 BAC72021.1 Non-secretory protein CDS SAVERM_4310 5282716 5281976 rsmG 16S ribosomal RNA small subunit methyltransferase gidB, PF02527: Glucose inhibited division protein 8.24 26517 H RNA modification 3.6 BAC72022.1 Non-secretory protein CDS SAVERM_4311 5283366 5282854 jag putative Jag-like protein PF01424: R3H domain 4.28 18281 H sporulation 1.8 BAC72023.1 Non-secretory protein CDS SAVERM_4312 5284668 5283382 yidC1 putative preprotein translocase YidC subunit PF02096: 60Kd inner membrane protein 10.86 46982 H protein secretion 1.6 BAC72024.1 Non-secretory protein CDS SAVERM_4313 5285025 5284672 hypothetical protein PF01809: Domain of unknown function DUF37 10.28 13035 H similar to unknown proteins 5 BAC72025.1 Non-secretory protein CDS SAVERM_4314 5285393 5285022 rnpA putative RNase P component PF00825: Ribonuclease P 12.42 13184 H RNA modification 3.6 BAC72026.1 Non-secretory protein CDS SAVERM_4315 5285549 5285412 rpmH putative ribosomal protein L34 PF00468: Ribosomal protein L34 13.54 5183 H ribosomal protein 3.7.1 BAC72027.1 Non-secretory protein CDS SAVERM_4316 5285972 5287933 dnaA putative replication initiator protein PF00308: Bacterial dnaA protein 6.19 72544 H DNA replication 3.1 BAC72028.1 Non-secretory protein CDS SAVERM_4317 5289024 5290154 dnaN1 putative DNA polymerase III beta subunit PF00712: DNA polymerase III beta subunit, N-terminal domain 4.33 39721 H DNA replication 3.1 BAC72029.1 Non-secretory protein CDS SAVERM_4318 5290374 5291249 gnd2 putative 6-phosphogluconate dehydrogenase PF03446: NAD binding domain of 6-phosphogluconate dehydrogenase 4.68 31473 H main glycolytic pathways 2.1.2 BAC72030.1 Non-secretory protein CDS SAVERM_4319 5291312 5292433 recF putative DNA recombination and repair protein PF02463: RecF/RecN/SMC N terminal domain 7.26 40899 H DNA recombination 3.3 BAC72031.1 Non-secretory protein CDS SAVERM_4320 5292430 5292975 hypothetical protein PF05258: Protein of unknown function (DUF721) 10.43 19347 H similar to unknown proteins 5 BAC72032.1 Non-secretory protein CDS SAVERM_4321 5293712 5295790 gyrB putative DNA gyrase subunit B PF00204: DNA gyrase B 4.87 75831 H DNA packaging & segregation 3.4 BAC72033.1 Non-secretory protein CDS SAVERM_4322 5295833 5298427 gyrA putative DNA gyrase subunit A PF00521: DNA gyrase/topoisomerase IV, subunit A 4.84 95397 H DNA packaging & segregation 3.4 BAC72034.1 Non-secretory protein CDS SAVERM_4323 5298567 5299181 putative membrane protein 9.58 20670 H miscellaneous 4.7 BAC72035.1 Non-secretory protein CDS SAVERM_4324 5300060 5299713 putative secreted protein 10.13 12198 H similar to unknown proteins 5 BAC72036.1 Signal peptide CDS SAVERM_4325 5300774 5302279 putative secreted protein 7.58 50759 H similar to unknown proteins 5 BAC72037.1 Signal peptide CDS SAVERM_4326 5303974 5302280 pkn10 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.49 59129 H protein modification 3.8 BAC72038.1 Non-secretory protein CDS SAVERM_4327 5304722 5304174 putative DNA-binding protein PF01381: Helix-turn-helix 6.81 19320 H regulation 3.5.2 BAC72039.1 Non-secretory protein CDS SAVERM_4328 5306087 5305386 putative regulatory protein PF09312: SurA N-terminal domain 9.4 25066 H regulation 3.5.2 BAC72040.1 Non-secretory protein CDS SAVERM_4329 5306491 5307051 ppiA putative peptidyl-prolyl cis-trans isomerase PF00160: Cyclophilin type peptidyl-prolyl cis-trans isomerase 6.98 20306 H protein modification 3.8 BAC72041.1 Non-secretory protein CDS SAVERM_4330 5307277 5308173 putative membrane protein PF01694: Rhomboid family 8.86 32192 H miscellaneous 4.7 BAC72042.1 Non-secretory protein CDS SAVERM_4331 5308710 5308456 whiP putative septation inhibitor protein PF06781: Uncharacterised protein family (UPF0233) 10.63 9226 H miscellaneous 4.7 BAC72043.1 Non-secretory protein CDS SAVERM_4332 5308853 5309665 hypothetical protein PF05949: Bacterial protein of unknown function (DUF881) 6.96 28799 H similar to unknown proteins 5 BAC72044.1 Non-secretory protein CDS SAVERM_4333 5309712 5310404 putative secreted protein PF04203: sortase family 9.44 25629 H similar to unknown proteins 5 BAC72045.1 Non-secretory protein CDS SAVERM_4334 5310409 5310597 hypothetical protein 5.61 7212 H similar to unknown proteins 5 BAC72046.1 Non-secretory protein CDS SAVERM_4335 5310594 5311232 pabA putative p-aminobenzoate synthase glutamine amidotransferase PF00117: Glutamine amidotransferase class-I 5.47 22645 H metabolism of coenzymes & prosthetic groups 2.5 BAC72047.1 Non-secretory protein CDS SAVERM_4336 5311229 5312578 hypothetical protein PF04203: sortase family 8.35 47038 H similar to unknown proteins 5 BAC72048.1 Non-secretory protein CDS SAVERM_4337 5312592 5313332 putative membrane protein PF04203: sortase family 9.81 27116 H miscellaneous 4.7 BAC72049.1 Non-secretory protein CDS SAVERM_4338 5315398 5313395 pkn11 putative serine/threonine protein kinase PF03793: PASTA domain, PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 5.14 70680 H protein modification 3.8 BAC72050.1 Non-secretory protein CDS SAVERM_4339 5317053 5315569 pbp6 putative penicillin-binding protein, secreted PF00905: Penicillin binding protein transpeptidase domain 9.34 52945 H cell wall 1.1 BAC72051.1 Non-secretory protein CDS SAVERM_4340 5318498 5317050 ftsW3 putative cell division membrane protein PF01098: Cell cycle protein 9.78 51517 H cell division 1.7 BAC72052.1 Non-secretory protein CDS SAVERM_4341 5320069 5318525 prpB8 putative magnesium or manganese-dependent protein phosphatase PF00481: Protein phosphatase 2C 4.83 54175 H protein modification 3.8 BAC72053.1 Non-secretory protein CDS SAVERM_4342 5320717 5320190 putative membrane protein PF00498: FHA domain 11.65 19068 H similar to unknown proteins 5 BAC72054.1 Non-secretory protein CDS SAVERM_4343 5321585 5320728 hypothetical protein PF00498: FHA domain 9.38 30447 H similar to unknown proteins 5 BAC72055.1 Non-secretory protein CDS SAVERM_4344 5322974 5322321 acpD putative acyl carrier protein phosphodiesterase PF02525: Flavodoxin-like fold 4.9 23066 H metabolism of coenzymes & prosthetic groups 2.5 BAC72056.1 Signal peptide CDS SAVERM_4345 5323110 5323517 putative transcriptional regulator PF01638: Transcriptional regulator 6.26 14927 H regulation 3.5.2 BAC72057.1 Non-secretory protein CDS SAVERM_4346 5323799 5325265 hypothetical protein PF10009: Uncharacterized protein conserved in bacteria (DUF2252) 6.68 51941 H similar to unknown proteins 5 BAC72058.1 Non-secretory protein CDS SAVERM_4347 5325561 5326400 hypothetical protein PF00226: DnaJ domain 4.34 31341 H similar to unknown proteins 5 BAC72059.1 Non-secretory protein CDS SAVERM_4348 5326463 5326792 hypothetical protein PF00581: Rhodanese-like domain 4.09 11547 H similar to unknown proteins 5 BAC72060.1 Non-secretory protein CDS SAVERM_4349 5328110 5326971 fadE19 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.81 39736 H metabolism of lipids 2.4 BAC72061.1 Non-secretory protein CDS SAVERM_4350 5329350 5328286 paaE putative phenylacetic acid degradation NADH oxidoreductase phenylacetate catabolism, PF00111: 2Fe-2S iron-sulfur cluster binding domain 5.48 38052 H specific pathways 2.1.1 BAC72062.1 Non-secretory protein CDS SAVERM_4351 5329862 5329350 paaD putative phenylacetic acid degradation protein phenylacetate catabolism, PF01883: Domain of unknown function DUF59 6.35 18530 H specific pathways 2.1.1 BAC72063.1 Non-secretory protein CDS SAVERM_4352 5330626 5329907 paaC putative phenylacetic acid degradation protein phenylacetate catabolism, PF05138: Phenylacetic acid catabolic protein 4.99 26322 H specific pathways 2.1.1 BAC72064.1 Non-secretory protein CDS SAVERM_4353 5330910 5330623 paaB putative phenylacetic acid degradation protein phenylacetate catabolism, PF06243: Phenylacetic acid degradation B 6.68 10787 H specific pathways 2.1.1 BAC72065.1 Non-secretory protein CDS SAVERM_4354 5331931 5330912 paaA putative phenylacetic acid degradation protein phenylacetate catabolism, PF05138: Phenylacetic acid catabolic protein 6.45 37747 H specific pathways 2.1.1 BAC72066.1 Non-secretory protein CDS SAVERM_4355 5332122 5333153 putative membrane protein 7.82 36860 H miscellaneous 4.7 BAC72067.1 Non-secretory protein CDS SAVERM_4356 5333153 5334382 putative membrane protein 10.58 45418 H miscellaneous 4.7 BAC72068.1 Non-secretory protein CDS SAVERM_4357 5334379 5335128 tsnR1 putative rRNA methyltransferase PF00588: SpoU rRNA Methylase family 6.73 26207 H RNA modification 3.6 BAC72069.1 Non-secretory protein CDS SAVERM_4358 5336835 5335144 paaZ putative dehydrogenase phenylacetate catabolism, PF00171: Aldehyde dehydrogenase family 4.75 60048 H specific pathways 2.1.1 BAC72070.1 Non-secretory protein CDS SAVERM_4359 5336984 5338498 paaH putative 3-hydroxyacyl-CoA dehydrogenase phenylacetate catabolism, PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 4.7 54233 H specific pathways 2.1.1 BAC72071.1 Non-secretory protein CDS SAVERM_4360 5338495 5339085 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.7 21987 H regulation 3.5.2 BAC72072.1 Non-secretory protein CDS SAVERM_4361 5339495 5339088 putative AsnC-family transcriptional regulator PF01037: AsnC family 6.97 14963 H regulation 3.5.2 BAC72073.1 Non-secretory protein CDS SAVERM_4362 5339763 5340908 bkdA putative 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) E1-alpha chain aceF, PF00676: Dehydrogenase E1 component 4.89 41015 H main glycolytic pathways 2.1.2 BAC72074.1 Non-secretory protein CDS SAVERM_4363 5340982 5341986 bkdB putative 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) E1-beta chain PF02779: Transketolase, pyridine binding domain 5.39 35837 H specific pathways 2.1.1 BAC72075.1 Non-secretory protein CDS SAVERM_4364 5341986 5343353 bkdC putative dihydrolipoamide acyltransferase PF00198: 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 5.74 47116 H metabolism of lipids 2.4 BAC72076.1 Non-secretory protein CDS SAVERM_4365 5343429 5344316 mobA putative molybdopterin-guanine dinucleotide biosynthesis protein PF00483: Nucleotidyl transferase 4.73 30229 H metabolism of coenzymes & prosthetic groups 2.5 BAC72077.1 Non-secretory protein CDS SAVERM_4366 5344379 5345773 moaA2 putative molybdopterin biosynthesis protein PF03453: MoeA N-terminal region (domain I and II) 5.7 48862 H metabolism of coenzymes & prosthetic groups 2.5 BAC72078.1 Non-secretory protein CDS SAVERM_4367 5345833 5346867 putative membrane protein PF02254: TrkA-N domain 9.36 37041 H miscellaneous 4.7 BAC72079.1 Non-secretory protein CDS SAVERM_4368 5346952 5347932 qor putative quinone oxidoreductase PF00107: Zinc-binding dehydrogenase 5.21 33666 H metabolism of coenzymes & prosthetic groups 2.5 BAC72080.1 Non-secretory protein CDS SAVERM_4369 5348923 5347961 hypothetical protein 9.7 32339 H similar to unknown proteins 5 BAC72081.1 Non-secretory protein CDS SAVERM_4370 5348987 5349532 hypothetical protein PF10759: Protein of unknown function (DUF2587) 4.31 19608 H similar to unknown proteins 5 BAC72082.1 Non-secretory protein CDS SAVERM_4371 5351356 5349704 pkn12 putative serine/threonine protein kinase PF03793: PASTA domain, PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 4.76 57961 H protein modification 3.8 BAC72083.1 Non-secretory protein CDS SAVERM_4372 5351732 5353231 pkn13 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 4.46 52107 H protein modification 3.8 BAC72084.1 Non-secretory protein CDS SAVERM_4373 5354485 5353436 hypothetical protein PF01636: Phosphotransferase enzyme family 9.58 38597 H similar to unknown proteins 5 BAC72085.1 Non-secretory protein CDS SAVERM_4374 5355068 5354574 hypothetical protein 6.95 17819 H similar to unknown proteins 5 BAC72086.1 Non-secretory protein CDS SAVERM_4375 5355890 5355231 putative two-component system response regulator PF00072: Response regulator receiver domain 4.82 23683 H regulation 3.5.2 BAC72087.1 Non-secretory protein CDS SAVERM_4376 5356305 5357525 bkdF putative branched-chain alpha keto acid dehydrogenase E1 alpha subunit PF00676: Dehydrogenase E1 component 4.93 44475 H metabolism of lipids 2.4 BAC72088.1 Non-secretory protein CDS SAVERM_4377 5357527 5358504 bkdG putative branched-chain alpha keto acid dehydrogenase E1 beta subunit PF02779: Transketolase, pyridine binding domain 5.15 35503 H metabolism of lipids 2.4 BAC72089.1 Non-secretory protein CDS SAVERM_4378 5358524 5359912 bkdH putative dihydrolipoamide acyltransferase component PF00198: 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 6.2 48745 H metabolism of lipids 2.4 BAC72090.1 Non-secretory protein CDS SAVERM_4379 5360819 5359989 dacD putative D-alanyl-D-alanine carboxypeptidase PF00768: D-alanyl-D-alanine carboxypeptidase 10.5 29052 H cell wall 1.1 BAC72091.1 Non-secretory protein CDS SAVERM_4380 5361083 5361766 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.73 24801 H regulation 3.5.2 BAC72092.1 Non-secretory protein CDS SAVERM_4381 5361763 5363109 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 11.07 46929 H transport / binding proteins & lipoproteins 1.2 BAC72093.1 Non-secretory protein CDS SAVERM_4382 5364089 5363265 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 5.79 30463 H similar to unknown proteins 5 BAC72094.1 Non-secretory protein CDS SAVERM_4383 5364245 5365051 putative hydrolase PF00795: Carbon-nitrogen hydrolase 4.67 28788 H miscellaneous 4.7 BAC72095.1 Non-secretory protein CDS SAVERM_4384 5365613 5365119 hypothetical protein PF04525: Protein of unknown function (DUF567) 5.35 19108 H similar to unknown proteins 5 BAC72096.1 Non-secretory protein CDS SAVERM_4385 5366050 5365817 hypothetical protein 5.03 9252 H no similarity 6 BAC72097.1 Non-secretory protein CDS SAVERM_4386 5366202 5367227 hypothetical protein frameshift, PF01436: NHL repeat 5.4 36712 H miscellaneous 4.7 BAC72098.1 Non-secretory protein CDS SAVERM_4387 5367136 5368020 hypothetical protein frameshift, PF01436: NHL repeat 4.32 31206 H miscellaneous 4.7 BAC72099.1 Non-secretory protein CDS SAVERM_4388 5368317 5368069 putative membrane protein 6.95 8858 H miscellaneous 4.7 BAC72100.1 Non-secretory protein CDS SAVERM_4389 5369739 5368441 apeB putative aspartyl aminopeptidase PF02127: Aminopeptidase I zinc metalloprotease (M18) 6.16 46012 H protein modification 3.8 BAC72101.1 Non-secretory protein CDS SAVERM_4390 5371721 5369895 fadE24 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.71 66461 H metabolism of lipids 2.4 BAC72102.1 Non-secretory protein CDS SAVERM_4391 5371864 5372328 hypothetical protein 4.87 17094 H similar to unknown proteins 5 BAC72103.1 Non-secretory protein CDS SAVERM_4392 5372504 5373475 putative pirin-like protein PF02678: Pirin, phage attachment site is located in the coding region. 5.15 34388 H miscellaneous 4.7 BAC72104.1 Non-secretory protein CDS SAVERM_4393 5373665 5374708 putative integral membrane protein PF01594: Domain of unknown function DUF20 8.35 35230 H miscellaneous 4.7 BAC72105.1 Non-secretory protein CDS SAVERM_4394 5376869 5374725 prpE3 putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.65 76980 H protein modification 3.8 BAC72106.1 Non-secretory protein CDS SAVERM_4395 5377024 5378787 aspS putative aspartyl-tRNA synthetase PF00152: tRNA synthetases class II (D, K and N) 4.84 65724 H aminoacyl-tRNA-synthetase 3.7.2 BAC72107.1 Non-secretory protein CDS SAVERM_4396 5378974 5379849 putative dioxygenase PF00775: Dioxygenase 4.7 30132 H miscellaneous 4.7 BAC72108.1 Signal peptide CDS SAVERM_4397 5379859 5380140 hypothetical protein 8.83 9341 H no similarity 6 BAC72109.1 Non-secretory protein CDS SAVERM_4398 5380867 5380424 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.04 15695 H regulation 3.5.2 BAC72110.1 Non-secretory protein CDS SAVERM_4399 5381111 5381959 putative DNA-binding protein PF01381: Helix-turn-helix 9.56 31361 H regulation 3.5.2 BAC72111.1 Non-secretory protein CDS SAVERM_4400 5382139 5382564 hypothetical protein 4.22 14530 H no similarity 6 BAC72112.1 Non-secretory protein CDS SAVERM_4401 5383078 5382545 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.04 19898 H miscellaneous 4.7 BAC72113.1 Non-secretory protein CDS SAVERM_4402 5383634 5383149 hypothetical protein 5.94 18359 H no similarity 6 BAC72114.1 Non-secretory protein CDS SAVERM_4403 5385523 5383799 metS putative methionyl-tRNA synthetase PF00133: tRNA synthetases class I (I, L, M and V) 4.75 64971 H aminoacyl-tRNA-synthetase 3.7.2 BAC72115.1 Non-secretory protein CDS SAVERM_4404 5387478 5385730 hypothetical protein PF00092: von Willebrand factor type A domain 3.84 61380 H similar to unknown proteins 5 BAC72116.1 Non-secretory protein CDS SAVERM_4405 5387779 5389881 hypothetical protein PF05787: Bacterial protein of unknown function (DUF839) 7.32 75200 H similar to unknown proteins 5 BAC72117.1 Non-secretory protein CDS SAVERM_4406 5390889 5389939 mprR putative LysR-family transcriptional regulator (small neutral protease regulatory protein) PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 7.31 34686 H regulation 3.5.2 BAC72118.1 Non-secretory protein CDS SAVERM_4407 5391097 5391780 snpA putative snapalysin (secreted metalloprotease) PF02031: Streptomyces extracellular neutral proteinase (M7) family 9.26 23386 H protein modification 3.8 BAC72119.1 Signal peptide CDS SAVERM_4408 5393858 5391918 putative integral membrane protein PF05976: Bacterial membrane protein of unknown function (DUF893) 9.97 68008 H miscellaneous 4.7 BAC72120.1 Non-secretory protein CDS SAVERM_4409 5394934 5393921 hypothetical protein PF03372: Endonuclease/Exonuclease/phosphatase family 8.86 36049 H similar to unknown proteins 5 BAC72121.1 Non-secretory protein CDS SAVERM_4410 5395928 5395143 putative hydrolase PF00561: alpha/beta hydrolase fold 5.34 27986 H miscellaneous 4.7 BAC72122.1 Non-secretory protein CDS SAVERM_4411 5396010 5397446 putative GntR-family transcriptional regulator frameshift 12.6 48743 H regulation 4.7 BAC72123.1 Non-secretory protein CDS SAVERM_4412 5396629 5397363 putative transcriptional regulator frameshift 5.79 25704 H miscellaneous 4.7 BAC72124.1 Non-secretory protein CDS SAVERM_4413 5398177 5397278 putative secreted protein 9.59 31528 H similar to unknown proteins 5 BAC72125.1 Signal peptide CDS SAVERM_4414 5398967 5398569 hypothetical protein 9.23 14188 H similar to unknown proteins 5 BAC72126.1 Non-secretory protein CDS SAVERM_4415 5399204 5400463 prpB9 putative magnesium or manganese-dependent protein phosphatase PF01933: Uncharacterised protein family UPF0052; membrane protein 7.67 44793 H protein modification 3.8 BAC72127.1 Non-secretory protein CDS SAVERM_4416 5400539 5401288 putative two-component system response regulator PF00072: Response regulator receiver domain 5.78 27635 H regulation 3.5.2 BAC72128.1 Non-secretory protein CDS SAVERM_4417 5401291 5402415 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.71 39139 H sensors 1.3 BAC72129.1 Non-secretory protein CDS SAVERM_4418 5402498 5403640 hypothetical protein 8.34 39964 H similar to unknown proteins 5 BAC72130.1 Signal peptide CDS SAVERM_4419 5405776 5403680 hypothetical protein 6.03 72132 H similar to unknown proteins 5 BAC72131.1 Non-secretory protein CDS SAVERM_4420 5406009 5405854 putative secreted protein 12.5 5095 H no similarity 6 BAC72132.1 Signal peptide CDS SAVERM_4421 5406164 5407507 putative regulatory protein PF07721: Tetratricopeptide repeat 5.95 48015 H regulation 3.5.2 BAC72133.1 Non-secretory protein CDS SAVERM_4422 5408043 5407822 hypothetical protein 9.26 7857 H no similarity 6 BAC72134.1 Non-secretory protein CDS SAVERM_4423 5409736 5408114 pbp7 putative penicillin-binding protein, secreted Tat substrate, PF00912: Transglycosylase 10.7 57130 H cell wall 1.1 BAC72135.1 Non-secretory protein CDS SAVERM_4424 5410407 5409733 hypothetical protein 10.18 23612 H no similarity 6 BAC72136.1 Non-secretory protein CDS SAVERM_4425 5410841 5410404 sig38 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 11.96 15792 H RNA initiation 3.5.1 BAC72137.1 Non-secretory protein CDS SAVERM_4426 5411599 5410838 hypothetical protein PF03734: ErfK/YbiS/YcfS/YnhG 9.32 26582 H similar to unknown proteins 5 BAC72138.1 Non-secretory protein CDS SAVERM_4427 5411790 5412317 sig39 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 8.53 19627 H RNA initiation 3.5.1 BAC72139.1 Non-secretory protein CDS SAVERM_4428 5412370 5413092 putative secreted protein PF03734: ErfK/YbiS/YcfS/YnhG 10.52 24615 H no similarity 6 BAC72140.1 Non-secretory protein CDS SAVERM_4429 5413105 5413407 putative secreted protein 9.83 11137 H similar to unknown proteins 5 BAC72141.1 Non-secretory protein CDS SAVERM_4430 5414040 5413657 hypothetical protein 5.67 14156 H no similarity 6 BAC72142.1 Non-secretory protein CDS SAVERM_4431 5415433 5414741 hypothetical protein PF08808: RES domain 8.82 25744 H no similarity 6 BAC72143.1 Non-secretory protein CDS SAVERM_4432 5418052 5415734 putative beta transducin-like protein PF00400: WD domain, G-beta repeat 6.7 81479 H sensors 1.3 BAC72144.1 Non-secretory protein CDS SAVERM_4433 5420319 5418049 hypothetical protein 5.5 82499 H no similarity 6 BAC72145.1 Non-secretory protein CDS SAVERM_4434 5420456 5421829 hypothetical protein PF02450: Lecithin:cholesterol acyltransferase 6.35 48528 H similar to unknown proteins 5 BAC72146.1 Non-secretory protein CDS SAVERM_4435 5421978 5423018 hypothetical protein 5.91 35181 H similar to unknown proteins 5 BAC72147.1 Non-secretory protein CDS SAVERM_4436 5423887 5423150 putative secreted protein 6.68 25739 H similar to unknown proteins 5 BAC72148.1 Non-secretory protein CDS SAVERM_4437 5423925 5424692 hypothetical protein PF00582: Universal stress protein family 8.62 27506 H no similarity 6 BAC72149.1 Non-secretory protein CDS SAVERM_4438 5424902 5425672 putative secreted protein 4.54 24849 H similar to unknown proteins 5 BAC72150.1 Signal peptide CDS SAVERM_4439 5425825 5426880 putative permease PF03773: Predicted permease 11.87 35808 H transport / binding proteins & lipoproteins 1.2 BAC72151.1 Non-secretory protein CDS SAVERM_4440 5426832 5427671 putative membrane protein 10.79 30258 H miscellaneous 4.7 BAC72152.1 Non-secretory protein CDS SAVERM_4441 5428461 5427739 hypothetical protein 8.97 26870 H no similarity 6 BAC72153.1 Non-secretory protein CDS SAVERM_4442 5428474 5429163 hypothetical protein 11.96 24007 H no similarity 6 BAC72154.1 Non-secretory protein CDS SAVERM_4443 5430301 5429180 putative IS630 family ISPsy1-like transposase IS630 family (5430367..5429184). Inverted repeat sequence (10/10). Target sequence (CTAG). 9.69 42229 H transposon & IS 4.5 BAC72155.1 Non-secretory protein CDS SAVERM_4444 5430439 5431380 hypothetical protein PF00702: haloacid dehalogenase-like hydrolase 5.35 33421 H similar to unknown proteins 5 BAC72156.1 Non-secretory protein CDS SAVERM_4445 5431839 5431462 hypothetical protein 5.1 13396 H similar to unknown proteins 5 BAC72157.1 Non-secretory protein CDS SAVERM_4446 5433448 5431916 putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 11.7 54094 H RNA modification 3.6 BAC72158.1 Non-secretory protein CDS SAVERM_4447 5434043 5433840 cspD4 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.54 7178 H adaptation to atypical conditions 4.1 BAC72159.1 Non-secretory protein CDS SAVERM_4448 5434748 5434404 putative MarR-family transcriptional regulator PF01047: MarR family 4.49 12632 H similar to unknown proteins 5 BAC72160.1 Non-secretory protein CDS SAVERM_4449 5435382 5435200 hypothetical protein 12.25 6734 H no similarity 6 BAC72161.1 Non-secretory protein CDS SAVERM_4450 5435482 5435955 hypothetical protein 7.87 17013 H no similarity 6 BAC72162.1 Non-secretory protein CDS SAVERM_4451 5436036 5436461 hypothetical protein 10.72 14950 H similar to unknown proteins 5 BAC72163.1 Non-secretory protein CDS SAVERM_4452 5436525 5437490 blaA3 putative beta-lactamase (ampC), secreted Tat substrate, PF00144: Beta-lactamase 8.79 34055 H detoxification 4.2 BAC72164.1 Non-secretory protein CDS SAVERM_4453 5437523 5438674 putative two-component system sensor kinase PF07730: Histidine kinase 11.06 40416 H sensors 1.3 BAC72165.1 Non-secretory protein CDS SAVERM_4454 5438671 5439321 putative two-component system response regulator PF00072: Response regulator receiver domain 5.94 23017 H regulation 3.5.2 BAC72166.1 Non-secretory protein CDS SAVERM_4455 5439435 5440601 putative beta-lactamase, secreted PF00144: Beta-lactamase 7.39 41057 H detoxification 4.2 BAC72167.1 Signal peptide CDS SAVERM_4456 5440567 5440959 hypothetical protein 8.41 13701 H no similarity 6 BAC72168.1 Non-secretory protein CDS SAVERM_4457 5442080 5440971 putative secreted protein PF06626: Protein of unknown function (DUF1152) 4.71 38894 H similar to unknown proteins 5 BAC72169.1 Non-secretory protein CDS SAVERM_4458 5442619 5442948 putative secreted protein 10.87 11216 H no similarity 6 BAC72170.1 Signal peptide CDS SAVERM_4459 5443230 5444921 hyaS putative secreted protein involving hyphae aggregation PF01186: Lysyl oxidase 8.05 59661 H similar to unknown proteins 5 BAC72171.1 Signal peptide CDS SAVERM_4460 5445508 5446695 putative secreted protein 5.65 42223 H similar to unknown proteins 5 BAC72172.1 Signal peptide CDS SAVERM_4461 5448367 5447060 putative secreted protein PF05257: CHAP domain 5.12 45593 H similar to unknown proteins 5 BAC72173.1 Signal peptide CDS SAVERM_4462 5449474 5450733 wbpA putative UDP-glucose/GDP-mannose dehydrogenase PF03721: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 5.28 45286 H specific pathways 2.1.1 BAC72174.1 Non-secretory protein CDS SAVERM_4463 5451109 5452428 putative glycosyltransferase, secreted similar to hyaluronate synthase, PF00535: Glycosyl transferase 9.82 49719 H specific pathways 2.1.1 BAC72175.1 Signal peptide CDS SAVERM_4464 5453354 5453929 dcd putative 2’-deoxycytidine 5’-triphosphate deaminase PF00692: dUTPase 5.59 21469 H metabolism of nucleotides & nucleic acids 2.3 BAC72176.1 Non-secretory protein CDS SAVERM_4465 5453950 5454459 gptA putative purine phosphoribosyltransferase PF00156: Phosphoribosyl transferase domain 4.61 18669 H metabolism of nucleotides & nucleic acids 2.3 BAC72177.1 Non-secretory protein CDS SAVERM_4466 5456419 5455631 putative IS5 family ISMt1-like transposase IS5 family (5455552..5456486) Inverted repeat sequence (10/12). 11.45 28959 H transposon & IS 4.5 BAC72178.1 Non-secretory protein CDS SAVERM_4467 5457267 5456416 putative rRNA methyltransferase PF08242: Methyltransferase domain 7.57 30568 H RNA modification 3.6 BAC72179.1 Non-secretory protein CDS SAVERM_4468 5459101 5457668 int11 putative serine-family recombinase/integrase PF07508: Recombinase 9.77 54110 H phage-related functions 4.4 BAC72180.1 Non-secretory protein CDS SAVERM_4469 5460319 5459306 putative membrane protein PF06532: Protein of unknown function (DUF1109) 7.25 35375 H miscellaneous 4.7 BAC72181.1 Non-secretory protein CDS SAVERM_4470 5460908 5460393 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 8.88 19216 L regulation 3.5.2 BAC72182.1 Non-secretory protein CDS SAVERM_4471 5460989 5461831 putative DNA-binding protein PF01381: Helix-turn-helix 6.97 31381 L regulation 3.5.2 BAC72183.1 Non-secretory protein CDS SAVERM_4472 5461843 5462028 hypothetical protein PF04149: Domain of unknown function (DUF397) 7.36 6543 L no similarity 6 BAC72184.1 Non-secretory protein CDS SAVERM_4473 5463505 5462069 putative integrin-like protein PF01839: FG-GAP repeat 4.16 46971 L transport / binding proteins & lipoproteins 1.2 BAC72185.1 Signal peptide CDS SAVERM_4474 5464970 5463525 putative integrin-like protein PF01839: FG-GAP repeat 4.44 47771 L transport / binding proteins & lipoproteins 1.2 BAC72186.1 Signal peptide CDS SAVERM_4475 5466422 5465049 putative integrin-like protein PF01839: FG-GAP repeat 4.1 45004 L transport / binding proteins & lipoproteins 1.2 BAC72187.1 Signal peptide CDS SAVERM_4476 5467916 5466471 putative integrin-like protein PF01839: FG-GAP repeat 3.8 47316 L transport / binding proteins & lipoproteins 1.2 BAC72188.1 Signal peptide CDS SAVERM_4477 5469623 5468142 putative integrin-like protein PF01839: FG-GAP repeat 3.92 48995 L transport / binding proteins & lipoproteins 1.2 BAC72189.1 Signal peptide CDS SAVERM_4478 5471394 5469949 putative integrin-like protein PF01839: FG-GAP repeat 3.97 46796 L transport / binding proteins & lipoproteins 1.2 BAC72190.1 Signal peptide CDS SAVERM_4479 5472954 5471488 putative integrin-like protein PF01839: FG-GAP repeat 4.53 50592 L similar to unknown proteins 5 BAC72191.1 Signal peptide CDS SAVERM_4480 5473189 5473617 putative secreted protein 3.94 14659 L no similarity 6 BAC72192.1 Signal peptide CDS SAVERM_4481 5475165 5473717 putative secreted protein PF02389: Cornifin (SPRR) family 4.11 52005 L similar to unknown proteins 5 BAC72193.1 Signal peptide CDS SAVERM_4482 5477660 5475393 putative iron-sulfur binding reductase PF02754: Cysteine-rich domain 5.84 83158 L miscellaneous 4.7 BAC72194.1 Non-secretory protein CDS SAVERM_4483 5477906 5478958 putative glycosyltransferase, secreted PF00953: Glycosyl transferase 12.13 34298 L specific pathways 2.1.1 BAC72195.1 Non-secretory protein CDS SAVERM_4484 5479054 5480922 dnaK1 putative heat shock protein Hsp70 PF00012: Hsp70 protein 4.49 66692 L protein folding 3.9 BAC72196.1 Non-secretory protein CDS SAVERM_4485 5480919 5481584 grpE1 putative heat shock protein GrpE PF01025: GrpE 4.26 23414 L adaptation to atypical conditions 4.1 BAC72197.1 Non-secretory protein CDS SAVERM_4486 5481621 5482811 dnaJ1 putative heat shock protein DnaJ PF01556: DnaJ C terminal region 9.24 40956 L adaptation to atypical conditions 4.1 BAC72198.1 Non-secretory protein CDS SAVERM_4487 5482816 5483265 hspR putative HspR protein repressor of dnaK operon, PF00376: MerR family regulatory protein 8.87 16844 L adaptation to atypical conditions 4.1 BAC72199.1 Non-secretory protein CDS SAVERM_4488 5483746 5484882 putative simple sugar ABC transporter substrate-binding protein Tat substrate, PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.13 39881 L transport / binding proteins & lipoproteins 1.2 BAC72200.1 Signal peptide CDS SAVERM_4489 5485415 5485086 hypothetical protein 4.11 11234 L no similarity 6 BAC72201.1 Non-secretory protein CDS SAVERM_4490 5487214 5485460 hypothetical protein PF02467: Transcription factor WhiB 8.95 61647 L no similarity 6 BAC72202.1 Non-secretory protein CDS SAVERM_4491 5487797 5487162 putative secreted protein 12.07 21881 L no similarity 6 BAC72203.1 Non-secretory protein CDS SAVERM_4492 5489026 5487794 hypothetical protein 4.51 45068 L similar to unknown proteins 5 BAC72204.1 Non-secretory protein CDS SAVERM_4493 5489739 5489023 hypothetical protein 4.43 25982 L no similarity 6 BAC72205.1 Non-secretory protein CDS SAVERM_4494 5490298 5489669 hypothetical protein 10.61 23400 L no similarity 6 BAC72206.1 Non-secretory protein CDS SAVERM_4495 5492782 5490512 putative secreted protein 10.39 80348 L similar to unknown proteins 5 BAC72207.1 Signal peptide CDS SAVERM_4496 5493341 5492823 putative secreted protein 4 18408 L similar to unknown proteins 5 BAC72208.1 Signal peptide CDS SAVERM_4497 5493963 5493352 putative secreted protein 4.75 21550 L similar to unknown proteins 5 BAC72209.1 Signal peptide CDS SAVERM_4498 5496983 5493999 putative secreted protein 5.72 109483 L similar to unknown proteins 5 BAC72210.1 Signal peptide CDS SAVERM_4499 5497533 5497036 hypothetical protein 6.08 18784 L no similarity 6 BAC72211.1 Non-secretory protein CDS SAVERM_4500 5497841 5497575 hypothetical protein 4.54 9001 L no similarity 6 BAC72212.1 Non-secretory protein CDS SAVERM_4501 5498944 5500545 hypothetical protein 11.77 55646 L similar to unknown proteins 5 BAC72214.1 Non-secretory protein CDS SAVERM_4502 5498972 5497917 putative secreted protein 4.59 36694 L similar to unknown proteins 5 BAC72213.1 Signal peptide CDS SAVERM_4503 5500576 5501205 hypothetical protein 5.03 22649 L no similarity 6 BAC72215.1 Non-secretory protein CDS SAVERM_4504 5501202 5502227 hypothetical protein 5.16 37157 L no similarity 6 BAC72216.1 Non-secretory protein CDS SAVERM_4505 5502224 5502604 hypothetical protein 5.45 14428 L similar to unknown proteins 5 BAC72217.1 Non-secretory protein CDS SAVERM_4506 5502822 5503505 putative secreted protein 4.35 23044 L no similarity 6 BAC72218.1 Non-secretory protein CDS SAVERM_4507 5503513 5505618 putative zoocin A PF01551: Peptidase family M23 6.84 72578 L protein modification 3.8 BAC72219.1 Non-secretory protein CDS SAVERM_4508 5505620 5507065 putative secreted protein PF01011: PQQ enzyme repeat 4.33 50004 L no similarity 6 BAC72220.1 Non-secretory protein CDS SAVERM_4509 5507102 5508832 trsK putative conjugative transfer gene complex protein PF02534: TraG/TraD family 8.05 61899 L plasmid transfer 4.7.2 BAC72221.1 Non-secretory protein CDS SAVERM_4510 5509973 5511187 putative LuxR-famiry transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 7.73 43387 L regulation 3.5.2 BAC72222.1 Non-secretory protein CDS SAVERM_4511 5512215 5511232 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 5.81 36081 L regulation 3.5.2 BAC72223.1 Non-secretory protein CDS SAVERM_4512 5512530 5512865 hypothetical protein 6.52 12632 L similar to unknown proteins 5 BAC72224.1 Non-secretory protein CDS SAVERM_4513 5513464 5513048 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 8.48 15157 L similar to unknown proteins 5 BAC72225.1 Non-secretory protein CDS SAVERM_4514 5513634 5516246 clpB1 putative ATP-dependent Clp protease ATPases with chaperone activity, PF07724: ATPase family associated with various cellular activities (AAA) 4.77 95043 L adaptation to atypical conditions 4.1 BAC72226.1 Non-secretory protein CDS SAVERM_4515 5516519 5517046 hypothetical protein 4.08 19979 L similar to unknown proteins 5 BAC72227.1 Non-secretory protein CDS SAVERM_4516 5518279 5517068 putative membrane protein PF04188: Protein of unknown function (DUF409) 10.86 42709 L miscellaneous 4.7 BAC72228.1 Non-secretory protein CDS SAVERM_4517 5519662 5518466 dapC putative N-succinyldiaminopimelate aminotransferase PF00155: Aminotransferase class I and II 4.9 43207 L metabolism of amino acids & related molecules 2.2 BAC72229.1 Non-secretory protein CDS SAVERM_4518 5520607 5521125 hypothetical protein PF10936: Protein of unknown function DUF2617 6.95 18476 L similar to unknown proteins 5 BAC72230.1 Non-secretory protein CDS SAVERM_4519 5521235 5522881 speE putative spermidine synthase PF01564: Spermine/spermidine synthase 9.71 57726 L metabolism of amino acids & related molecules 2.2 BAC72231.1 Non-secretory protein CDS SAVERM_4520 5522997 5523929 hypothetical protein PF06240: Carbon monoxide dehydrogenase subunit G (CoxG) 4.3 32004 L similar to unknown proteins 5 BAC72232.1 Non-secretory protein CDS SAVERM_4521 5524053 5524841 hypothetical protein PF01263: Aldose 1-epimerase 4.68 28988 L similar to unknown proteins 5 BAC72233.1 Non-secretory protein CDS SAVERM_4522 5524875 5525423 pyrE putative orotate phosphoribosyltransferase PF00156: Phosphoribosyl transferase domain 4.9 19033 L metabolism of nucleotides & nucleic acids 2.3 BAC72234.1 Non-secretory protein CDS SAVERM_4523 5525590 5526612 fbaA putative fructose 1,6-bisphosphate aldolase PF01116: Fructose-bisphosphate aldolase class-II 5.3 36817 L main glycolytic pathways 2.1.2 BAC72235.1 Non-secretory protein CDS SAVERM_4524 5526702 5528291 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.09 53721 L transport / binding proteins & lipoproteins 1.2 BAC72236.1 Non-secretory protein CDS SAVERM_4525 5528433 5528846 hypothetical protein PF11349: Protein of unknown function (DUF3151) 6.23 14756 L similar to unknown proteins 5 BAC72237.1 Non-secretory protein CDS SAVERM_4526 5529052 5529897 tdo putative tryptophan 2,3-dioxygenase PF03301: Tryptophan 2,3-dioxygenase 5.59 31411 L metabolism of amino acids & related molecules 2.2 BAC72238.1 Non-secretory protein CDS SAVERM_4527 5529890 5531074 putative hydrolase PF01053: Cys/Met metabolism PLP-dependent enzyme 4.8 41810 L miscellaneous 4.7 BAC72239.1 Non-secretory protein CDS SAVERM_4528 5531443 5531090 hypothetical protein 6.97 12639 L no similarity 6 BAC72240.1 Non-secretory protein CDS SAVERM_4529 5533534 5531573 hypothetical protein PF00498: FHA domain 10.26 71504 L similar to unknown proteins 5 BAC72241.1 Non-secretory protein CDS SAVERM_4530 5534287 5533682 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.86 21226 L regulation 3.5.2 BAC72242.1 Non-secretory protein CDS SAVERM_4531 5534474 5535493 putative lipase/esterase PF07859: alpha/beta hydrolase fold 4.85 34536 L metabolism of lipids 2.4 BAC72243.1 Non-secretory protein CDS SAVERM_4532 5535768 5536859 putative membrane protein Tat substrate, PF06259: Domain of unknown function (DUF1023) 9.89 37784 L miscellaneous 4.7 BAC72244.1 Non-secretory protein CDS SAVERM_4533 5536852 5538147 putative membrane protein PF01757: Acyltransferase family 12.29 45971 L miscellaneous 4.7 BAC72245.1 Non-secretory protein CDS SAVERM_4534 5538158 5539612 putative two-component system sensor kinase PF07730: Histidine kinase 9.43 51525 L sensors 1.3 BAC72246.1 Non-secretory protein CDS SAVERM_4535 5539727 5540401 putative two-component system response regulator PF00072: Response regulator receiver domain 4.7 24058 L regulation 3.5.2 BAC72247.1 Non-secretory protein CDS SAVERM_4536 5540582 5541961 putative two-component system sensor kinase PF07730: Histidine kinase 6.33 49651 L sensors 1.3 BAC72248.1 Non-secretory protein CDS SAVERM_4537 5541958 5542632 putative two-component system response regulator PF00072: Response regulator receiver domain 4.76 24029 L regulation 3.5.2 BAC72249.1 Non-secretory protein CDS SAVERM_4538 5543067 5543252 hypothetical protein PF04149: Domain of unknown function (DUF397) 10.47 6652 L similar to unknown proteins 5 BAC72250.1 Non-secretory protein CDS SAVERM_4539 5543376 5544593 cyp20 putative cytochrome P450 CYP107P2 4.95 44885 L metabolism of coenzymes & prosthetic groups 2.5 BAC72251.1 Non-secretory protein CDS SAVERM_4540 5546452 5544848 putative ABC transporter permease protein PF04172: LrgB-like family 9.65 54866 L transport / binding proteins & lipoproteins 1.2 BAC72252.1 Non-secretory protein CDS SAVERM_4541 5547363 5546449 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.3 33447 L transport / binding proteins & lipoproteins 1.2 BAC72253.1 Non-secretory protein CDS SAVERM_4542 5547552 5547962 putative MarR-family transcriptional regulator PF01047: MarR family 7.86 15475 L regulation 3.5.2 BAC72254.1 Non-secretory protein CDS SAVERM_4543 5549590 5548088 putative amino acid permease PF00324: Amino acid permease 9.33 52591 L transport / binding proteins & lipoproteins 1.2 BAC72255.1 Non-secretory protein CDS SAVERM_4544 5549845 5551239 eutB putative ethanolamine ammonia-lyase large subunit PF06751: Ethanolamine ammonia lyase large subunit (EutB) 4.55 48726 L specific pathways 2.1.1 BAC72256.1 Non-secretory protein CDS SAVERM_4545 5551236 5552024 eutC putative ethanolamine ammonia-lyase small subunit PF05985: Ethanolamine ammonia-lyase light chain (EutC) 8.51 27786 L specific pathways 2.1.1 BAC72257.1 Non-secretory protein CDS SAVERM_4546 5553174 5552317 hypothetical protein PF00781: Diacylglycerol kinase catalytic domain (presumed) 9.54 29788 L similar to unknown proteins 5 BAC72258.1 Non-secretory protein CDS SAVERM_4547 5553370 5554653 purA putative adenylosuccinate synthetase PF00709: Adenylosuccinate synthetase 5.09 46135 L metabolism of nucleotides & nucleic acids 2.3 BAC72259.1 Non-secretory protein CDS SAVERM_4548 5555531 5554881 hypothetical protein 4.05 23296 L similar to unknown proteins 5 BAC72260.1 Non-secretory protein CDS SAVERM_4549 5558074 5555606 putative glycosyltransferase PF00535: Glycosyl transferase 8.53 88625 L specific pathways 2.1.1 BAC72261.1 Non-secretory protein CDS SAVERM_4550 5558775 5558071 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.89 25509 L regulation 3.5.2 BAC72262.1 Non-secretory protein CDS SAVERM_4551 5560333 5558978 putative aminotransferase PF00202: Aminotransferase class-III 4.98 48232 L metabolism of amino acids & related molecules 2.2 BAC72263.1 Non-secretory protein CDS SAVERM_4552 5560534 5561136 hypothetical protein PF01965: DJ-1/PfpI family 4.35 21286 L similar to unknown proteins 5 BAC72264.1 Non-secretory protein CDS SAVERM_4553 5561133 5561588 putative MarR-family transcriptional regulator PF01047: MarR family 9.29 16194 L regulation 3.5.2 BAC72265.1 Non-secretory protein CDS SAVERM_4554 5561678 5563726 pkn14 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.21 69415 L protein modification 3.8 BAC72266.1 Non-secretory protein CDS SAVERM_4555 5564591 5563845 hypothetical protein 6.05 26499 L similar to unknown proteins 5 BAC72267.1 Non-secretory protein CDS SAVERM_4556 5564945 5565286 hypothetical protein PF02575: Uncharacterised BCR, YbaB family COG0718 3.99 11538 L similar to unknown proteins 5 BAC72268.1 Non-secretory protein CDS SAVERM_4557 5565399 5565998 recR putative recombination and repair protein PF01751: Toprim domain 4.99 21826 L DNA recombination 3.3 BAC72269.1 Non-secretory protein CDS SAVERM_4558 5565991 5566650 hypothetical protein 3.98 24186 L similar to unknown proteins 5 BAC72270.1 Non-secretory protein CDS SAVERM_4559 5567003 5568295 lysC putative aspartate kinase ask, PF00696: Amino acid kinase family 4.99 45385 L metabolism of amino acids & related molecules 2.2 BAC72271.1 Non-secretory protein CDS SAVERM_4560 5568295 5569371 asd1 putative aspartate-semialdehyde dehydrogenase PF02774: Semialdehyde dehydrogenase, dimerisation domain 4.99 37763 L metabolism of amino acids & related molecules 2.2 BAC72272.1 Non-secretory protein CDS SAVERM_4561 5569855 5570430 sig40 putative RNA polymerase ECF-subfamily sigma factor similar to SCO3613, PF08281: Sigma-70, region 4 9.67 21174 L RNA initiation 3.5.1 BAC72273.1 Non-secretory protein CDS SAVERM_4562 5570427 5571629 hypothetical protein 4.4 39099 L similar to unknown proteins 5 BAC72274.1 Non-secretory protein CDS SAVERM_4563 5572542 5571715 hypothetical protein PF02104: SURF1 family 5.45 29647 L similar to unknown proteins 5 BAC72275.1 Non-secretory protein CDS SAVERM_4564 5574560 5572719 putative aminoacyl peptidase PF00326: Prolyl oligopeptidase family 4.43 66339 L protein modification 3.8 BAC72276.1 Non-secretory protein CDS SAVERM_4565 5576704 5574683 putative membrane protein PF02254: TrkA-N domain 9.12 69750 L miscellaneous 4.7 BAC72277.1 Non-secretory protein CDS SAVERM_4566 5577484 5576837 hypothetical protein PF01638: Transcriptional regulator 9.28 24242 L similar to unknown proteins 5 BAC72278.1 Non-secretory protein CDS SAVERM_4567 5578559 5577789 hypothetical protein 8.67 27779 L similar to unknown proteins 5 BAC72279.1 Non-secretory protein CDS SAVERM_4568 5579566 5578556 putative permease PF03773: Predicted permease 11.56 34801 L transport / binding proteins & lipoproteins 1.2 BAC72280.1 Non-secretory protein CDS SAVERM_4569 5581179 5579758 putative membrane protein 10.19 49645 L miscellaneous 4.7 BAC72281.1 Non-secretory protein CDS SAVERM_4570 5581246 5582550 hypothetical protein PF00174: Oxidoreductase molybdopterin binding domain 9.91 47049 L similar to unknown proteins 5 BAC72282.1 Non-secretory protein CDS SAVERM_4571 5583853 5582954 hypothetical protein PF05724: Thiopurine S-methyltransferase (TPMT) 7.18 31259 L similar to unknown proteins 5 BAC72283.1 Non-secretory protein CDS SAVERM_4572 5584467 5583850 hypothetical protein PF09837: Uncharacterized protein conserved in bacteria (DUF2064) 5.99 21534 L similar to unknown proteins 5 BAC72284.1 Non-secretory protein CDS SAVERM_4573 5585261 5584464 putative glycosyltransferase PF00535: Glycosyl transferase 7.9 28264 L specific pathways 2.1.1 BAC72285.1 Non-secretory protein CDS SAVERM_4574 5586504 5585503 galE2 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 6 35124 L specific pathways 2.1.1 BAC72286.1 Non-secretory protein CDS SAVERM_4575 5588008 5586743 putative serine protease PF00082: Subtilase family 7.73 43547 L protein modification 3.8 BAC72287.1 Signal peptide CDS SAVERM_4576 5589681 5588005 hypothetical protein 7.07 56300 L similar to unknown proteins 5 BAC72288.1 Non-secretory protein CDS SAVERM_4577 5590305 5589742 putative secreted protein 4.47 19266 L similar to unknown proteins 5 BAC72289.1 Non-secretory protein CDS SAVERM_4578 5590803 5591261 hypothetical protein 6.96 15826 L no similarity 6 BAC72290.1 Non-secretory protein CDS SAVERM_4579 5591261 5593192 hypothetical protein PF06259: Domain of unknown function (DUF1023) 4.76 67093 L similar to unknown proteins 5 BAC72291.1 Non-secretory protein CDS SAVERM_4580 5595373 5594588 putative membrane protein 11.33 28124 L miscellaneous 4.7 BAC72292.1 Non-secretory protein CDS SAVERM_4581 5596387 5595461 hypothetical protein PF00149: Calcineurin-like phosphoesterase 8.58 33504 L similar to unknown proteins 5 BAC72293.1 Non-secretory protein CDS SAVERM_4582 5596519 5596986 hypothetical protein PF02637: GatB/Yqey domain 7.01 16650 L similar to unknown proteins 5 BAC72294.1 Non-secretory protein CDS SAVERM_4583 5599337 5597046 pbp8 putative penicillin-binding protein, secreted PF00912: Transglycosylase 9.41 80134 L cell wall 1.1 BAC72295.1 Non-secretory protein CDS SAVERM_4584 5599696 5600085 wblA putative WhiB-family transcriptional regulator; putative role in cell cycle control PF02467: Transcription factor WhiB 4.44 14257 L regulation 3.5.2 BAC72296.1 Non-secretory protein CDS SAVERM_4585 5601584 5600160 putative ion-transporting ATPase PF02374: Anion-transporting ATPase 4.85 50126 L transport / binding proteins & lipoproteins 1.2 BAC72297.1 Non-secretory protein CDS SAVERM_4586 5602558 5601581 putative ion-transporting ATPase PF02374: Anion-transporting ATPase 6.55 34921 L transport / binding proteins & lipoproteins 1.2 BAC72298.1 Non-secretory protein CDS SAVERM_4587 5602654 5602815 hypothetical protein 4.84 6120 L similar to unknown proteins 5 BAC72299.1 Non-secretory protein CDS SAVERM_4588 5602812 5603282 hypothetical protein PF01042: Endoribonuclease L-PSP 4.43 15770 L similar to unknown proteins 5 BAC72300.1 Non-secretory protein CDS SAVERM_4589 5603487 5604359 hypothetical protein PF00293: NUDIX domain 5.06 31667 L similar to unknown proteins 5 BAC72301.1 Non-secretory protein CDS SAVERM_4590 5604356 5605186 putative hydrolase PF00753: Metallo-beta-lactamase superfamily 5.29 29183 L miscellaneous 4.7 BAC72302.1 Non-secretory protein CDS SAVERM_4591 5606171 5605260 hypothetical protein PF01909: Nucleotidyltransferase domain 5.94 33549 L similar to unknown proteins 5 BAC72303.1 Non-secretory protein CDS SAVERM_4592 5606872 5606198 putative transcriptional regulator with cyclic nucleotide-binding domain PF00027: Cyclic nucleotide-binding domain 6.05 24526 L regulation 3.5.2 BAC72304.1 Non-secretory protein CDS SAVERM_4593 5607216 5608148 nth putative endonuclease III PF00730: HhH-GPD superfamily base excision DNA repair protein 10.38 33718 L DNA modification & repair 3.2 BAC72305.1 Signal peptide CDS SAVERM_4594 5608210 5608977 hypothetical protein PF00293: NUDIX domain 4.69 27273 L similar to unknown proteins 5 BAC72306.1 Non-secretory protein CDS SAVERM_4595 5609098 5610297 putative serine protease PF00089: Trypsin 9.42 42065 L protein modification 3.8 BAC72307.1 Non-secretory protein CDS SAVERM_4596 5611597 5610647 putative hydrolase PF00561: alpha/beta hydrolase fold 8.69 35363 L miscellaneous 4.7 BAC72308.1 Non-secretory protein CDS SAVERM_4597 5612070 5611594 hypothetical protein PF07332: Protein of unknown function (DUF1469) 10.49 16187 L similar to unknown proteins 5 BAC72309.1 Non-secretory protein CDS SAVERM_4598 5613514 5612114 putative sodium/proton antiporter PF06965: Na+/H+ antiporter 1 5.72 49235 L transport / binding proteins & lipoproteins 1.2 BAC72310.1 Non-secretory protein CDS SAVERM_4599 5615705 5613747 acsA1 putative acetyl-CoA synthetase PF00501: AMP-binding enzyme 5.04 71091 L specific pathways 2.1.1 BAC72311.1 Non-secretory protein CDS SAVERM_4600 5618407 5616032 putative membrane protein PF00916: Sulfate transporter family 8.51 82195 L miscellaneous 4.7 BAC72312.1 Non-secretory protein CDS SAVERM_4601 5618725 5619996 putative secreted protein 7.88 46345 L similar to unknown proteins 5 BAC72313.1 Signal peptide CDS SAVERM_4602 5620975 5619986 cooC putative carbon monoxide dehydrogenase accessory protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 5.64 35504 L miscellaneous 4.7 BAC72314.1 Non-secretory protein CDS SAVERM_4603 5621068 5621892 hypothetical protein 5.98 28434 L similar to unknown proteins 5 BAC72315.1 Non-secretory protein CDS SAVERM_4604 5623119 5622286 ssgB putative morphological differentiation-associated protein PF00702: haloacid dehalogenase-like hydrolase 6.51 30367 L cell division 1.7 BAC72316.1 Non-secretory protein CDS SAVERM_4605 5623699 5624793 minD2 putative septum site determining protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 5.47 37184 L cell division 1.7 BAC72317.1 Non-secretory protein CDS SAVERM_4606 5624790 5626091 hypothetical protein PF00437: Type II/IV secretion system protein 6.97 44742 L similar to unknown proteins 5 BAC72318.1 Non-secretory protein CDS SAVERM_4607 5626372 5627001 hypothetical protein PF00482: Bacterial type II secretion system protein F domain 7.69 20750 L similar to unknown proteins 5 BAC72319.1 Non-secretory protein CDS SAVERM_4608 5626998 5627498 hypothetical protein 12.5 17287 L similar to unknown proteins 5 BAC72320.1 Non-secretory protein CDS SAVERM_4609 5627482 5627787 putative membrane protein 11.85 10079 L miscellaneous 4.7 BAC72321.1 Non-secretory protein CDS SAVERM_4610 5627907 5628140 hypothetical protein 11.88 8254 L similar to unknown proteins 5 BAC72322.1 Non-secretory protein CDS SAVERM_4611 5628127 5628567 hypothetical protein PF07811: TadE-like protein 5.88 14618 L similar to unknown proteins 5 BAC72323.1 Non-secretory protein CDS SAVERM_4612 5628315 5629013 putative membrane protein 11.92 22158 L miscellaneous 4.7 BAC72324.1 Non-secretory protein CDS SAVERM_4613 5631517 5629010 putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 6.46 89739 L RNA modification 3.6 BAC72325.1 Non-secretory protein CDS SAVERM_4614 5631598 5631939 rsbV anti-sigma factor antagonist bldG, PF01740: STAS domain 4.88 12348 L adaptation to atypical conditions 4.1 BAC72326.1 Non-secretory protein CDS SAVERM_4615 5632069 5632509 rsbW2 putative anti-sigma factor 4.17 15298 L regulation 3.5.2 BAC72327.1 Non-secretory protein CDS SAVERM_4616 5632824 5635229 hppA putative pyrophosphate-energized proton pump PF03030: Inorganic H+ pyrophosphatase 5.26 81610 L metabolism of phosphates 2.6 BAC72328.1 Non-secretory protein CDS SAVERM_4617 5635446 5636042 putative secreted protein 4.64 20296 L similar to unknown proteins 5 BAC72329.1 Signal peptide CDS SAVERM_4618 5636158 5637747 putative rRNA or tRNA methyltransferase PF05175: Methyltransferase small domain 4.65 56284 L RNA modification 3.6 BAC72330.1 Non-secretory protein CDS SAVERM_4619 5637938 5640166 pkn15 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.33 76127 L protein modification 3.8 BAC72331.1 Non-secretory protein CDS SAVERM_4620 5640163 5640504 hypothetical protein 12.21 11871 L similar to unknown proteins 5 BAC72332.1 Non-secretory protein CDS SAVERM_4621 5640787 5643615 topA putative DNA topoisomerase I PF01131: DNA topoisomerase 9.11 102620 L DNA packaging & segregation 3.4 BAC72333.1 Non-secretory protein CDS SAVERM_4622 5643834 5647055 tmk putative thymidylate kinase PF02223: Thymidylate kinase 5.47 113936 L metabolism of nucleotides & nucleic acids 2.3 BAC72334.1 Non-secretory protein CDS SAVERM_4623 5647265 5648470 holB putative DNA polymerase III delta prime subunit PF00004: ATPase family associated with various cellular activities (AAA) 6.1 42777 L DNA replication 3.1 BAC72335.1 Non-secretory protein CDS SAVERM_4624 5648606 5650207 slpD putative tripeptidyl-peptidase B, secreted PF08386: TAP-like protein 6.76 56539 L protein modification 3.8 BAC72336.1 Signal peptide CDS SAVERM_4625 5651093 5651473 putative transposase IS4-family protein truncated 11.15 13657 L no similarity 6 BAC72338.1 Signal peptide CDS SAVERM_4626 5651111 5650089 int12 putative tyrosine-family recombinase/integrase integrated tRNA gene, PF00589: Phage integrase family 11.58 38233 L phage-related functions 4.4 BAC72337.1 Signal peptide CDS SAVERM_4627 5652002 5651778 putative secreted protein 8.22 7265 L no similarity 6 BAC72339.1 Signal peptide CDS SAVERM_4628 5653526 5652810 hypothetical protein PF01590: GAF domain 5.86 26013 R similar to unknown proteins 5 BAC72340.1 Non-secretory protein CDS SAVERM_4629 5654485 5653610 hypothetical protein PF03861: ANTAR domain 4.09 30676 R similar to unknown proteins 5 BAC72341.1 Non-secretory protein CDS SAVERM_4630 5655219 5654485 hypothetical protein 10.64 27102 R similar to unknown proteins 5 BAC72342.1 Non-secretory protein CDS SAVERM_4631 5656178 5655894 hypothetical protein PF03861: ANTAR domain 11.19 10452 R similar to unknown proteins 5 BAC72343.1 Non-secretory protein CDS SAVERM_4632 5656707 5656369 hypothetical protein 11.85 13757 R no similarity 6 BAC72344.1 Non-secretory protein CDS SAVERM_4633 5657322 5657666 hypothetical protein 5.23 12888 R similar to unknown proteins 5 BAC72345.1 Non-secretory protein CDS SAVERM_4634 5658328 5659263 putative glycosyltransferase PF00535: Glycosyl transferase 10.03 34135 R specific pathways 2.1.1 BAC72346.1 Non-secretory protein CDS SAVERM_4635 5659480 5662893 putative transcriptional regulator similar to AfsR, PF03704: Bacterial transcriptional activator domain 6.18 119684 R regulation 3.5.2 BAC72347.1 Non-secretory protein CDS SAVERM_4636 5664547 5662853 polA2 putative DNA polymerase I PF00476: DNA polymerase family A 6.28 61041 R DNA replication 3.1 BAC72348.1 Non-secretory protein CDS SAVERM_4637 5665315 5664626 clpX1 putative ClpX protein PF02861: Clp amino terminal domain 9.1 23874 R adaptation to atypical conditions 4.1 BAC72349.1 Non-secretory protein CDS SAVERM_4638 5665530 5666657 hypothetical protein PF10979: Protein of unknown function (DUF2786) 5.79 40189 R similar to unknown proteins 5 BAC72350.1 Non-secretory protein CDS SAVERM_4639 5667186 5666668 putative secreted protein 6.51 16949 R similar to unknown proteins 5 BAC72351.1 Signal peptide CDS SAVERM_4640 5668158 5667649 putative secreted protein PF05481: Mycobacterium 19 kDa lipoprotein antigen 8.49 16340 R similar to unknown proteins 5 BAC72352.1 Signal peptide CDS SAVERM_4641 5668528 5668223 rpsN2 putative ribosomal protein S14 PF00253: Ribosomal protein S14p/S29e 12.22 11709 R ribosomal protein 3.7.1 BAC72353.1 Non-secretory protein CDS SAVERM_4642 5668749 5668528 rpmB2 putative ribosomal protein L28 PF00830: Ribosomal L28 family 12.58 8223 R ribosomal protein 3.7.1 BAC72354.1 Non-secretory protein CDS SAVERM_4643 5668835 5668999 rpmG1 putative ribosomal protein L33 PF00471: Ribosomal protein L33 11.87 6561 R ribosomal protein 3.7.1 BAC72355.1 Non-secretory protein CDS SAVERM_4644 5669005 5669253 rpmE3 putative ribosomal protein L31 PF01197: Ribosomal protein L31 8.97 9300 R ribosomal protein 3.7.1 BAC72356.1 Non-secretory protein CDS SAVERM_4645 5669258 5670601 hypothetical protein PF07683: Cobalamin synthesis protein cobW C-terminal domain 4.76 46683 R similar to unknown proteins 5 BAC72357.1 Non-secretory protein CDS SAVERM_4646 5670601 5670837 rpsR2 putative ribosomal protein S18 PF01084: Ribosomal protein S18 12.04 9080 R ribosomal protein 3.7.1 BAC72358.1 Non-secretory protein CDS SAVERM_4647 5671432 5671653 putative regulatory protein PF04149: Domain of unknown function (DUF397) 7.62 7850 R regulation 3.5.2 BAC72359.1 Non-secretory protein CDS SAVERM_4648 5672298 5671774 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.3 19327 R regulation 3.5.2 BAC72360.1 Non-secretory protein CDS SAVERM_4649 5672654 5673478 putative DNA-binding protein PF01381: Helix-turn-helix 6.52 30652 R regulation 3.5.2 BAC72361.1 Non-secretory protein CDS SAVERM_4650 5673611 5675071 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.6 51937 R specific pathways 2.1.1 BAC72362.1 Non-secretory protein CDS SAVERM_4651 5675271 5675810 hypothetical protein PF04978: Protein of unknown function (DUF664) 4.72 19722 R similar to unknown proteins 5 BAC72363.1 Non-secretory protein CDS SAVERM_4652 5675835 5676476 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 5.04 23863 R regulation 3.5.2 BAC72364.1 Non-secretory protein CDS SAVERM_4653 5676565 5677497 putative ABC transporter ATP-binding protein PF00005: ABC transporter 9.5 33294 R transport / binding proteins & lipoproteins 1.2 BAC72365.1 Non-secretory protein CDS SAVERM_4654 5677515 5678276 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.03 27038 R transport / binding proteins & lipoproteins 1.2 BAC72366.1 Non-secretory protein CDS SAVERM_4655 5679713 5678301 gadB2 putative glutamate decarboxylase PF00282: Pyridoxal-dependent decarboxylase conserved domain 5.04 52225 R metabolism of amino acids & related molecules 2.2 BAC72367.1 Non-secretory protein CDS SAVERM_4656 5681030 5679747 hypothetical protein PF00654: Voltage gated chloride channel 8.51 43191 R similar to unknown proteins 5 BAC72368.1 Non-secretory protein CDS SAVERM_4657 5681130 5681891 tipA putative MerR-family transcriptional regulator PF07739: TipAS antibiotic-recognition domain 5.03 28987 R regulation 3.5.2 BAC72369.1 Non-secretory protein CDS SAVERM_4658 5682320 5681955 hypothetical protein PF01906: Domain of unknown function DUF74 6.79 12827 R similar to unknown proteins 5 BAC72370.1 Non-secretory protein CDS SAVERM_4659 5682461 5683480 putative membrane protein PF00597: DedA family 5.29 37261 R miscellaneous 4.7 BAC72371.1 Non-secretory protein CDS SAVERM_4660 5685244 5683583 putative membrane protein PF06738: Protein of unknown function (DUF1212) 6.53 58169 R miscellaneous 4.7 BAC72372.1 Non-secretory protein CDS SAVERM_4661 5685868 5685377 ppa putative inorganic pyrophosphatase PF00719: Inorganic pyrophosphatase 4.68 18636 R metabolism of phosphates 2.6 BAC72373.1 Non-secretory protein CDS SAVERM_4662 5686245 5687630 dacE putative D-alanyl-D-alanine carboxypeptidase PF00768: D-alanyl-D-alanine carboxypeptidase 8.67 46900 R cell wall 1.1 BAC72374.1 Non-secretory protein CDS SAVERM_4663 5687726 5688859 hypothetical protein PF10103: Uncharacterised conserved protein (DUF2342) 6.69 41394 R similar to unknown proteins 5 BAC72375.1 Non-secretory protein CDS SAVERM_4664 5689055 5690092 tilS putative tRNA(Ile)-lysidine synthase PF01171: PP-loop family 9.29 36173 R cell division 1.7 BAC72376.1 Non-secretory protein CDS SAVERM_4665 5690146 5690706 hprT putative hypoxanthine phosphoribosyltransferase PF00156: Phosphoribosyl transferase domain 4.73 20054 R metabolism of nucleotides & nucleic acids 2.3 BAC72377.1 Non-secretory protein CDS SAVERM_4666 5690937 5692931 ftsH putative cell division protein FtsH PF01434: Peptidase family M41 5.37 71515 R cell division 1.7 BAC72378.1 Non-secretory protein CDS SAVERM_4667 5693074 5693679 folE putative GTP cyclohydrolase I PF01227: GTP cyclohydrolase I 5.16 22265 R metabolism of coenzymes & prosthetic groups 2.5 BAC72379.1 Non-secretory protein CDS SAVERM_4668 5694216 5693728 putative secreted protein 10.83 16705 R similar to unknown proteins 5 BAC72380.1 Non-secretory protein CDS SAVERM_4669 5694881 5694270 folK putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase PF01288: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) 4.45 22108 R metabolism of coenzymes & prosthetic groups 2.5 BAC72381.1 Non-secretory protein CDS SAVERM_4670 5695237 5694878 folB putative dihydroneopterin aldolase PF02152: Dihydroneopterin aldolase 4.78 12993 R metabolism of coenzymes & prosthetic groups 2.5 BAC72382.1 Non-secretory protein CDS SAVERM_4671 5696017 5695508 hypothetical protein 3.8 18160 R similar to unknown proteins 5 BAC72383.1 Non-secretory protein CDS SAVERM_4672 5696946 5696014 folP2 putative dihydropteroate synthase PF00809: Pterin binding enzyme 5.41 32051 R metabolism of coenzymes & prosthetic groups 2.5 BAC72384.1 Non-secretory protein CDS SAVERM_4673 5698959 5697154 putative membrane protein PF04329: Family of unknown function (DUF470) 10.41 65387 R miscellaneous 4.7 BAC72385.1 Non-secretory protein CDS SAVERM_4674 5699189 5700319 putative membrane protein PF00756: Putative esterase 10.37 40719 R miscellaneous 4.7 BAC72386.1 Non-secretory protein CDS SAVERM_4675 5700632 5702176 putative secreted protein 4.33 52726 R similar to unknown proteins 5 BAC72387.1 Non-secretory protein CDS SAVERM_4676 5703649 5702276 hypothetical protein PF03703: Bacterial membrane flanked domain 11.03 49509 R similar to unknown proteins 5 BAC72388.1 Non-secretory protein CDS SAVERM_4677 5704185 5703664 putative integral membrane protein PF03703: Bacterial membrane flanked domain 9.17 18616 R miscellaneous 4.7 BAC72389.1 Non-secretory protein CDS SAVERM_4678 5704217 5705368 nuoD2 putative NADH dehydrogenase I chain D (complex I) PF00346: Respiratory-chain NADH dehydrogenase, 49 Kd subunit 5.8 42567 R membrane bioenergetics 1.4 BAC72390.1 Non-secretory protein CDS SAVERM_4679 5706391 5705333 hypothetical protein PF02636: Uncharacterized ACR, COG1565 4.58 37335 R similar to unknown proteins 5 BAC72391.1 Non-secretory protein CDS SAVERM_4680 5706510 5707715 putative two-component system sensor kinase PF07730: Histidine kinase 6.52 43269 R sensors 1.3 BAC72392.1 Non-secretory protein CDS SAVERM_4681 5707796 5708467 putative two-component system response regulator PF00072: Response regulator receiver domain 5.42 24263 R regulation 3.5.2 BAC72393.1 Non-secretory protein CDS SAVERM_4682 5708500 5709132 putative TmrB-like protein 10.03 23547 R miscellaneous 4.7 BAC72394.1 Non-secretory protein CDS SAVERM_4683 5710263 5709139 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 7.03 40584 R regulation 3.5.2 BAC72395.1 Non-secretory protein CDS SAVERM_4684 5710693 5710565 hypothetical protein 13.15 4657 R no similarity 6 BAC72396.1 Non-secretory protein CDS SAVERM_4685 5712046 5710805 putative L-allo-threonine aldolase PF01212: Beta-eliminating lyase 4.8 44745 R miscellaneous 4.7 BAC72397.1 Non-secretory protein CDS SAVERM_4686 5712219 5713139 hypothetical protein PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 5.14 31201 R similar to unknown proteins 5 BAC72398.1 Non-secretory protein CDS SAVERM_4687 5713136 5714137 panC putative pantoate--beta-alanine ligase pantothenate biosynthesis 6.32 35472 R metabolism of coenzymes & prosthetic groups 2.5 BAC72399.1 Non-secretory protein CDS SAVERM_4688 5714134 5715951 nadB putative L-aspartate oxidase NAD biosynthesis (quinolinate biosynthesis) 5.86 63228 R metabolism of coenzymes & prosthetic groups 2.5 BAC72400.1 Non-secretory protein CDS SAVERM_4689 5715948 5716943 nadC putative nicotinate-nucleotide pyrophosphorylase NAD biosynthesis 4.1 34719 R metabolism of coenzymes & prosthetic groups 2.5 BAC72401.1 Non-secretory protein CDS SAVERM_4690 5716953 5717750 putative Bordetella pertussis Bvg accessory factor family protein PF03309: Bordetella pertussis Bvg accessory factor family 4.35 28143 R miscellaneous 4.7 BAC72402.1 Non-secretory protein CDS SAVERM_4691 5718058 5718780 hypothetical protein 11 24971 R similar to unknown proteins 5 BAC72403.1 Non-secretory protein CDS SAVERM_4692 5718824 5719003 putative secreted protein 4.68 6069 R similar to unknown proteins 5 BAC72404.1 Non-secretory protein CDS SAVERM_4693 5719170 5719703 hypothetical protein PF03965: Penicillinase repressor 4.77 19791 R similar to unknown proteins 5 BAC72405.1 Non-secretory protein CDS SAVERM_4694 5719744 5720286 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.35 20208 R miscellaneous 4.7 BAC72406.1 Non-secretory protein CDS SAVERM_4695 5720536 5720871 putative Lsr2-like protein PF11774: Lsr2 6.89 11828 R miscellaneous 4.7 BAC72407.1 Non-secretory protein CDS SAVERM_4696 5721551 5720850 putative proline-rich protein PF01391: Collagen triple helix repeat (20 copies) 6.35 23828 R miscellaneous 4.7 BAC72408.1 Non-secretory protein CDS SAVERM_4697 5721983 5724508 clpC2 putative ATP-dependent Clp protease PF07724: ATPase family associated with various cellular activities (AAA) 6.03 93024 R adaptation to atypical conditions 4.1 BAC72409.1 Non-secretory protein CDS SAVERM_4698 5727706 5724587 putative large ATP-binding protein PF05729: NACHT domain 6.55 114944 R miscellaneous 4.7 BAC72410.1 Non-secretory protein CDS SAVERM_4699 5728303 5727746 hypothetical protein 12.23 20120 R similar to unknown proteins 5 BAC72411.1 Non-secretory protein CDS SAVERM_4700 5728690 5729301 putative zoocin A PF01551: Peptidase family M23 10.82 20367 R protein modification 3.8 BAC72412.1 Signal peptide CDS SAVERM_4701 5729892 5729317 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.01 21868 R regulation 3.5.2 BAC72413.1 Non-secretory protein CDS SAVERM_4702 5730082 5731695 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 8.82 55551 R transport / binding proteins & lipoproteins 1.2 BAC72414.1 Non-secretory protein CDS SAVERM_4703 5733345 5731882 putative two-component system sensor kinase similar to AfsQ2, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.94 51616 R sensors 1.3 BAC72415.1 Non-secretory protein CDS SAVERM_4704 5734061 5733354 putative two-component system response regulator similar to AfsQ1, PF00072: Response regulator receiver domain 4.64 25633 R regulation 3.5.2 BAC72416.1 Non-secretory protein CDS SAVERM_4705 5734695 5734105 putative secreted protein 4.16 20332 R similar to unknown proteins 5 BAC72417.1 Non-secretory protein CDS SAVERM_4706 5735285 5734746 sig41 putative RNA polymerase ECF-subfamily sigma factor similar to SCO3356:sigE, PF04545: Sigma-70, region 4 5.75 20617 R RNA initiation 3.5.1 BAC72418.1 Non-secretory protein CDS SAVERM_4707 5736562 5735621 mutY putative A/G-specific adenine glycosylase G/C -> T/A transversion, PF00730: HhH-GPD superfamily base excision DNA repair protein 9.19 33986 R DNA modification & repair 3.2 BAC72419.1 Non-secretory protein CDS SAVERM_4708 5737512 5737886 hypothetical protein 8.02 13065 R similar to unknown proteins 5 BAC72420.1 Non-secretory protein CDS SAVERM_4709 5739284 5738160 putative DNA-binding protein PF02457: Domain of unknown function DUF147 5 40020 R regulation 3.5.2 BAC72421.1 Non-secretory protein CDS SAVERM_4710 5740775 5739366 radA putative DNA repair protein PF03796: DnaB-like helicase C terminal domain 8.15 49852 R DNA modification & repair 3.2 BAC72422.1 Non-secretory protein CDS SAVERM_4711 5741117 5742865 putative alanine-rich protein 8.25 61240 R miscellaneous 4.7 BAC72423.1 Non-secretory protein CDS SAVERM_4712 5743761 5742892 hypothetical protein 5.88 32002 R similar to unknown proteins 5 BAC72424.1 Signal peptide CDS SAVERM_4713 5743833 5744765 ppx2 putative exopolyphosphatase PF02541: Ppx/GppA phosphatase family 5.01 33006 R miscellaneous 4.7 BAC72425.1 Non-secretory protein CDS SAVERM_4714 5745258 5746067 hypothetical protein PF01261: AP endonuclease family 2 7.37 30493 R similar to unknown proteins 5 BAC72426.1 Non-secretory protein CDS SAVERM_4715 5746064 5746681 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.82 22065 R regulation 3.5.2 BAC72427.1 Non-secretory protein CDS SAVERM_4716 5746979 5748832 ilvD1 putative dihydroxy-acid dehydratase PF00920: Dehydratase family 4.95 65370 R metabolism of amino acids & related molecules 2.2 BAC72428.1 Non-secretory protein CDS SAVERM_4717 5751157 5748959 pkn16 putative serine/threonine protein kinase AfsK homolog, PF01011: PQQ enzyme repeat, PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 9.44 76174 R protein modification 3.8 BAC72429.1 Non-secretory protein CDS SAVERM_4718 5751260 5751604 hypothetical protein PF08239: Bacterial SH3 domain 4.37 11944 R similar to unknown proteins 5 BAC72430.1 Non-secretory protein CDS SAVERM_4719 5751675 5752259 hypothetical protein 8.86 20766 R similar to unknown proteins 5 BAC72431.1 Non-secretory protein CDS SAVERM_4720 5752401 5753033 hypothetical protein PF08241: Methyltransferase domain 5.55 22457 R similar to unknown proteins 5 BAC72432.1 Non-secretory protein CDS SAVERM_4721 5754560 5753085 putative transmembrane sulfate transport protein PF00916: Sulfate transporter family 10.22 49716 R transport / binding proteins & lipoproteins 1.2 BAC72433.1 Non-secretory protein CDS SAVERM_4722 5754929 5755756 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.25 28992 R transport / binding proteins & lipoproteins 1.2 BAC72434.1 Non-secretory protein CDS SAVERM_4723 5755753 5756544 putative ABC transporter permease protein PF01061: ABC-2 type transporter 8.5 27922 R transport / binding proteins & lipoproteins 1.2 BAC72435.1 Non-secretory protein CDS SAVERM_4724 5756668 5757477 proC putative pyrroline-5-carboxylate reductase PF03807: NADP oxidoreductase coenzyme F420-dependent 6.31 28158 R metabolism of amino acids & related molecules 2.2 BAC72436.1 Non-secretory protein CDS SAVERM_4725 5758491 5757496 trpS2 putative tryptophanyl-tRNA synthetase indolemycin resistance, PF00579: tRNA synthetases class I (W and Y) 7 36516 R aminoacyl-tRNA-synthetase 3.7.2 BAC72437.1 Non-secretory protein CDS SAVERM_4726 5764588 5765232 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.51 23383 I miscellaneous 4.7 BAC72438.1 Non-secretory protein CDS SAVERM_4727 5765381 5766082 putative membrane protein 10.34 24327 I miscellaneous 4.7 BAC72439.1 Non-secretory protein CDS SAVERM_4728 5766176 5767387 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 9.98 42245 I miscellaneous 4.7 BAC72440.1 Non-secretory protein CDS SAVERM_4729 5767407 5768510 acuC putative acetoin dehydrogenase PF00850: Histone deacetylase domain 4.99 39472 I specific pathways 2.1.1 BAC72441.1 Non-secretory protein CDS SAVERM_4730 5768693 5769508 hypothetical protein 5.56 28921 I similar to unknown proteins 5 BAC72442.1 Non-secretory protein CDS SAVERM_4731 5769605 5769850 hypothetical protein 8.76 9050 I similar to unknown proteins 5 BAC72443.1 Non-secretory protein CDS SAVERM_4732 5770447 5771496 putative NAD-dependent epimerase/dehydratase PF01370: NAD dependent epimerase/dehydratase family 9.83 37349 I miscellaneous 4.7 BAC72444.1 Non-secretory protein CDS SAVERM_4733 5771511 5772557 putative acyltransferase PF01553: Acyltransferase 7.66 38546 I miscellaneous 4.7 BAC72445.1 Non-secretory protein CDS SAVERM_4734 5773852 5772617 rsbN putative anti-sigma factor 6.36 42284 I similar to unknown proteins 5 BAC72446.1 Non-secretory protein CDS SAVERM_4735 5774926 5774150 bds putative RNA polymerase ECF-subfamily sigma factor (BldN) sig42 (similar to SCO3323), gamma-butyrolactone-dependent extracytoplasmic function sigma factor, PF04542: Sigma-70 region 2 8.63 28220 I RNA initiation 3.5.1 BAC72447.1 Non-secretory protein CDS SAVERM_4736 5776235 5775345 serB1 putative 3-phosphoserine phosphatase PF00702: haloacid dehalogenase-like hydrolase 6.87 31985 I metabolism of amino acids & related molecules 2.2 BAC72448.1 Non-secretory protein CDS SAVERM_4737 5776429 5776737 putative redoxin PF05768: Glutaredoxin-like domain (DUF836) 6.77 11692 I miscellaneous 4.7 BAC72449.1 Non-secretory protein CDS SAVERM_4738 5777053 5777811 rex putative redox-sensing transcriptional repressor PF06971: Putative DNA-binding protein C-terminus 5.1 26087 I regulation 3.5.2 BAC72450.1 Non-secretory protein CDS SAVERM_4739 5777808 5779517 hemA putative glutamyl-tRNA reductase PF05201: Glutamyl-tRNAGlu reductase, N-terminal domain 4.71 59320 I metabolism of coenzymes & prosthetic groups 2.5 BAC72451.1 Non-secretory protein CDS SAVERM_4740 5779514 5780488 hemC1 putative porphobilinogen deaminase PF01379: Porphobilinogen deaminase, dipyromethane cofactor binding domain 4.66 33772 I metabolism of coenzymes & prosthetic groups 2.5 BAC72452.1 Non-secretory protein CDS SAVERM_4741 5780485 5782200 hemD putative uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase PF02602: Uroporphyrinogen-III synthase HemD 5.78 59683 I metabolism of coenzymes & prosthetic groups 2.5 BAC72453.1 Non-secretory protein CDS SAVERM_4742 5782340 5783332 hemB putative 5-aminolevulinic acid dehydratase PF00490: Delta-aminolevulinic acid dehydratase 4.65 35618 I metabolism of coenzymes & prosthetic groups 2.5 BAC72454.1 Non-secretory protein CDS SAVERM_4743 5784094 5783378 hypothetical protein 9.76 24424 I similar to unknown proteins 5 BAC72455.1 Non-secretory protein CDS SAVERM_4744 5784150 5785505 putative DNA-binding protein PF01381: Helix-turn-helix 5.04 46934 I regulation 3.5.2 BAC72456.1 Non-secretory protein CDS SAVERM_4745 5785614 5786516 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.74 33065 I similar to unknown proteins 5 BAC72457.1 Non-secretory protein CDS SAVERM_4746 5787516 5786563 putative phosphotransferase PF01636: Phosphotransferase enzyme family 5.95 35496 I miscellaneous 4.7 BAC72458.1 Non-secretory protein CDS SAVERM_4747 5788565 5787654 hypothetical protein 4.18 32194 I similar to unknown proteins 5 BAC72459.1 Non-secretory protein CDS SAVERM_4748 5790500 5788728 argS2 putative arginyl-tRNA synthetase PF00750: tRNA synthetases class I (R) 4.94 65188 I aminoacyl-tRNA-synthetase 3.7.2 BAC72460.1 Non-secretory protein CDS SAVERM_4749 5790745 5792391 lysS1 putative lysyl-tRNA synthetase PF01921: tRNA synthetases class I (K) 5.31 60119 I aminoacyl-tRNA-synthetase 3.7.2 BAC72461.1 Non-secretory protein CDS SAVERM_4750 5793820 5792501 putative membrane protein 4.91 48343 I miscellaneous 4.7 BAC72462.1 Non-secretory protein CDS SAVERM_4751 5794936 5793986 hypothetical protein 8.93 32787 I similar to unknown proteins 5 BAC72463.1 Non-secretory protein CDS SAVERM_4752 5795966 5795091 putative secreted protein 4.2 29770 I similar to unknown proteins 5 BAC72464.1 Signal peptide CDS SAVERM_4753 5796203 5797396 hypothetical protein PF01139: Uncharacterized protein family UPF0027 8.35 43592 I similar to unknown proteins 5 BAC72465.1 Non-secretory protein CDS SAVERM_4754 5797877 5797440 hypothetical protein 9.93 16450 I no similarity 6 BAC72466.1 Non-secretory protein CDS SAVERM_4755 5799323 5798544 putative dehydrogenase PF00106: short chain dehydrogenase 5.62 26623 I miscellaneous 4.7 BAC72467.1 Non-secretory protein CDS SAVERM_4756 5799772 5799434 hypothetical protein PF02694: Uncharacterized BCR, YnfA/UPF0060 family 7.35 11920 I similar to unknown proteins 5 BAC72468.1 Non-secretory protein CDS SAVERM_4757 5799890 5800381 putative MarR-family transcriptional regulator PF01047: MarR family 6.8 18157 I regulation 3.5.2 BAC72469.1 Non-secretory protein CDS SAVERM_4758 5800819 5800409 putative transcriptional regulator PF01638: Transcriptional regulator 7.42 15267 I regulation 3.5.2 BAC72470.1 Non-secretory protein CDS SAVERM_4759 5800956 5801834 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.66 28920 I miscellaneous 4.7 BAC72471.1 Non-secretory protein CDS SAVERM_4760 5803312 5801897 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.53 48104 I transport / binding proteins & lipoproteins 1.2 BAC72472.1 Non-secretory protein CDS SAVERM_4761 5803321 5803845 hypothetical protein PF00583: Acetyltransferase (GNAT) family 8.49 18838 I similar to unknown proteins 5 BAC72473.1 Non-secretory protein CDS SAVERM_4762 5804751 5803942 putative AraC-family transcriptional regulator PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.73 29706 I regulation 3.5.2 BAC72474.1 Non-secretory protein CDS SAVERM_4763 5804947 5806041 putative monooxygenase PF00296: Luciferase-like monooxygenase 5.39 40561 I miscellaneous 4.7 BAC72475.1 Non-secretory protein CDS SAVERM_4764 5806041 5806769 putative NAD(P)H-dependent FMN reductase PF03358: NADPH-dependent FMN reductase 6.53 24783 I metabolism of coenzymes & prosthetic groups 2.5 BAC72476.1 Signal peptide CDS SAVERM_4765 5808941 5806803 putative membrane protein PF03929: PepSY-associated TM helix 11.78 74215 I miscellaneous 4.7 BAC72477.1 Non-secretory protein CDS SAVERM_4766 5810263 5808938 putative glycosyltransferase PF00534: Glycosyl transferases group 1 10.58 48696 I specific pathways 2.1.1 BAC72478.1 Signal peptide CDS SAVERM_4767 5810406 5811143 putative two-component system response regulator PF00072: Response regulator receiver domain 5.03 26959 I regulation 3.5.2 BAC72479.1 Non-secretory protein CDS SAVERM_4768 5811144 5812799 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.75 58623 I sensors 1.3 BAC72480.1 Signal peptide CDS SAVERM_4769 5814837 5812840 putative amino acid transporter PF03023: MviN-like protein 8.14 71927 I miscellaneous 4.7 BAC72481.1 Non-secretory protein CDS SAVERM_4770 5815106 5815591 putative membrane protein 11.8 17676 I miscellaneous 4.7 BAC72482.1 Non-secretory protein CDS SAVERM_4771 5815897 5816517 hypothetical protein 9.7 22865 I similar to unknown proteins 5 BAC72483.1 Non-secretory protein CDS SAVERM_4772 5817148 5816453 putative DJ-1/PfpI-family transcriptional regulator PF01965: DJ-1/PfpI family 4.53 23875 I regulation 3.5.2 BAC72484.1 Non-secretory protein CDS SAVERM_4773 5817276 5818232 abaB2 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.73 33826 I regulation 3.5.2 BAC72485.1 Non-secretory protein CDS SAVERM_4774 5820326 5818290 putative amino acid permease PF00324: Amino acid permease 10.25 73300 I transport / binding proteins & lipoproteins 1.2 BAC72486.1 Non-secretory protein CDS SAVERM_4775 5821132 5820572 hypothetical protein PF00583: Acetyltransferase (GNAT) family 5.7 20871 I similar to unknown proteins 5 BAC72487.1 Non-secretory protein CDS SAVERM_4776 5821553 5821756 cspD5 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.54 7220 I adaptation to atypical conditions 4.1 BAC72488.1 Non-secretory protein CDS SAVERM_4777 5822881 5822204 putative secreted protein Tat substrate, PF03713: Domain of unknown function (DUF305) 6.72 23228 I similar to unknown proteins 5 BAC72489.1 Signal peptide CDS SAVERM_4778 5823455 5822982 putative secreted protein 10.72 15954 I no similarity 6 BAC72490.1 Signal peptide CDS SAVERM_4779 5824519 5823653 putative haloalkane dehalogenase PF00561: alpha/beta hydrolase fold 5.75 31618 I miscellaneous 4.7 BAC72491.1 Non-secretory protein CDS SAVERM_4780 5824983 5824531 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 11.41 15948 I similar to unknown proteins 5 BAC72492.1 Non-secretory protein CDS SAVERM_4781 5825858 5825037 hypothetical protein PF05368: NmrA-like family 6.06 28834 I similar to unknown proteins 5 BAC72493.1 Non-secretory protein CDS SAVERM_4782 5825957 5826550 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.81 21724 I regulation 3.5.2 BAC72494.1 Non-secretory protein CDS SAVERM_4783 5826781 5827365 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.95 20247 I regulation 3.5.2 BAC72495.1 Non-secretory protein CDS SAVERM_4784 5827528 5828130 hypothetical protein 6.27 21836 I similar to unknown proteins 5 BAC72496.1 Non-secretory protein CDS SAVERM_4785 5828137 5828376 putative secreted protein 7.93 8583 I similar to unknown proteins 5 BAC72497.1 Non-secretory protein CDS SAVERM_4786 5828339 5828806 hypothetical protein 4.89 16563 I similar to unknown proteins 5 BAC72498.1 Non-secretory protein CDS SAVERM_4787 5829173 5829550 putative anti-sigma factor antagonist PF01740: STAS domain 6.96 13279 I regulation 3.5.2 BAC72499.1 Non-secretory protein CDS SAVERM_4788 5829547 5830257 hypothetical protein 9.31 26322 I similar to unknown proteins 5 BAC72500.1 Non-secretory protein CDS SAVERM_4789 5831214 5830360 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.92 30899 I similar to unknown proteins 5 BAC72501.1 Non-secretory protein CDS SAVERM_4790 5832210 5831272 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.17 33307 I regulation 3.5.2 BAC72502.1 Non-secretory protein CDS SAVERM_4791 5832251 5833252 hypothetical protein PF00892: Integral membrane protein DUF6 11.23 34322 I similar to unknown proteins 5 BAC72503.1 Non-secretory protein CDS SAVERM_4792 5833276 5833944 hypothetical protein PF01118: Semialdehyde dehydrogenase, NAD binding domain 4.92 23262 I similar to unknown proteins 5 BAC72504.1 Non-secretory protein CDS SAVERM_4793 5834450 5834013 hypothetical protein 5.15 15842 I similar to unknown proteins 5 BAC72505.1 Non-secretory protein CDS SAVERM_4794 5834609 5835223 hypothetical protein 12.58 22599 I similar to unknown proteins 5 BAC72506.1 Non-secretory protein CDS SAVERM_4795 5835211 5836527 hemL putative glutamate-1-semialdehyde 2,1-aminotransferase PF00202: Aminotransferase class-III 5.24 45776 I metabolism of coenzymes & prosthetic groups 2.5 BAC72507.1 Non-secretory protein CDS SAVERM_4796 5836524 5837216 putative phosphoglycerate mutase PF00300: Phosphoglycerate mutase family 8.28 25385 I main glycolytic pathways 2.1.2 BAC72508.1 Non-secretory protein CDS SAVERM_4797 5837392 5838669 putative secreted protein Tat substrate, PF01522: Polysaccharide deacetylase 9.14 46509 I similar to unknown proteins 5 BAC72509.1 Non-secretory protein CDS SAVERM_4798 5838736 5839368 resA putative cytochrome c biogenesis protein PF08534: Redoxin 10.09 22164 I membrane bioenergetics 1.4 BAC72510.1 Signal peptide CDS SAVERM_4799 5839375 5840157 ccsA putative cytochrome C biogenesis membrane protein PF02683: Cytochrome C biogenesis protein transmembrane region 9.14 27418 I membrane bioenergetics 1.4 BAC72511.1 Non-secretory protein CDS SAVERM_4800 5840161 5841948 resB putative cytochrome C biogenesis membrane protein PF05140: ResB-like family 9.19 63891 I membrane bioenergetics 1.4 BAC72512.1 Non-secretory protein CDS SAVERM_4801 5841945 5843021 ccsB putative cytochrome C assembly protein PF01578: Cytochrome C assembly protein 9.57 38578 I membrane bioenergetics 1.4 BAC72513.1 Non-secretory protein CDS SAVERM_4802 5843152 5843637 hypothetical protein PF08327: Activator of Hsp90 ATPase homolog 1-like protein 6.9 17622 I no similarity 6 BAC72514.1 Non-secretory protein CDS SAVERM_4803 5845208 5843661 hypothetical protein PF01094: Receptor family ligand binding region 9.97 55573 I no similarity 6 BAC72515.1 Non-secretory protein CDS SAVERM_4804 5847307 5845208 hypothetical protein 6.69 75538 I no similarity 6 BAC72516.1 Non-secretory protein CDS SAVERM_4805 5848410 5847436 putative iron/ascorbate-dependent oxidoreductase PF03171: 2OG-Fe(II) oxygenase superfamily 4.54 35576 I miscellaneous 4.7 BAC72517.1 Non-secretory protein CDS SAVERM_4806 5848864 5848403 cdd4 putative cytidine/deoxycytidine deaminase PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region 4.94 16522 I metabolism of nucleotides & nucleic acids 2.3 BAC72518.1 Non-secretory protein CDS SAVERM_4807 5849545 5849102 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 7.16 15995 I miscellaneous 4.7 BAC72519.1 Non-secretory protein CDS SAVERM_4808 5850085 5849693 putative membrane protein 5.05 14995 I miscellaneous 4.7 BAC72520.1 Non-secretory protein CDS SAVERM_4809 5850173 5851624 ubiX putative decarboxylase PF01977: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 6.47 53824 I miscellaneous 4.7 BAC72521.1 Non-secretory protein CDS SAVERM_4810 5851621 5852526 ubiA putative 4-hydroxybenzoate octaprenyltransferase PF01040: UbiA prenyltransferase family 8.93 32736 I metabolism of coenzymes & prosthetic groups 2.5 BAC72522.1 Non-secretory protein CDS SAVERM_4811 5852782 5853447 ubiD putative 3-octaprenyl-4-hydroxybenzoate carboxy-lyase PF02441: Flavoprotein 6.4 23274 I metabolism of coenzymes & prosthetic groups 2.5 BAC72523.1 Non-secretory protein CDS SAVERM_4812 5853523 5853978 putative AsnC-family transcriptional regulator PF01037: AsnC family 4.73 16429 I regulation 3.5.2 BAC72524.1 Non-secretory protein CDS SAVERM_4813 5854065 5855228 cofH1 putative 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2 PF04055: Radical SAM superfamily 6.51 44445 I miscellaneous 4.7 BAC72525.1 Non-secretory protein CDS SAVERM_4814 5855236 5855772 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.93 19232 I miscellaneous 4.7 BAC72526.1 Non-secretory protein CDS SAVERM_4815 5855867 5856166 putative membrane protein 9.2 10821 I miscellaneous 4.7 BAC72527.1 Non-secretory protein CDS SAVERM_4816 5856259 5856900 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 8.5 22872 I regulation 3.5.2 BAC72528.1 Non-secretory protein CDS SAVERM_4817 5857854 5856928 putative MaoC-like dehydratase PF01575: MaoC like domain 10.62 33271 I miscellaneous 4.7 BAC72529.1 Non-secretory protein CDS SAVERM_4818 5858175 5860091 fadD10 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.46 68567 I metabolism of lipids 2.4 BAC72530.1 Non-secretory protein CDS SAVERM_4819 5860168 5860665 putative secreted protein Tat substrate 8.86 17207 I similar to unknown proteins 5 BAC72531.1 Non-secretory protein CDS SAVERM_4820 5860982 5860779 cspD6 putative cold shock protein PF00313: 'Cold-shock' DNA-binding domain 4.48 7119 I adaptation to atypical conditions 4.1 BAC72532.1 Non-secretory protein CDS SAVERM_4821 5861326 5862174 mqnA putative chorismate futalosine-lyase (menaquinone biosynthetic protein) PF02621: Uncharacterized ACR, COG1427 4.92 31131 I similar to unknown proteins 5 BAC72533.1 Non-secretory protein CDS SAVERM_4822 5862253 5864004 pkn17 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 4.93 58766 I protein modification 3.8 BAC72534.1 Non-secretory protein CDS SAVERM_4823 5864677 5863997 hypothetical protein 12.24 23398 I no similarity 6 BAC72535.1 Non-secretory protein CDS SAVERM_4824 5864704 5865447 pilD putative leader peptidase (prepilin peptidase) / N-methyltransferase Type II secretion system, PF01478: Type IV leader peptidase family 7.84 25421 I protein secretion 1.6 BAC72536.1 Non-secretory protein CDS SAVERM_4825 5865567 5866766 mqnC putative de-hypoxanthine futalosine synthase (menaquinone biosynthetic protein) PF04055: Radical SAM superfamily 6.33 44232 I miscellaneous 4.7 BAC72537.1 Non-secretory protein CDS SAVERM_4826 5866774 5867223 hypothetical protein 8.78 16001 I similar to unknown proteins 5 BAC72538.1 Non-secretory protein CDS SAVERM_4827 5868304 5867255 putative sugar hydrolase, secreted PF00704: Glycosyl hydrolases family 18 3.87 35432 I miscellaneous 4.7 BAC72539.1 Signal peptide CDS SAVERM_4828 5868612 5869004 putative membrane protein 11.58 12757 I miscellaneous 4.7 BAC72540.1 Non-secretory protein CDS SAVERM_4829 5869025 5871397 putative polysaccharide deacetylase/glycosyltransferase PF01522: Polysaccharide deacetylase 9.76 85819 I cell wall 1.1 BAC72541.1 Non-secretory protein CDS SAVERM_4830 5871397 5872812 hypothetical protein PF01757: Acyltransferase family 8.66 53082 I similar to unknown proteins 5 BAC72542.1 Non-secretory protein CDS SAVERM_4831 5872885 5873580 menG putative ubiquinone/menaquinone methyltransferase PF01209: ubiE/COQ5 methyltransferase family 9.58 25620 I metabolism of coenzymes & prosthetic groups 2.5 BAC72543.1 Non-secretory protein CDS SAVERM_4832 5873712 5876213 hypothetical protein PF03884: Domain of unknown function (DUF329) 5.05 84429 I similar to unknown proteins 5 BAC72544.1 Non-secretory protein CDS SAVERM_4833 5876553 5876206 hypothetical protein PF03793: PASTA domain 5.73 12189 I similar to unknown proteins 5 BAC72545.1 Non-secretory protein CDS SAVERM_4834 5877144 5876638 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.89 18964 I miscellaneous 4.7 BAC72546.1 Non-secretory protein CDS SAVERM_4835 5877245 5878549 putative electron transfer oxidoreductase PF01494: FAD binding domain 7.65 47460 I miscellaneous 4.7 BAC72547.1 Non-secretory protein CDS SAVERM_4836 5879617 5878799 putative NLP/P60-family secreted protein (PgpA peptidase) Seems to have no N-terminal signal sequence, PF00877: NlpC/P60 family 9.94 27296 I miscellaneous 4.7 BAC72548.1 Signal peptide CDS SAVERM_4837 5880403 5880762 nuoA1 putative NADH dehydrogenase I chain A (complex I) PF00507: NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 4.96 13227 I membrane bioenergetics 1.4 BAC72549.1 Non-secretory protein CDS SAVERM_4838 5880778 5881332 nuoB1 putative NADH dehydrogenase I chain B (complex I) PF01058: NADH ubiquinone oxidoreductase, 20 Kd subunit 7.93 19996 I membrane bioenergetics 1.4 BAC72550.1 Non-secretory protein CDS SAVERM_4839 5881329 5882075 nuoC putative NADH dehydrogenase I chain C (complex I) PF00329: Respiratory-chain NADH dehydrogenase, 30 Kd subunit 4.74 27538 I membrane bioenergetics 1.4 BAC72551.1 Non-secretory protein CDS SAVERM_4840 5882072 5883403 nuoD1 putative NADH dehydrogenase I chain D (complex I) PF00346: Respiratory-chain NADH dehydrogenase, 49 Kd subunit 5.45 48617 I membrane bioenergetics 1.4 BAC72552.1 Non-secretory protein CDS SAVERM_4841 5883400 5884263 nuoE putative NADH dehydrogenase I chain E (complex I) PF01257: Respiratory-chain NADH dehydrogenase 24 Kd subunit 4.46 30387 I membrane bioenergetics 1.4 BAC72553.1 Non-secretory protein CDS SAVERM_4842 5884260 5885609 nuoF1 putative NADH dehydrogenase I chain F (complex I) PF01512: Respiratory-chain NADH dehydrogenase 51 Kd subunit 5.78 49046 I membrane bioenergetics 1.4 BAC72554.1 Non-secretory protein CDS SAVERM_4843 5885606 5888110 nuoG1 putative NADH dehydrogenase I chain G (complex I) PF00384: Molybdopterin oxidoreductase 5.5 87713 I membrane bioenergetics 1.4 BAC72555.1 Non-secretory protein CDS SAVERM_4844 5888107 5889471 nuoH1 putative NADH dehydrogenase I chain H (complex I) PF00146: NADH dehydrogenase 6.16 50270 I membrane bioenergetics 1.4 BAC72556.1 Non-secretory protein CDS SAVERM_4845 5889464 5890066 nuoI1 putative NADH dehydrogenase I chain I (complex I) PF00037: 4Fe-4S binding domain 4.59 22277 I membrane bioenergetics 1.4 BAC72557.1 Non-secretory protein CDS SAVERM_4846 5890063 5890905 nuoJ1 putative NADH dehydrogenase I chain J (complex I) PF00499: NADH-ubiquinone/plastoquinone oxidoreductase chain 6 8.06 30114 I membrane bioenergetics 1.4 BAC72558.1 Non-secretory protein CDS SAVERM_4847 5890902 5891201 nuoK1 putative NADH dehydrogenase I chain K (complex I) PF00420: NADH-ubiquinone/plastoquinone oxidoreductase chain 4L 8.24 10704 I membrane bioenergetics 1.4 BAC72559.1 Non-secretory protein CDS SAVERM_4848 5891215 5893119 nuoL1 putative NADH dehydrogenase I chain L (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 8.88 67370 I membrane bioenergetics 1.4 BAC72560.1 Non-secretory protein CDS SAVERM_4849 5893125 5894723 nuoM1 putative NADH dehydrogenase I chain M (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 9.04 56965 I membrane bioenergetics 1.4 BAC72561.1 Signal peptide CDS SAVERM_4850 5894720 5896348 nuoN1 putative NADH dehydrogenase I chain N (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 9.04 56141 I membrane bioenergetics 1.4 BAC72562.1 Non-secretory protein CDS SAVERM_4851 5896755 5898731 recQ putative ATP-dependent DNA helicase PF00270: DEAD/DEAH box helicase 4.97 71552 I DNA recombination 3.3 BAC72563.1 Non-secretory protein CDS SAVERM_4852 5901629 5898810 putative oxidoreductase PF00890: FAD binding domain 5.44 99375 I miscellaneous 4.7 BAC72564.1 Non-secretory protein CDS SAVERM_4853 5902507 5901695 ssuB5 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein, PF00005: ABC transporter 10.96 28150 I transport / binding proteins & lipoproteins 1.2 BAC72565.1 Non-secretory protein CDS SAVERM_4854 5903357 5902488 ssuC5 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 9.65 30985 I transport / binding proteins & lipoproteins 1.2 BAC72566.1 Non-secretory protein CDS SAVERM_4855 5904700 5903354 ssuA5 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding protein, PF09084: NMT1/THI5 like 10.03 46548 I transport / binding proteins & lipoproteins 1.2 BAC72567.1 Signal peptide CDS SAVERM_4856 5904943 5904716 fdxE putative ferredoxin PF00037: 4Fe-4S binding domain 4.18 8139 I membrane bioenergetics 1.4 BAC72568.1 Non-secretory protein CDS SAVERM_4857 5905797 5905018 putative GntR-family transcriptional regulator PF07702: UTRA domain 8.07 28096 I regulation 3.5.2 BAC72569.1 Non-secretory protein CDS SAVERM_4858 5907392 5906169 fahA putative fumarylacetoacetase PF01557: Fumarylacetoacetate (FAA) hydrolase family 4.88 43479 I metabolism of amino acids & related molecules 2.2 BAC72570.1 Non-secretory protein CDS SAVERM_4859 5907567 5908856 hypothetical protein 9.34 47795 I similar to unknown proteins 5 BAC72571.1 Non-secretory protein CDS SAVERM_4860 5908906 5910108 putative oxidoreductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 9.94 42747 I miscellaneous 4.7 BAC72572.1 Non-secretory protein CDS SAVERM_4861 5910408 5911220 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.53 28352 I similar to unknown proteins 5 BAC72573.1 Non-secretory protein CDS SAVERM_4862 5911714 5911238 putative secreted protein PF01464: Transglycosylase SLT domain 8.42 16335 I similar to unknown proteins 5 BAC72574.1 Signal peptide CDS SAVERM_4863 5914278 5912224 hypothetical protein PF02129: Pro dipeptidyl-peptidase (S15 family) 5.18 76103 I similar to unknown proteins 5 BAC72575.1 Non-secretory protein CDS SAVERM_4864 5914570 5915580 grcC putative polyprenyl diphosphate synthase probably geranylgeranyl pyrophosphate synthase, PF00348: Polyprenyl synthetase 4.58 35852 I metabolism of coenzymes & prosthetic groups 2.5 BAC72576.1 Non-secretory protein CDS SAVERM_4865 5915733 5916761 putative secreted protein 10.47 34519 I similar to unknown proteins 5 BAC72577.1 Signal peptide CDS SAVERM_4866 5917037 5918266 hypothetical protein PF03548: Outer membrane lipoprotein carrier protein LolA 4.78 41371 I similar to unknown proteins 5 BAC72578.1 Non-secretory protein CDS SAVERM_4867 5918301 5919341 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.83 35892 I transport / binding proteins & lipoproteins 1.2 BAC72579.1 Non-secretory protein CDS SAVERM_4868 5919328 5920221 putative ABC transporter permease protein PF01061: ABC-2 type transporter 8.45 30985 I transport / binding proteins & lipoproteins 1.2 BAC72580.1 Non-secretory protein CDS SAVERM_4869 5920842 5920258 hypothetical protein PF02525: Flavodoxin-like fold 6.24 21267 I similar to unknown proteins 5 BAC72581.1 Non-secretory protein CDS SAVERM_4870 5921746 5921048 hypothetical protein 11.9 25043 I similar to unknown proteins 5 BAC72582.1 Non-secretory protein CDS SAVERM_4871 5921949 5923703 hypothetical protein 5.26 59261 I similar to unknown proteins 5 BAC72583.1 Non-secretory protein CDS SAVERM_4872 5924788 5923841 lap putative leucyl aminopeptidase, secreted (aminopeptidase S) PF04389: Peptidase family M28 6.51 32534 I protein modification 3.8 BAC72584.1 Signal peptide CDS SAVERM_4873 5925895 5924915 hypothetical protein PF00892: Integral membrane protein DUF6 10.18 35005 I similar to unknown proteins 5 BAC72585.1 Non-secretory protein CDS SAVERM_4874 5926882 5926028 hypothetical protein PF01113: Dihydrodipicolinate reductase, N-terminus 4.67 29040 I similar to unknown proteins 5 BAC72586.1 Non-secretory protein CDS SAVERM_4875 5926972 5927445 putative transcriptional regulator PF01638: Transcriptional regulator 9.79 17198 I regulation 3.5.2 BAC72587.1 Non-secretory protein CDS SAVERM_4876 5928538 5927459 korB putative 2-oxoglutarate ferredoxin oxidoreductase, beta subunit PF02775: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 6.29 38528 I TCA cycle 2.1.3 BAC72588.1 Non-secretory protein CDS SAVERM_4877 5930459 5928531 korA putative 2-oxoglutarate ferredoxin oxidoreductase, alpha subunit PF01855: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain 4.98 68704 I TCA cycle 2.1.3 BAC72589.1 Non-secretory protein CDS SAVERM_4878 5931417 5930746 putative two-component system response regulator PF00072: Response regulator receiver domain 5.17 24113 I regulation 3.5.2 BAC72590.1 Non-secretory protein CDS SAVERM_4879 5933289 5931931 putative two-component system sensor kinase PF07730: Histidine kinase 6.8 48792 I sensors 1.3 BAC72591.1 Non-secretory protein CDS SAVERM_4880 5934899 5933658 putative two-component system sensor kinase PF07730: Histidine kinase 6.02 44640 I sensors 1.3 BAC72592.1 Non-secretory protein CDS SAVERM_4881 5935153 5935593 nuoA2 putative NADH dehydrogenase I chain A (complex I) similar to many chloroplastic ubiquinone dehydrogenase, PF00507: NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 6.06 15601 I metabolism of coenzymes & prosthetic groups 2.5 BAC72593.1 Non-secretory protein CDS SAVERM_4882 5935584 5936195 nuoB2 putative NADH dehydrogenase I chain B (complex I) similar to many eukaryotic ubiquinone dehydrogenase, PF01058: NADH ubiquinone oxidoreductase, 20 Kd subunit 8.46 21896 I metabolism of coenzymes & prosthetic groups 2.5 BAC72594.1 Non-secretory protein CDS SAVERM_4883 5936192 5937706 putative NADH dehydrogenase (complex I) PF00329: Respiratory-chain NADH dehydrogenase, 30 Kd subunit 4.72 51187 I miscellaneous 4.7 BAC72595.1 Non-secretory protein CDS SAVERM_4884 5937703 5938671 nuoH2 putative NADH dehydrogenase I chain H (complex I) PF00146: NADH dehydrogenase 5.64 34630 I membrane bioenergetics 1.4 BAC72596.1 Non-secretory protein CDS SAVERM_4885 5938674 5939324 nuoI2 putative NADH dehydrogenase I chain I (complex I) PF00037: 4Fe-4S binding domain 4.37 23187 I membrane bioenergetics 1.4 BAC72597.1 Non-secretory protein CDS SAVERM_4886 5939321 5939944 nuoJ2 putative NADH dehydrogenase I chain J (complex I) PF00499: NADH-ubiquinone/plastoquinone oxidoreductase chain 6 6.8 21309 I membrane bioenergetics 1.4 BAC72598.1 Non-secretory protein CDS SAVERM_4887 5939944 5940333 nuoK2 putative NADH dehydrogenase I chain K (complex I) PF00420: NADH-ubiquinone/plastoquinone oxidoreductase chain 4L 4.75 13478 I membrane bioenergetics 1.4 BAC72599.1 Non-secretory protein CDS SAVERM_4888 5940330 5942321 nuoL2 putative NADH dehydrogenase I chain L (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 7.2 68419 I membrane bioenergetics 1.4 BAC72600.1 Signal peptide CDS SAVERM_4889 5942328 5943911 nuoM2 putative NADH dehydrogenase I chain M (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 8.99 55067 I membrane bioenergetics 1.4 BAC72601.1 Non-secretory protein CDS SAVERM_4890 5943908 5945407 nuoN2 putative NADH dehydrogenase I chain N (complex I) PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 8.05 51783 I membrane bioenergetics 1.4 BAC72602.1 Non-secretory protein CDS SAVERM_4891 5945620 5946483 htpX1 putative heat shock protein, protease PF01435: Peptidase family M48 10.13 31270 I protein modification 3.8 BAC72603.1 Non-secretory protein CDS SAVERM_4892 5946480 5946872 putative membrane protein PF03733: Domain of unknown function (DUF307) 8.89 14240 I miscellaneous 4.7 BAC72604.1 Non-secretory protein CDS SAVERM_4893 5946999 5947565 hypothetical protein PF09346: SMI1 / KNR4 family 4.07 20780 I similar to unknown proteins 5 BAC72605.1 Non-secretory protein CDS SAVERM_4894 5948902 5947634 putative amino acid transporter PF00324: Amino acid permease 10.58 41237 I transport / binding proteins & lipoproteins 1.2 BAC72606.1 Non-secretory protein CDS SAVERM_4895 5949050 5949316 hypothetical protein PF04226: Transglycosylase associated protein 10.44 9299 I similar to unknown proteins 5 BAC72607.1 Non-secretory protein CDS SAVERM_4896 5949946 5949458 hypothetical protein PF04461: Protein of unknown function (DUF520) 5.42 18010 I similar to unknown proteins 5 BAC72608.1 Non-secretory protein CDS SAVERM_4897 5953648 5952467 putative peptidase M20D, amidohydrolase PF01546: Peptidase family M20/M25/M40 5.79 40268 I miscellaneous 4.7 BAC72609.1 Non-secretory protein CDS SAVERM_4898 5954746 5954090 hypothetical protein PF00106: short chain dehydrogenase 4.83 22427 I similar to unknown proteins 5 BAC72610.1 Non-secretory protein CDS SAVERM_4899 5956229 5954988 putative hydrolase PF01979: Amidohydrolase family 6.6 41637 I miscellaneous 4.7 BAC72611.1 Non-secretory protein CDS SAVERM_4900 5956882 5957046 rpmG2 putative ribosomal protein L33 PF00471: Ribosomal protein L33 10.57 6406 I ribosomal protein 3.7.1 BAC72612.1 Non-secretory protein CDS SAVERM_4901 5957202 5957654 hypothetical protein PF05921: Actinomycete protein of unknown function (DUF875) 4.57 16162 I similar to unknown proteins 5 BAC72613.1 Non-secretory protein CDS SAVERM_4902 5957657 5958085 putative MaoC-like dehydratase PF01575: MaoC like domain 4.73 15220 I similar to unknown proteins 5 BAC72614.1 Non-secretory protein CDS SAVERM_4903 5958310 5958879 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.73 21189 I regulation 3.5.2 BAC72615.1 Non-secretory protein CDS SAVERM_4904 5958993 5960462 putative transmembrane efflux protein drug resistance, PF07690: Major Facilitator Superfamily 9.8 50002 I transport / binding proteins & lipoproteins 1.2 BAC72616.1 Non-secretory protein CDS SAVERM_4905 5960568 5961662 murB putative UDP-N-acetylenolpyruvoylglucosamine reductase PF02873: UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 5.14 38183 I cell wall 1.1 BAC72617.1 Non-secretory protein CDS SAVERM_4906 5962888 5961860 add4 putative adenosine deaminase PF00962: Adenosine/AMP deaminase 6.07 37324 I metabolism of nucleotides & nucleic acids 2.3 BAC72618.1 Non-secretory protein CDS SAVERM_4907 5964282 5963056 aspC1 putative aspartate aminotransferase PF00155: Aminotransferase class I and II 4.68 43568 I metabolism of amino acids & related molecules 2.2 BAC72619.1 Non-secretory protein CDS SAVERM_4908 5964712 5964999 secE putative preprotein translocase SecE subunit PF00584: SecE/Sec61-gamma subunits of protein translocation complex 10.6 10623 I protein secretion 1.6 BAC72620.1 Non-secretory protein CDS SAVERM_4909 5965077 5965940 nusG putative transcription antitermination protein PF02357: Transcription termination factor nusG 3.78 31507 I DNA termination 3.5.4 BAC72621.1 Non-secretory protein CDS SAVERM_4910 5966111 5966545 rplK putative ribosomal protein L11 relC, PF00298: Ribosomal protein L11, RNA binding domain 10.32 15218 I ribosomal protein 3.7.1 BAC72622.1 Non-secretory protein CDS SAVERM_4911 5966625 5967350 rplA putative ribosomal protein L1 PF00687: Ribosomal protein L1p/L10e family 10.23 25828 I ribosomal protein 3.7.1 BAC72623.1 Non-secretory protein CDS SAVERM_4912 5967982 5968512 rplJ putative ribosomal protein L10 PF00466: Ribosomal protein L10 9.99 18542 I ribosomal protein 3.7.1 BAC72624.1 Non-secretory protein CDS SAVERM_4913 5968622 5969005 rplL putative ribosomal protein L7/L12 PF00542: Ribosomal protein L7/L12 C-terminal domain 4.24 13281 I ribosomal protein 3.7.1 BAC72625.1 Non-secretory protein CDS SAVERM_4914 5969628 5973113 rpoB RNA polymerase beta subunit PF00562: RNA polymerase Rpb2, domain 6 4.58 128297 I RNA elongation 3.5.3 BAC72626.1 Non-secretory protein CDS SAVERM_4915 5973224 5977123 rpoC RNA polymerase beta prime subunit PF04997: RNA polymerase Rpb1, domain 1 7.17 145044 I RNA elongation 3.5.3 BAC72627.1 Non-secretory protein CDS SAVERM_4916 5977160 5977861 hypothetical protein PF08044: Domain of unknown function (DUF1707) 9.03 23887 I similar to unknown proteins 5 BAC72628.1 Non-secretory protein CDS SAVERM_4917 5978149 5978520 rpsL ribosomal protein S12 PF00164: Ribosomal protein S12 11.78 13771 I ribosomal protein 3.7.1 BAC72629.1 Non-secretory protein CDS SAVERM_4918 5978523 5978993 rpsG putative ribosomal protein S7 PF00177: Ribosomal protein S7p/S5e 11.05 17445 I ribosomal protein 3.7.1 BAC72630.1 Non-secretory protein CDS SAVERM_4919 5979033 5981162 fusA1 putative translation elongation factor G PF00009: Elongation factor Tu GTP binding domain 4.72 77793 I elongation 3.7.4 BAC72631.1 Non-secretory protein CDS SAVERM_4920 5981306 5982499 tufA1 putative elongation factor EF-Tu PF00009: Elongation factor Tu GTP binding domain 4.75 43826 I elongation 3.7.4 BAC72632.1 Non-secretory protein CDS SAVERM_4921 5982592 5982705 hypothetical protein PF06821: Alpha/Beta hydrolase family of unknown function (DUF1234) 4.67 4092 I no similarity 6 BAC72633.1 Non-secretory protein CDS SAVERM_4922 5983359 5982754 hypothetical protein PF06821: Protein of unknown function (DUF1234) 5.95 21490 I similar to unknown proteins 5 BAC72634.1 Non-secretory protein CDS SAVERM_4923 5983411 5984361 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 7.65 33365 I regulation 3.5.2 BAC72635.1 Non-secretory protein CDS SAVERM_4924 5986484 5984370 putative secreted protein Tat substrate, PF02585: Uncharacterised LmbE-like protein, COG2120 9.39 74111 I similar to unknown proteins 5 BAC72636.1 Non-secretory protein CDS SAVERM_4925 5987138 5987446 rpsJ putative ribosomal protein S10 PF00338: Ribosomal protein S10p/S20e 9.82 11521 I ribosomal protein 3.7.1 BAC72637.1 Non-secretory protein CDS SAVERM_4926 5987464 5988108 rplC putative ribosomal protein L3 PF00297: Ribosomal protein L3 10.85 22714 I ribosomal protein 3.7.1 BAC72638.1 Non-secretory protein CDS SAVERM_4927 5988114 5988779 rplD putative ribosomal protein L4 PF00573: Ribosomal protein L4/L1 family 10.42 23581 I ribosomal protein 3.7.1 BAC72639.1 Non-secretory protein CDS SAVERM_4928 5988779 5989195 rplW putative ribosomal protein L23 longer N-terminus compared with other bacteria, PF00276: Ribosomal protein L23 11.18 14880 I ribosomal protein 3.7.1 BAC72640.1 Non-secretory protein CDS SAVERM_4929 5989235 5990071 rplB putative ribosomal protein L2 PF03947: Ribosomal Proteins L2, C-terminal domain 11.92 30376 I ribosomal protein 3.7.1 BAC72641.1 Non-secretory protein CDS SAVERM_4930 5990084 5990365 rpsS putative ribosomal protein S19 PF00203: Ribosomal protein S19 11.52 10543 I ribosomal protein 3.7.1 BAC72642.1 Non-secretory protein CDS SAVERM_4931 5990408 5990755 rplV putative ribosomal protein L22 PF00237: Ribosomal protein L22p/L17e 10.98 12795 I ribosomal protein 3.7.1 BAC72643.1 Non-secretory protein CDS SAVERM_4932 5990755 5991582 rpsC putative ribosomal protein S3 PF00189: Ribosomal protein S3, C-terminal domain 11.07 30061 I ribosomal protein 3.7.1 BAC72644.1 Non-secretory protein CDS SAVERM_4933 5991589 5992008 rplP putative ribosomal protein L16 PF00252: Ribosomal protein L16 11.62 15856 I ribosomal protein 3.7.1 BAC72645.1 Non-secretory protein CDS SAVERM_4934 5992008 5992232 rpmC putative ribosomal protein L29 PF00831: Ribosomal L29 protein 5.91 8402 I ribosomal protein 3.7.1 BAC72646.1 Non-secretory protein CDS SAVERM_4935 5992232 5992516 rpsQ putative ribosomal protein S17 PF00366: Ribosomal protein S17 10.64 10719 I ribosomal protein 3.7.1 BAC72647.1 Non-secretory protein CDS SAVERM_4936 5992620 5992988 rplN putative ribosomal protein L14 PF00238: Ribosomal protein L14p/L23e 10.81 13371 I ribosomal protein 3.7.1 BAC72648.1 Non-secretory protein CDS SAVERM_4937 5992991 5993314 rplX putative ribosomal protein L24 PF00467: KOW motif 10.6 11509 I ribosomal protein 3.7.1 BAC72649.1 Non-secretory protein CDS SAVERM_4938 5993314 5993871 rplE putative ribosomal protein L5 PF00673: ribosomal L5P family C-terminus 10.18 20796 I ribosomal protein 3.7.1 BAC72650.1 Non-secretory protein CDS SAVERM_4939 5993877 5994062 rpsN1 putative ribosomal protein S14 PF00253: Ribosomal protein S14p/S29e 11.6 6949 I ribosomal protein 3.7.1 BAC72651.1 Non-secretory protein CDS SAVERM_4940 5994274 5994672 rpsH putative ribosomal protein S8 PF00410: Ribosomal protein S8 10.34 14308 I ribosomal protein 3.7.1 BAC72652.1 Non-secretory protein CDS SAVERM_4941 5994697 5995236 rplF putative ribosomal protein L6 PF00347: Ribosomal protein L6 10.58 19217 I ribosomal protein 3.7.1 BAC72653.1 Non-secretory protein CDS SAVERM_4942 5995240 5995623 rplR putative ribosomal protein L18 PF00861: Ribosomal L18p/L5e family 11.26 13505 I ribosomal protein 3.7.1 BAC72654.1 Non-secretory protein CDS SAVERM_4943 5995665 5996270 rpsE putative ribosomal protein S5 PF03719: Ribosomal protein S5, C-terminal domain 11.12 20343 I ribosomal protein 3.7.1 BAC72655.1 Non-secretory protein CDS SAVERM_4944 5996273 5996455 rpmD putative ribosomal protein L30 PF00327: Ribosomal protein L30p/L7e 10.36 6889 I ribosomal protein 3.7.1 BAC72656.1 Non-secretory protein CDS SAVERM_4945 5996458 5996913 rplO putative ribosomal protein L15 PF01305: Ribosomal protein L15 amino terminal region 10.83 16021 I ribosomal protein 3.7.1 BAC72657.1 Non-secretory protein CDS SAVERM_4946 5997158 5998474 secY putative preprotein translocase SecY subunit PF00344: eubacterial secY protein 9.95 47586 I protein secretion 1.6 BAC72658.1 Non-secretory protein CDS SAVERM_4947 5998474 5999136 adk putative adenylate kinase PF00406: Adenylate kinase 4.81 24355 I metabolism of nucleotides & nucleic acids 2.3 BAC72659.1 Non-secretory protein CDS SAVERM_4948 5999283 6000119 map3 putative methionyl aminopeptidase, secreted PF00557: metallopeptidase family M24 5.04 29455 I protein modification 3.8 BAC72660.1 Non-secretory protein CDS SAVERM_4949 6000287 6000508 infA1 putative translation initiation factor IF-1 PF00575: S1 RNA binding domain 9.88 8410 I initiation 3.7.3 BAC72661.1 Non-secretory protein CDS SAVERM_4950 6000568 6000681 rpmJ putative ribosomal protein L36 PF00444: Ribosomal protein L36 11.65 4401 I ribosomal protein 3.7.1 BAC72662.1 Non-secretory protein CDS SAVERM_4951 6000885 6001265 rpsM putative ribosomal protein S13 PF00416: Ribosomal protein S13/S18 11.49 14365 I ribosomal protein 3.7.1 BAC72663.1 Non-secretory protein CDS SAVERM_4952 6001363 6001767 rpsK putative ribosomal protein S11 PF00411: Ribosomal protein S11 12.08 14384 I ribosomal protein 3.7.1 BAC72664.1 Non-secretory protein CDS SAVERM_4953 6001910 6002932 rpoA RNA polymerase alpha subunit PF01000: RNA polymerase Rpb3/RpoA insert domain 4.4 36695 I RNA elongation 3.5.3 BAC72665.1 Non-secretory protein CDS SAVERM_4954 6003114 6003617 rplQ putative ribosomal protein L17 PF01196: Ribosomal protein L17 10.1 18151 I ribosomal protein 3.7.1 BAC72666.1 Non-secretory protein CDS SAVERM_4955 6003707 6004564 truA putative pseudouridine synthase PF01416: tRNA pseudouridine synthase 7.31 31388 I RNA modification 3.6 BAC72667.1 Non-secretory protein CDS SAVERM_4956 6005456 6004569 hypothetical protein PF06974: Protein of unknown function (DUF1298) 8.86 30658 I similar to unknown proteins 5 BAC72668.1 Non-secretory protein CDS SAVERM_4957 6005829 6006272 rplM putative ribosomal protein L13 PF00572: Ribosomal protein L13 10.43 16320 I ribosomal protein 3.7.1 BAC72669.1 Non-secretory protein CDS SAVERM_4958 6006315 6006836 rpsI putative ribosomal protein S9 longer N-terminus compared with other bacteria, PF00380: Ribosomal protein S9/S16 9.82 19024 I ribosomal protein 3.7.1 BAC72670.1 Non-secretory protein CDS SAVERM_4959 6007048 6008406 glmM putative phosphoglucosamine mutase PF02878: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 4.82 46746 I specific pathways 2.1.1 BAC72671.1 Non-secretory protein CDS SAVERM_4960 6009427 6008474 putative membrane protein PF04087: Domain of unknown function (DUF389) 4.94 33209 I miscellaneous 4.7 BAC72672.1 Non-secretory protein CDS SAVERM_4961 6010433 6009444 coaA putative pantothenate kinase PF00485: Phosphoribulokinase / Uridine kinase family 10.06 36993 I metabolism of coenzymes & prosthetic groups 2.5 BAC72673.1 Non-secretory protein CDS SAVERM_4962 6010591 6010848 hypothetical protein 4.24 9515 I no similarity 6 BAC72674.1 Non-secretory protein CDS SAVERM_4963 6011012 6012859 glmS1 putative L-glutamine-D-fructose-6-phosphate amidotransferase PF01380: SIS domain 5.31 65987 I metabolism of amino acids & related molecules 2.2 BAC72675.1 Non-secretory protein CDS SAVERM_4964 6013029 6013400 acpS putative holo-ACP synthase PF01648: 4'-phosphopantetheinyl transferase superfamily 5.75 12990 I metabolism of lipids 2.4 BAC72676.1 Non-secretory protein CDS SAVERM_4965 6013441 6014871 hypothetical protein PF03853: YjeF-related protein N-terminus 6.54 47564 I similar to unknown proteins 5 BAC72677.1 Non-secretory protein CDS SAVERM_4966 6014923 6016140 hypothetical protein PF03734: ErfK/YbiS/YcfS/YnhG 10.67 43348 I similar to unknown proteins 5 BAC72678.1 Non-secretory protein CDS SAVERM_4967 6016209 6017384 alr putative alanine racemase PF01168: Alanine racemase, N-terminal domain 6.59 40751 I metabolism of amino acids & related molecules 2.2 BAC72679.1 Non-secretory protein CDS SAVERM_4968 6017475 6018725 putative hydrolase, secreted PF00561: alpha/beta hydrolase fold 6.25 43521 I miscellaneous 4.7 BAC72680.1 Non-secretory protein CDS SAVERM_4969 6018685 6019212 hypothetical protein PF02367: Uncharacterised P-loop hydrolase UPF0079 4.46 18418 I similar to unknown proteins 5 BAC72681.1 Non-secretory protein CDS SAVERM_4970 6019468 6019644 hypothetical protein 9.8 5922 I similar to unknown proteins 5 BAC72682.1 Non-secretory protein CDS SAVERM_4971 6020284 6019730 putative secreted protein 10.28 18944 I similar to unknown proteins 5 BAC72683.1 Signal peptide CDS SAVERM_4972 6020407 6021054 hypothetical protein PF00814: glycoprotease family 5.06 22552 I similar to unknown proteins 5 BAC72684.1 Non-secretory protein CDS SAVERM_4973 6021072 6021554 putative ribosomal-protein-alanine N-acetyltransferase probably ribosomal-protein-alanine N-acetyltransferase 4.44 17822 I protein modification 3.8 BAC72685.1 Non-secretory protein CDS SAVERM_4974 6021547 6022671 gcp putative O-sialoglycoprotein endopeptidase PF00814: glycoprotease family 6.11 39076 I protein modification 3.8 BAC72686.1 Non-secretory protein CDS SAVERM_4975 6022668 6022925 hypothetical protein 4.51 9824 I similar to unknown proteins 5 BAC72687.1 Non-secretory protein CDS SAVERM_4976 6023026 6023868 putative DNA-binding protein PF01381: Helix-turn-helix 6.73 31079 I regulation 3.5.2 BAC72688.1 Non-secretory protein CDS SAVERM_4977 6023865 6024116 hypothetical protein PF04149: Domain of unknown function (DUF397) 6.77 9011 I similar to unknown proteins 5 BAC72689.1 Non-secretory protein CDS SAVERM_4978 6024202 6025221 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.97 36103 I regulation 3.5.2 BAC72690.1 Non-secretory protein CDS SAVERM_4979 6025409 6026713 msmE putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 7.69 45647 I transport / binding proteins & lipoproteins 1.2 BAC72691.1 Signal peptide CDS SAVERM_4980 6026723 6027775 msmF putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.91 38167 I transport / binding proteins & lipoproteins 1.2 BAC72692.1 Non-secretory protein CDS SAVERM_4981 6027772 6028668 msmG putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 10.25 32042 I transport / binding proteins & lipoproteins 1.2 BAC72693.1 Non-secretory protein CDS SAVERM_4982 6028705 6030933 xynB2 putative xylan 1,4-beta-xylosidase PF01915: Glycosyl hydrolase family 3 C terminal domain 4.93 78243 I specific pathways 2.1.1 BAC72694.1 Non-secretory protein CDS SAVERM_4983 6031078 6032187 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 7.24 39396 I regulation 3.5.2 BAC72695.1 Non-secretory protein CDS SAVERM_4984 6032380 6033735 xynA2 putative endo-1,4-beta xylanase, secreted PF00331: Glycosyl hydrolase family 10 6.62 47350 I specific pathways 2.1.1 BAC72696.1 Signal peptide CDS SAVERM_4985 6033808 6034893 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 6.73 37286 I regulation 3.5.2 BAC72697.1 Non-secretory protein CDS SAVERM_4986 6035075 6035431 hypothetical protein PF04946: DGPF domain 4.44 13048 I similar to unknown proteins 5 BAC72698.1 Non-secretory protein CDS SAVERM_4987 6035525 6036799 sig43 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 5.76 46019 I RNA initiation 3.5.1 BAC72699.1 Non-secretory protein CDS SAVERM_4988 6038084 6036912 hypothetical protein PF05175: Methyltransferase small domain 6.28 41628 I similar to unknown proteins 5 BAC72700.1 Non-secretory protein CDS SAVERM_4989 6038220 6039095 putative polysaccharide deacetylase, secreted PF01522: Polysaccharide deacetylase 7.59 32501 I cell wall 1.1 BAC72701.1 Signal peptide CDS SAVERM_4990 6039092 6039922 putative polysaccharide deacetylase, secreted PF01522: Polysaccharide deacetylase 10.88 30015 I cell wall 1.1 BAC72702.1 Non-secretory protein CDS SAVERM_4991 6040496 6040804 groES1 putative GroES PF00166: Chaperonin 10 Kd subunit 4.38 10930 I protein folding 3.9 BAC72703.1 Non-secretory protein CDS SAVERM_4992 6040941 6042569 groEL1 putative class I heat-shock protein PF00118: TCP-1/cpn60 chaperonin family 4.6 56996 I protein folding 3.9 BAC72704.1 Non-secretory protein CDS SAVERM_4993 6043442 6042693 hypothetical protein PF07366: Protein of unknown function (DUF1486) 4.35 28333 I similar to unknown proteins 5 BAC72705.1 Non-secretory protein CDS SAVERM_4994 6044244 6043471 putative dehydrogenase PF00106: short chain dehydrogenase 10.31 27320 I miscellaneous 4.7 BAC72706.1 Non-secretory protein CDS SAVERM_4995 6045075 6044407 hypothetical protein PF03473: MOSC domain 6.31 24117 I similar to unknown proteins 5 BAC72707.1 Non-secretory protein CDS SAVERM_4996 6045156 6046052 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.45 31103 I regulation 3.5.2 BAC72708.1 Non-secretory protein CDS SAVERM_4997 6046508 6046179 wblB putative WhiB-family transcriptional regulator; putative role in cell cycle control PF02467: Transcription factor WhiB 6.5 11977 I regulation 3.5.2 BAC72709.1 Non-secretory protein CDS SAVERM_4998 6046898 6047509 whiK putative two-component system response regulator (bldM) PF00072: Response regulator receiver domain 10.71 21955 I regulation 3.5.2 BAC72710.1 Non-secretory protein CDS SAVERM_4999 6047808 6048383 sig44 putative RNA polymerase ECF-subfamily sigma factor similar to SCO4769, PF08281: Sigma-70, region 4 6.4 21052 I RNA initiation 3.5.1 BAC72711.1 Non-secretory protein CDS SAVERM_5000 6048664 6050172 guaB1 putative inosine-5’-monophosphate dehydrogenase PF00478: IMP dehydrogenase / GMP reductase domain 6.08 52723 I metabolism of nucleotides & nucleic acids 2.3 BAC72712.1 Non-secretory protein CDS SAVERM_5001 6050311 6051435 guaB2 putative inosine-5’-monophosphate dehydrogenase PF00478: IMP dehydrogenase / GMP reductase domain 5.46 39941 I metabolism of nucleotides & nucleic acids 2.3 BAC72713.1 Non-secretory protein CDS SAVERM_5002 6053316 6052108 putative UDP-glucose/GDP-mannose dehydrogenase PF00984: UDP-glucose/GDP-mannose dehydrogenase family, central domain 7.74 42829 I specific pathways 2.1.1 BAC72714.1 Non-secretory protein CDS SAVERM_5003 6053578 6055284 glpD2 putative glycerol-3-phosphate dehydrogenase PF01266: FAD dependent oxidoreductase 6.67 61983 I specific pathways 2.1.1 BAC72715.1 Non-secretory protein CDS SAVERM_5004 6056438 6055377 putative beta-lactamase, secreted PF00144: Beta-lactamase 9.37 37114 I detoxification 4.2 BAC72716.1 Signal peptide CDS SAVERM_5005 6056589 6058769 pkn18 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7.85 74602 I protein modification 3.8 BAC72717.1 Non-secretory protein CDS SAVERM_5006 6058940 6061621 pkn19 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7 92763 I protein modification 3.8 BAC72718.1 Non-secretory protein CDS SAVERM_5007 6061938 6063581 pkn20 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7.53 59308 I protein modification 3.8 BAC72719.1 Non-secretory protein CDS SAVERM_5008 6063790 6064947 pkn21 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.74 40516 I protein modification 3.8 BAC72720.1 Non-secretory protein CDS SAVERM_5009 6065086 6065475 hypothetical protein 5.6 14337 I no similarity 6 BAC72721.1 Non-secretory protein CDS SAVERM_5010 6065586 6067322 pkn22 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.58 62333 I protein modification 3.8 BAC72722.1 Non-secretory protein CDS SAVERM_5011 6068167 6067364 putative secreted protein 4.38 27282 I similar to unknown proteins 5 BAC72723.1 Signal peptide CDS SAVERM_5012 6068794 6068609 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.51 6715 I no similarity 6 BAC72724.1 Non-secretory protein CDS SAVERM_5013 6069657 6068806 putative DNA-binding protein PF01381: Helix-turn-helix 6.9 31839 I regulation 3.5.2 BAC72725.1 Non-secretory protein CDS SAVERM_5014 6069909 6070397 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.28 17114 I regulation 3.5.2 BAC72726.1 Non-secretory protein CDS SAVERM_5015 6070502 6071875 putative membrane protein PF00781: Diacylglycerol kinase catalytic domain (presumed) 7.77 47999 I miscellaneous 4.7 BAC72727.1 Non-secretory protein CDS SAVERM_5016 6072117 6073748 gabD1 putative succinate-semialdehyde dehydrogenase, NADP-dependent PF00171: Aldehyde dehydrogenase family 6.96 57782 I metabolism of amino acids & related molecules 2.2 BAC72728.1 Non-secretory protein CDS SAVERM_5017 6073813 6075618 choD putative cholesterol oxidase PF01266: FAD dependent oxidoreductase 9.56 64440 I specific pathways 2.1.1 BAC72729.1 Non-secretory protein CDS SAVERM_5018 6075922 6076683 putative secreted protein 9.67 25410 I similar to unknown proteins 5 BAC72730.1 Signal peptide CDS SAVERM_5019 6077662 6077378 hypothetical protein PF01817: Chorismate mutase type II 7.37 10218 I similar to unknown proteins 5 BAC72731.1 Non-secretory protein CDS SAVERM_5020 6078473 6077928 hypothetical protein PF04138: GtrA-like protein 10.59 20219 I similar to unknown proteins 5 BAC72732.1 Non-secretory protein CDS SAVERM_5021 6078590 6079813 purK putative phosphoribosylaminoimidazole carboxylase ATPase subunit PF02222: ATP-grasp domain 5.83 44214 I metabolism of nucleotides & nucleic acids 2.3 BAC72733.1 Non-secretory protein CDS SAVERM_5022 6079810 6080343 purE putative phosphoribosylaminoimidazole carboxylase catalytic subunit PF00731: AIR carboxylase 4.96 18377 I metabolism of nucleotides & nucleic acids 2.3 BAC72734.1 Non-secretory protein CDS SAVERM_5023 6080349 6081542 putative dipeptidase PF01244: Membrane dipeptidase (Peptidase family M19) 4.96 42827 I protein modification 3.8 BAC72735.1 Non-secretory protein CDS SAVERM_5024 6081971 6081579 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.38 14463 I similar to unknown proteins 5 BAC72736.1 Non-secretory protein CDS SAVERM_5025 6083548 6082205 udgA putative UDP-glucose 6-dehydrogenase PF03721: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 5.14 48077 I specific pathways 2.1.1 BAC72737.1 Non-secretory protein CDS SAVERM_5026 6083724 6084881 fadE1 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.06 41375 I metabolism of lipids 2.4 BAC72738.1 Non-secretory protein CDS SAVERM_5027 6085605 6084970 hypothetical protein PF00702: haloacid dehalogenase-like hydrolase 4.89 22357 I similar to unknown proteins 5 BAC72739.1 Non-secretory protein CDS SAVERM_5028 6086798 6085605 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 6.98 42457 I regulation 3.5.2 BAC72740.1 Non-secretory protein CDS SAVERM_5029 6086994 6087617 putative acyl-CoA hydrolase PF03061: Thioesterase superfamily 9.68 22289 I metabolism of lipids 2.4 BAC72741.1 Non-secretory protein CDS SAVERM_5030 6089206 6087680 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 11.19 55696 I regulation 3.5.2 BAC72742.1 Signal peptide CDS SAVERM_5031 6089279 6090307 exoA putative glycosyltransferase PF00535: Glycosyl transferase 9.43 36806 I specific pathways 2.1.1 BAC72743.1 Non-secretory protein CDS SAVERM_5032 6092104 6090362 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 9.75 61654 I regulation 3.5.2 BAC72744.1 Non-secretory protein CDS SAVERM_5033 6093952 6092429 putative transcriptional regulator Tat substrate, PF03816: Cell envelope-related transcriptional attenuator domain 10.26 53770 I regulation 3.5.2 BAC72745.1 Non-secretory protein CDS SAVERM_5034 6095662 6094412 putative transcriptional regulator PF03816: Cell envelope-related transcriptional attenuator domain 5.35 44571 I regulation 3.5.2 BAC72746.1 Non-secretory protein CDS SAVERM_5035 6096674 6095910 hypothetical protein PF00501: AMP-binding enzyme 4.51 26346 I similar to unknown proteins 5 BAC72747.1 Non-secretory protein CDS SAVERM_5036 6096814 6098190 putative secreted protein PF01510: N-acetylmuramoyl-L-alanine amidase 10.35 47722 I similar to unknown proteins 5 BAC72748.1 Signal peptide CDS SAVERM_5037 6098346 6099428 rmlA putative nucleotide phosphorylase PF00483: Nucleotidyl transferase 5.21 37531 I metabolism of coenzymes & prosthetic groups 2.5 BAC72749.1 Non-secretory protein CDS SAVERM_5038 6100580 6099570 hypothetical protein PF00730: HhH-GPD superfamily base excision DNA repair protein 11.76 36401 I similar to unknown proteins 5 BAC72750.1 Non-secretory protein CDS SAVERM_5039 6101925 6100654 cofE putative F420-0:gamma-glutamyl ligase PF01996: F420-0:Gamma-glutamyl ligase 5.39 44672 I similar to unknown proteins 5 BAC72751.1 Non-secretory protein CDS SAVERM_5040 6103154 6102195 cofD putative LPPG:Fo 2-phospho-L-lactate transferase PF01933: Uncharacterised protein family UPF0052 4.47 33584 I miscellaneous 4.7 BAC72752.1 Non-secretory protein CDS SAVERM_5041 6103716 6103189 cdo2 putative cysteine dioxygenase PF05995: cysteine dioxygenase type I 5.76 18982 I miscellaneous 4.7 BAC72753.1 Non-secretory protein CDS SAVERM_5042 6104412 6104675 whiB putative WhiB-family transcriptional regulator, WhiB protein PF02467: Transcription factor WhiB 4.48 9892 I regulation 3.5.2 BAC72754.1 Non-secretory protein CDS SAVERM_5043 6104897 6108574 putative membrane protein PF00535: Glycosyl transferase 6.06 129126 I miscellaneous 4.7 BAC72755.1 Non-secretory protein CDS SAVERM_5044 6108571 6110079 putative secreted protein 4.87 50215 I miscellaneous 4.7 BAC72756.1 Signal peptide CDS SAVERM_5045 6110730 6110158 hypothetical protein PF06262: Domain of unknown function (DUF1025) 6.82 20454 I similar to unknown proteins 5 BAC72757.1 Non-secretory protein CDS SAVERM_5046 6110912 6111385 hypothetical protein PF12005: Protein of unknown function (DUF3499) 8.61 16763 I similar to unknown proteins 5 BAC72758.1 Non-secretory protein CDS SAVERM_5047 6111641 6113257 lldP putative L-lactate permease PF02652: L-lactate permease 7.84 55439 I transport / binding proteins & lipoproteins 1.2 BAC72759.1 Non-secretory protein CDS SAVERM_5048 6113505 6114872 manB putative phosphomannomutase PF02879: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II 4.49 48535 I specific pathways 2.1.1 BAC72760.1 Non-secretory protein CDS SAVERM_5049 6115063 6115233 hypothetical protein PF03966: Protein of unknown function (DUF343) 4.17 5929 I similar to unknown proteins 5 BAC72761.1 Non-secretory protein CDS SAVERM_5050 6115265 6116392 hypothetical protein PF10432: Bacterial phospho-glucose isomerase C-terminal region 4.4 38116 I similar to unknown proteins 5 BAC72762.1 Non-secretory protein CDS SAVERM_5051 6116496 6117647 manA putative mannose-6-phosphate isomerase PF01238: Phosphomannose isomerase type I 4.46 40787 I specific pathways 2.1.1 BAC72763.1 Non-secretory protein CDS SAVERM_5052 6117765 6118748 putative transport protein PF01545: Cation efflux family 5.79 34734 I transport / binding proteins & lipoproteins 1.2 BAC72764.1 Non-secretory protein CDS SAVERM_5053 6119333 6120790 sahH putative S-adenosyl-L-homocysteine hydrolase PF05221: S-adenosyl-L-homocysteine hydrolase 4.86 53009 I metabolism of amino acids & related molecules 2.2 BAC72765.1 Non-secretory protein CDS SAVERM_5054 6120938 6121552 hypothetical protein PF06271: RDD family 6.02 21817 I similar to unknown proteins 5 BAC72766.1 Non-secretory protein CDS SAVERM_5055 6122654 6121647 putative membrane protein PF06271: RDD family 9.96 34361 I miscellaneous 4.7 BAC72767.1 Non-secretory protein CDS SAVERM_5056 6122773 6123780 putative membrane protein PF01944: Integral membrane protein DUF95 9.32 35949 I miscellaneous 4.7 BAC72768.1 Non-secretory protein CDS SAVERM_5057 6130979 6129669 putative secreted protein PF01882: Protein of unknown function DUF58 11.55 47173 B similar to unknown proteins 5 BAC72769.1 Non-secretory protein CDS SAVERM_5058 6131971 6130979 putative regulatory protein PF07726: ATPase family associated with various cellular activities (AAA) 4.96 35313 B regulation 3.5.2 BAC72770.1 Non-secretory protein CDS SAVERM_5059 6133107 6131968 putative secreted protein 9.08 39751 B miscellaneous 4.7 BAC72771.1 Signal peptide CDS SAVERM_5060 6133877 6133158 putative integral membrane protein 9.72 25751 B miscellaneous 4.7 BAC72772.1 Non-secretory protein CDS SAVERM_5061 6135261 6133912 putative integral membrane protein PF07415: Gammaherpesvirus latent membrane protein (LMP2) protein 6.8 45364 B miscellaneous 4.7 BAC72773.1 Non-secretory protein CDS SAVERM_5062 6135405 6136553 eif1 putative initiation factor eIF-2B alpha subunit PF01008: Initiation factor 2 subunit family 4.55 39282 B initiation 3.7.3 BAC72774.1 Non-secretory protein CDS SAVERM_5063 6136558 6137247 mtrA putative two-component system response regulator probably essential TCR, PF00072: Response regulator receiver domain 5.83 25248 B regulation 3.5.2 BAC72775.1 Non-secretory protein CDS SAVERM_5064 6137249 6139327 mtrB putative two-component system sensor kinase probably essential TCR, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 10.71 73162 B sensors 1.3 BAC72776.1 Non-secretory protein CDS SAVERM_5065 6139317 6141149 lpqB putative lipoprotein 5.1 65012 B transport / binding proteins & lipoproteins 1.2 BAC72777.1 Non-secretory protein CDS SAVERM_5066 6141156 6142175 hypothetical protein PF00156: Phosphoribosyl transferase domain 10.95 35026 B similar to unknown proteins 5 BAC72778.1 Non-secretory protein CDS SAVERM_5067 6142323 6143183 putative sigma 54 modulation protein/ribosomal protein S30EA PF02482: Sigma 54 modulation protein / S30EA ribosomal protein 8.48 30813 B similar to unknown proteins 5 BAC72779.1 Non-secretory protein CDS SAVERM_5068 6143389 6144135 putative two-component system response regulator PF00072: Response regulator receiver domain 4.5 27054 B regulation 3.5.2 BAC72780.1 Non-secretory protein CDS SAVERM_5069 6145365 6144163 hypothetical protein PF06224: Protein of unknown function (DUF1006) 8.83 44557 B similar to unknown proteins 5 BAC72781.1 Non-secretory protein CDS SAVERM_5070 6145998 6145429 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.25 20584 B miscellaneous 4.7 BAC72782.1 Non-secretory protein CDS SAVERM_5071 6146233 6149052 secA1 putative preprotein translocase SecA subunit PF07517: SecA DEAD-like domain 4.63 105778 B protein secretion 1.6 BAC72783.1 Non-secretory protein CDS SAVERM_5072 6149516 6149247 hypothetical protein 8.48 10012 B similar to unknown proteins 5 BAC72784.1 Non-secretory protein CDS SAVERM_5073 6150095 6150610 hypothetical protein 3.92 17579 B similar to unknown proteins 5 BAC72785.1 Non-secretory protein CDS SAVERM_5074 6150756 6151430 putative phosphatase PF00702: haloacid dehalogenase-like hydrolase 5.08 23914 B miscellaneous 4.7 BAC72786.1 Non-secretory protein CDS SAVERM_5075 6152169 6157106 gdhA1 putative NAD-specific glutamate dehydrogenase PF05088: Bacterial NAD-glutamate dehydrogenase 5.26 183386 B metabolism of amino acids & related molecules 2.2 BAC72787.1 Non-secretory protein CDS SAVERM_5076 6157319 6157807 hypothetical protein PF04138: GtrA-like protein 11.92 17661 B similar to unknown proteins 5 BAC72788.1 Non-secretory protein CDS SAVERM_5077 6157791 6159287 putative integral membrane protein PF00115: Cytochrome C and Quinol oxidase polypeptide I 10.5 53201 B miscellaneous 4.7 BAC72789.1 Non-secretory protein CDS SAVERM_5078 6161141 6159441 putative glycosyltransferase PF00535: Glycosyl transferase 8.94 63084 B miscellaneous 4.7 BAC72790.1 Non-secretory protein CDS SAVERM_5079 6163360 6161138 tagF putative CDP-glycerol:polyglycerol phosphate glycero-phosphotransferase PF04464: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase 9.19 82139 B cell wall 1.1 BAC72791.1 Non-secretory protein CDS SAVERM_5080 6164453 6163464 tagH putative ABC transporter ATP-binding protein teichoic acid translocation transport system, PF00005: ABC transporter 10.16 35665 B transport / binding proteins & lipoproteins 1.2 BAC72792.1 Non-secretory protein CDS SAVERM_5081 6165405 6164446 tagG putative ABC transporter permease protein teichoic acid translocation transport system, PF01061: ABC-2 type transporter 10.2 34627 B transport / binding proteins & lipoproteins 1.2 BAC72793.1 Non-secretory protein CDS SAVERM_5082 6165643 6166281 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 10.02 22580 B regulation 3.5.2 BAC72794.1 Non-secretory protein CDS SAVERM_5083 6167544 6166489 putative ribosylglycoyhydrolase PF03747: ADP-ribosylglycohydrolase 5.49 36359 B miscellaneous 4.7 BAC72795.1 Non-secretory protein CDS SAVERM_5084 6168172 6167549 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.51 22173 B regulation 3.5.2 BAC72796.1 Non-secretory protein CDS SAVERM_5085 6168271 6169239 putative dehydrogenase PF00106: short chain dehydrogenase 10.01 33748 B miscellaneous 4.7 BAC72797.1 Non-secretory protein CDS SAVERM_5086 6170287 6169307 galE3 putative UDP-glucose 4-epimerase PF01370: NAD dependent epimerase/dehydratase family 4.96 34653 B specific pathways 2.1.1 BAC72798.1 Non-secretory protein CDS SAVERM_5087 6171960 6170365 putative glycosyltransferase, secreted PF00535: Glycosyl transferase 8.6 58112 B miscellaneous 4.7 BAC72799.1 Non-secretory protein CDS SAVERM_5088 6173273 6172005 hypothetical protein PF09594: Protein of unknown function (DUF2029) 11.85 45477 B similar to unknown proteins 5 BAC72800.1 Signal peptide CDS SAVERM_5089 6173367 6174929 hypothetical protein 11.21 55335 B similar to unknown proteins 5 BAC72801.1 Non-secretory protein CDS SAVERM_5090 6175510 6175007 putative MarR-family transcriptional regulator PF01047: MarR family 6.27 18428 B regulation 3.5.2 BAC72802.1 Non-secretory protein CDS SAVERM_5091 6175639 6176052 ohrB2 putative organic hydroperoxide resistance protein PF02566: OsmC-like protein 4.45 14083 B detoxification 4.2 BAC72803.1 Non-secretory protein CDS SAVERM_5092 6177581 6176259 putative integral membrane protein PF01925: Domain of unknown function DUF81 11.43 47815 B miscellaneous 4.7 BAC72804.1 Signal peptide CDS SAVERM_5093 6179788 6177590 putative glycosyltransferase PF04464: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase 8.52 81913 B specific pathways 2.1.1 BAC72805.1 Non-secretory protein CDS SAVERM_5094 6181983 6179794 putative glycosyltransferase PF04464: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase 9.07 79961 B specific pathways 2.1.1 BAC72806.1 Non-secretory protein CDS SAVERM_5095 6184449 6182113 putative glycosyltransferase PF04464: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase 9.97 86969 B specific pathways 2.1.1 BAC72807.1 Non-secretory protein CDS SAVERM_5096 6185452 6184571 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.72 31683 B transport / binding proteins & lipoproteins 1.2 BAC72808.1 Non-secretory protein CDS SAVERM_5097 6186729 6185449 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.13 44978 B transport / binding proteins & lipoproteins 1.2 BAC72809.1 Non-secretory protein CDS SAVERM_5098 6188214 6186823 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.58 48634 B transport / binding proteins & lipoproteins 1.2 BAC72810.1 Signal peptide CDS SAVERM_5099 6192633 6188365 hypothetical protein PF00498: FHA domain 7.04 144404 B similar to unknown proteins 5 BAC72811.1 Non-secretory protein CDS SAVERM_5100 6193092 6194813 pkn23 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 7.81 61879 B protein modification 3.8 BAC72812.1 Non-secretory protein CDS SAVERM_5101 6194969 6196210 pkn24 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.13 43413 B protein modification 3.8 BAC72813.1 Non-secretory protein CDS SAVERM_5102 6196323 6197429 prfB putative peptide chain release factor 2 PF00472: Peptidyl-tRNA hydrolase domain 4.44 41106 B termination 3.7.5 BAC72814.1 Non-secretory protein CDS SAVERM_5103 6197736 6198566 putative secreted protein 3.62 24572 B miscellaneous 4.7 BAC72815.1 Signal peptide CDS SAVERM_5104 6199189 6199878 ftsE putative cell division ATP-binding protein PF00005: ABC transporter 10.71 25714 B cell division 1.7 BAC72816.1 Non-secretory protein CDS SAVERM_5105 6199908 6200825 ftsX putative cell division protein PF02687: Predicted permease 9.03 33334 B cell division 1.7 BAC72817.1 Non-secretory protein CDS SAVERM_5106 6200893 6202062 putative carboxy-terminal processing protease precursor, secreted PF03572: Peptidase family S41 4.83 39996 B protein modification 3.8 BAC72818.1 Signal peptide CDS SAVERM_5107 6202121 6202654 smpB putative small protein B SsrA-binding protein, PF01668: SmpB protein 10.61 20046 B protein modification 3.8 BAC72819.1 Non-secretory protein CDS SAVERM_5108 6203529 6204158 hypothetical protein 4.19 23047 B no similarity 6 BAC72820.1 Non-secretory protein CDS SAVERM_5109 6204635 6204339 hypothetical protein 12.44 10726 B no similarity 6 BAC72821.1 Non-secretory protein CDS SAVERM_5110 6205038 6205949 putative phosphotransferase PF01636: Phosphotransferase enzyme family 5.68 32942 B miscellaneous 4.7 BAC72822.1 Non-secretory protein CDS SAVERM_5111 6206069 6207481 cyp21 putative cytochrome P450 CYP184A1 6.27 51189 B metabolism of coenzymes & prosthetic groups 2.5 BAC72823.1 Non-secretory protein CDS SAVERM_5112 6208703 6207447 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.8 42938 B transport / binding proteins & lipoproteins 1.2 BAC72824.1 Non-secretory protein CDS SAVERM_5113 6208934 6209899 putative LysR-family transcriptional regulator PF00126: Bacterial regulatory helix-turn-helix protein, lysR family 5.81 35061 B regulation 3.5.2 BAC72825.1 Non-secretory protein CDS SAVERM_5114 6209993 6211513 matA putative membrane protein PF05433: Rickettsia 17 kDa surface antigen 10.68 50372 B miscellaneous 4.7 BAC72826.1 Non-secretory protein CDS SAVERM_5115 6211513 6213765 matB putative bi-functional glycosyltransferase/deacetylase PF01522: Polysaccharide deacetylase, PF00535: Glycosyl transferase 10.21 83203 B miscellaneous 4.7 BAC72827.1 Non-secretory protein CDS SAVERM_5116 6213762 6215018 putative integral membrane protein PF01757: Acyltransferase family 9.84 46045 B miscellaneous 4.7 BAC72828.1 Non-secretory protein CDS SAVERM_5117 6215887 6215339 hypothetical protein 11.03 20121 B no similarity 6 BAC72829.1 Non-secretory protein CDS SAVERM_5118 6216446 6216000 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 7.55 15963 B no similarity 6 BAC72830.1 Non-secretory protein CDS SAVERM_5119 6216715 6218106 narK putative nitrate extrusion protein PF07690: Major Facilitator Superfamily 9.88 48642 B transport / binding proteins & lipoproteins 1.2 BAC72831.1 Non-secretory protein CDS SAVERM_5120 6218210 6219370 putative transcriptional regulator PF02602: Uroporphyrinogen-III synthase HemD 6.53 40971 B regulation 3.5.2 BAC72832.1 Non-secretory protein CDS SAVERM_5121 6219873 6219319 putative membrane protein 11.46 19457 B miscellaneous 4.7 BAC72833.1 Non-secretory protein CDS SAVERM_5122 6220123 6220710 hypothetical protein PF07336: Protein of unknown function (DUF1470) 8.51 21048 B similar to unknown proteins 5 BAC72834.1 Non-secretory protein CDS SAVERM_5123 6221200 6221796 sig45 putative RNA polymerase ECF-subfamily sigma factor similar to SCO2954, PF04542: Sigma-70 region 2 8.94 22176 B RNA initiation 3.5.1 BAC72835.1 Non-secretory protein CDS SAVERM_5124 6221799 6222617 putative membrane protein 6.52 28459 B miscellaneous 4.7 BAC72836.1 Non-secretory protein CDS SAVERM_5125 6222701 6225211 putative ATP-dependent helicase PF00580: UvrD/REP helicase 5.27 90603 B DNA modification & repair 3.2 BAC72837.1 Non-secretory protein CDS SAVERM_5126 6225718 6227151 maeB2 putative malate dehydrogenase (oxaloacetate-decarboxylating; NADP-requiring) malS4, PF03949: Malic enzyme, NAD binding domain 4.68 49506 B TCA cycle 2.1.3 BAC72838.1 Non-secretory protein CDS SAVERM_5127 6227508 6227789 hup putative DNA-binding protein Hu 1 PF00216: Bacterial DNA-binding protein 10.15 9837 B DNA packaging & segregation 3.4 BAC72839.1 Non-secretory protein CDS SAVERM_5128 6229316 6227970 murA1 putative UDP-N-acetylglucosamine transferase PF00275: EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 6.15 48203 B cell wall 1.1 BAC72840.1 Non-secretory protein CDS SAVERM_5129 6229586 6230167 putative secreted protein PF02622: Uncharacterized ACR, COG1678 3.99 20299 B similar to unknown proteins 5 BAC72841.1 Non-secretory protein CDS SAVERM_5130 6230197 6230493 hypothetical protein PF11238: Protein of unknown function (DUF3039) 6.77 10544 B similar to unknown proteins 5 BAC72842.1 Non-secretory protein CDS SAVERM_5131 6230779 6232119 dasA2 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.53 46863 B transport / binding proteins & lipoproteins 1.2 BAC72843.1 Signal peptide CDS SAVERM_5132 6232124 6233086 dasB2 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 8.43 34392 B transport / binding proteins & lipoproteins 1.2 BAC72844.1 Non-secretory protein CDS SAVERM_5133 6233083 6233928 dasC2 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 10.36 31313 B transport / binding proteins & lipoproteins 1.2 BAC72845.1 Non-secretory protein CDS SAVERM_5134 6233930 6235663 nagZ3 putative beta-N-acetylhexosaminidase PF00728: Glycosyl hydrolase family 20, catalytic domain 6.07 63322 B cell wall 1.1 BAC72846.1 Non-secretory protein CDS SAVERM_5135 6235873 6236793 putative dehydrogenase PF00941: FAD binding domain in molybdopterin dehydrogenase 8.76 31096 B miscellaneous 4.7 BAC72847.1 Non-secretory protein CDS SAVERM_5136 6236790 6238352 hypothetical protein PF01799: [2Fe-2S] binding domain 3.87 52306 B similar to unknown proteins 5 BAC72848.1 Non-secretory protein CDS SAVERM_5137 6238349 6240655 putative dehydrogenase PF02738: Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain 5.24 80236 B miscellaneous 4.7 BAC72849.1 Non-secretory protein CDS SAVERM_5138 6240993 6242183 hypothetical protein 4.16 42337 B similar to unknown proteins 5 BAC72850.1 Non-secretory protein CDS SAVERM_5139 6242641 6244095 ebrB putative multidrug resistance efflux protein PF07690: Major Facilitator Superfamily 10.29 48763 B transport / binding proteins & lipoproteins 1.2 BAC72851.1 Non-secretory protein CDS SAVERM_5140 6244408 6246204 sdrA putative protein involving differentiation PF04851: Type III restriction enzyme, res subunit 5.98 66312 B miscellaneous 4.7 BAC72852.1 Non-secretory protein CDS SAVERM_5141 6246638 6247279 sdrB putative differentiation regulon (IclR-family transcriptional regulator) PF01614: Bacterial transcriptional regulator 7.26 22414 B regulation 3.5.2 BAC72853.1 Non-secretory protein CDS SAVERM_5142 6247582 6248376 sdrC putative secreted protein PF05362: Lon protease (S16) C-terminal proteolytic domain 7.19 27056 B miscellaneous 4.7 BAC72854.1 Signal peptide CDS SAVERM_5143 6249226 6248588 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 6.61 24046 B regulation 3.5.2 BAC72855.1 Non-secretory protein CDS SAVERM_5144 6250204 6249242 opuBC2 putative ABC transporter substrate-binding protein osmoprotectant transport system permease protein, PF04069: Substrate binding domain of ABC-type glycine betaine transport system 5.48 34277 B transport / binding proteins & lipoproteins 1.2 BAC72856.1 Signal peptide CDS SAVERM_5145 6251031 6250201 opuBB1 putative ABC transporter permease protein osmoprotectant transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 10.77 29041 B transport / binding proteins & lipoproteins 1.2 BAC72857.1 Non-secretory protein CDS SAVERM_5146 6252341 6251028 opuBA2 putative ABC transporter ATP-binding protein osmoprotectant transport system ATP-binding protein, PF00005: ABC transporter 5.36 47657 B transport / binding proteins & lipoproteins 1.2 BAC72858.1 Non-secretory protein CDS SAVERM_5147 6252981 6252334 opuBB2 putative ABC transporter permease protein osmoprotectant transport system permease protein, PF01547: Bacterial extracellular solute-binding protein 10.06 22414 B transport / binding proteins & lipoproteins 1.2 BAC72859.1 Non-secretory protein CDS SAVERM_5148 6253517 6253005 putative AsnC-family transcriptional regulator PF01037: AsnC family 8.53 18482 B regulation 3.5.2 BAC72860.1 Non-secretory protein CDS SAVERM_5149 6253610 6254755 hpd 4-hydroxyphenylpyruvate dioxygenase ochronotic pigment biosynthesis, PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.4 41863 B antibiotic production 4.3 BAC72861.1 Non-secretory protein CDS SAVERM_5150 6256490 6254901 putative secreted protein Tat substrate, PF00515: TPR Domain 5.21 55824 B similar to unknown proteins 5 BAC72862.1 Non-secretory protein CDS SAVERM_5151 6256583 6257998 glcD2 putative (S)-2-hydroxy-acid oxidase similar to glycolate oxidase: PF01565: FAD binding domain 4.51 49120 B specific pathways 2.1.1 BAC72863.1 Non-secretory protein CDS SAVERM_5152 6258237 6259847 putative membrane protein PF06271: RDD family 6.45 55050 B miscellaneous 4.7 BAC72864.1 Non-secretory protein CDS SAVERM_5153 6260266 6260712 putative membrane protein PF06271: RDD family 9.83 15931 B miscellaneous 4.7 BAC72865.1 Non-secretory protein CDS SAVERM_5154 6261176 6260892 putative secreted protein 8.52 9337 B similar to unknown proteins 5 BAC72866.1 Non-secretory protein CDS SAVERM_5155 6261636 6263981 putative protease, secreted PF05547: Immune inhibitor A peptidase M6 6.18 84334 B protein modification 3.8 BAC72867.1 Signal peptide CDS SAVERM_5156 6264103 6264486 hypothetical protein 11.58 13111 B similar to unknown proteins 5 BAC72868.1 Non-secretory protein CDS SAVERM_5157 6265454 6264870 pncA putative nicotinamidase PF00857: Isochorismatase family 4.49 20088 B metabolism of coenzymes & prosthetic groups 2.5 BAC72869.1 Non-secretory protein CDS SAVERM_5158 6267104 6265776 pncB putative nicotinate phosphoribosyltransferase PF04095: Nicotinate phosphoribosyltransferase (NAPRTase) family 5.33 46939 B metabolism of coenzymes & prosthetic groups 2.5 BAC72870.1 Non-secretory protein CDS SAVERM_5159 6267279 6267596 clpS putative ATP-dependent Clp protease adaptor protein PF02617: ATP-dependent Clp protease adaptor protein ClpS 5.58 11927 B adaptation to atypical conditions 4.1 BAC72871.1 Non-secretory protein CDS SAVERM_5160 6267609 6268214 hypothetical protein PF09438: Domain of unknown function 3.99 21613 B similar to unknown proteins 5 BAC72872.1 Non-secretory protein CDS SAVERM_5161 6268547 6269998 putative proline permease PF00324: Amino acid permease 8.25 51825 B transport / binding proteins & lipoproteins 1.2 BAC72873.1 Non-secretory protein CDS SAVERM_5162 6270089 6270511 hypothetical protein PF01398: Mov34/MPN/PAD-1 family 4.16 15536 B similar to unknown proteins 5 BAC72874.1 Non-secretory protein CDS SAVERM_5163 6270890 6271177 hypothetical protein PF02597: ThiS family 4.38 10350 B similar to unknown proteins 5 BAC72875.1 Non-secretory protein CDS SAVERM_5164 6271195 6272145 cysM2 putative cysteine synthase PF00291: Pyridoxal-phosphate dependent enzyme 5.05 33715 B metabolism of amino acids & related molecules 2.2 BAC72876.1 Non-secretory protein CDS SAVERM_5165 6272719 6272273 putative secreted protein 10.41 16172 B similar to unknown proteins 5 BAC72877.1 Non-secretory protein CDS SAVERM_5166 6272994 6273746 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 5.12 27237 B similar to unknown proteins 5 BAC72878.1 Non-secretory protein CDS SAVERM_5167 6275093 6273825 ptsC1 putative phosphotransferase system IIC component PF02378: Phosphotransferase system, EIIC 9.9 44524 B transport / binding proteins & lipoproteins 1.2 BAC72879.1 Non-secretory protein CDS SAVERM_5168 6276629 6275343 ptsC2 putative phosphotransferase system IIC component PF02378: Phosphotransferase system, EIIC 7.2 45847 B transport / binding proteins & lipoproteins 1.2 BAC72880.1 Non-secretory protein CDS SAVERM_5169 6276799 6277032 ptsB putative phosphotransferase system IIB component PF00367: Phosphotransferase system, EIIB 4.03 7892 B transport / binding proteins & lipoproteins 1.2 BAC72881.1 Non-secretory protein CDS SAVERM_5170 6277137 6277871 rphA putative ribonuclease PH PF01138: 3' exoribonuclease family, domain 1 5.91 26091 B RNA modification 3.6 BAC72882.1 Non-secretory protein CDS SAVERM_5171 6277931 6278347 putative secreted protein 4.34 14433 B miscellaneous 4.7 BAC72883.1 Signal peptide CDS SAVERM_5172 6278382 6278984 putative nucleoside-triphosphatase PF01725: Ham1 family 5.57 21048 B similar to unknown proteins 5 BAC72884.1 Non-secretory protein CDS SAVERM_5173 6280244 6279261 putative hydrolase PF00561: alpha/beta hydrolase fold 5.78 35388 B miscellaneous 4.7 BAC72885.1 Non-secretory protein CDS SAVERM_5174 6280352 6280963 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.78 21348 B regulation 3.5.2 BAC72886.1 Non-secretory protein CDS SAVERM_5175 6282649 6281141 putative osmoprotectant transporter PF00083: Sugar (and other) transporter 9.42 53564 B transport / binding proteins & lipoproteins 1.2 BAC72887.1 Non-secretory protein CDS SAVERM_5176 6283244 6282777 bcp2 putative bacterioferritin comigratory protein PF00578: AhpC/TSA family 5.3 16724 B miscellaneous 4.7 BAC72888.1 Non-secretory protein CDS SAVERM_5177 6283437 6283775 putative membrane protein 11.23 12073 B miscellaneous 4.7 BAC72889.1 Non-secretory protein CDS SAVERM_5178 6283819 6284175 groES2 putative GroES-family molecular chaperone PF00166: Chaperonin 10 Kd subunit 6.35 13121 B protein folding 3.9 BAC72890.1 Non-secretory protein CDS SAVERM_5179 6286541 6284295 pbp9 putative penicillin-binding protein PF00912: Transglycosylase 5.61 78005 B cell wall 1.1 BAC72891.1 Non-secretory protein CDS SAVERM_5180 6286890 6287690 hypothetical protein PF06182: Protein of unknown function (DUF990) 8.39 28483 B similar to unknown proteins 5 BAC72892.1 Non-secretory protein CDS SAVERM_5181 6287683 6288582 putative integral membrane transport protein PF06182: Protein of unknown function (DUF990) 10.6 31762 B transport / binding proteins & lipoproteins 1.2 BAC72893.1 Non-secretory protein CDS SAVERM_5182 6288585 6289592 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.28 37309 B transport / binding proteins & lipoproteins 1.2 BAC72894.1 Non-secretory protein CDS SAVERM_5183 6289626 6290528 hypothetical protein PF08044: Domain of unknown function (DUF1707) 6.21 34105 B similar to unknown proteins 5 BAC72895.1 Non-secretory protein CDS SAVERM_5184 6291963 6290569 putative secreted protein PF00657: GDSL-like Lipase/Acylhydrolase 7.18 48876 B miscellaneous 4.7 BAC72896.1 Non-secretory protein CDS SAVERM_5185 6292063 6293430 hypothetical protein PF04286: Protein of unknown function (DUF445) 8.44 49634 B similar to unknown proteins 5 BAC72897.1 Non-secretory protein CDS SAVERM_5186 6293494 6294999 putative sugar transport protein PF07690: Major Facilitator Superfamily 6.16 53163 B transport / binding proteins & lipoproteins 1.2 BAC72898.1 Non-secretory protein CDS SAVERM_5187 6295078 6295557 putative membrane protein 7.68 17147 B miscellaneous 4.7 BAC72899.1 Non-secretory protein CDS SAVERM_5188 6296151 6295642 hypothetical protein 9.34 18871 B no similarity 6 BAC72900.1 Non-secretory protein CDS SAVERM_5189 6296611 6296162 putative integral membrane protein 10.24 15229 B miscellaneous 4.7 BAC72901.1 Signal peptide CDS SAVERM_5190 6296882 6297907 bdpF putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 6.6 36041 B regulation 3.5.2 BAC72902.1 Non-secretory protein CDS SAVERM_5191 6298289 6297984 putative membrane protein PF05433: Rickettsia 17 kDa surface antigen 12.27 9972 B miscellaneous 4.7 BAC72903.1 Non-secretory protein CDS SAVERM_5192 6299172 6298444 hypothetical protein 10.88 26108 B no similarity 6 BAC72904.1 Non-secretory protein CDS SAVERM_5193 6299759 6299385 putative secreted protein PF03995: Peptidase inhibitor family I36 7.38 12825 B no similarity 6 BAC72905.1 Signal peptide CDS SAVERM_5194 6300449 6299976 hypothetical protein 10.81 16236 B no similarity 6 BAC72906.1 Non-secretory protein CDS SAVERM_5195 6301008 6301202 hypothetical protein 4.66 6962 B similar to unknown proteins 5 BAC72907.1 Non-secretory protein CDS SAVERM_5196 6301177 6301710 hypothetical protein 4.53 20291 B similar to unknown proteins 5 BAC72908.1 Non-secretory protein CDS SAVERM_5197 6301736 6302587 putative DNA-binding protein PF01381: Helix-turn-helix 7.05 31474 B regulation 3.5.2 BAC72909.1 Non-secretory protein CDS SAVERM_5198 6303106 6302630 hypothetical protein 4.06 17760 B no similarity 6 BAC72910.1 Non-secretory protein CDS SAVERM_5199 6303480 6303268 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.91 7347 B no similarity 6 BAC72911.1 Non-secretory protein CDS SAVERM_5200 6304325 6303477 putative DNA-binding protein PF01381: Helix-turn-helix 6.06 31590 B regulation 3.5.2 BAC72912.1 Non-secretory protein CDS SAVERM_5201 6304532 6305194 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.31 23669 B regulation 3.5.2 BAC72913.1 Non-secretory protein CDS SAVERM_5202 6308119 6305198 putative ATP-dependent helicase PF04851: Type III restriction enzyme, res subunit 6.52 109251 B DNA modification & repair 3.2 BAC72914.1 Non-secretory protein CDS SAVERM_5203 6308525 6309583 putative HNH endonuclease PF13391: HNH endonuclease 5.25 40232 B similar to unknown proteins 5 BAC72915.1 Non-secretory protein CDS SAVERM_5204 6310644 6309631 hypothetical protein PF02810: SEC-C motif 4.73 36676 B similar to unknown proteins 5 BAC72916.1 Non-secretory protein CDS SAVERM_5205 6312322 6310847 putative secreted endo-beta-1,6-galactanase Tat substrate 7.6 52723 B miscellaneous 4.7 BAC72917.1 Signal peptide CDS SAVERM_5206 6312601 6313419 putative membrane protein PF04203: Sortase family 11.56 29701 B miscellaneous 4.7 BAC72918.1 Non-secretory protein CDS SAVERM_5207 6313586 6313921 apcA hypothetical protein 12.1 11502 B similar to unknown proteins 5 BAC72919.1 Non-secretory protein CDS SAVERM_5208 6314034 6314765 yidC2 putative membrane protein PF02096: 60Kd inner membrane protein 9.97 26196 B miscellaneous 4.7 BAC72920.1 Non-secretory protein CDS SAVERM_5209 6314908 6315765 hpcE putative 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase PF01557: Fumarylacetoacetate (FAA) hydrolase family 4.53 30559 B specific pathways 2.1.1 BAC72921.1 Non-secretory protein CDS SAVERM_5210 6316416 6315925 hypothetical protein PF06142: Protein of unknown function (DUF967) 6.52 17968 B similar to unknown proteins 5 BAC72922.1 Non-secretory protein CDS SAVERM_5211 6317579 6316485 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 4.45 38570 B miscellaneous 4.7 BAC72923.1 Non-secretory protein CDS SAVERM_5212 6317639 6318925 putative ROK-family transcriptional regulator PF00480: ROK family 7.33 42624 B regulation 3.5.2 BAC72924.1 Non-secretory protein CDS SAVERM_5213 6319187 6320206 hypothetical protein 4.42 34153 B similar to unknown proteins 5 BAC72925.1 Non-secretory protein CDS SAVERM_5214 6320308 6321087 nagD putative N-acetyl-glucosamine catabolism protein PF00702: haloacid dehalogenase-like hydrolase 4.83 28048 B cell wall 1.1 BAC72926.1 Non-secretory protein CDS SAVERM_5215 6321293 6321940 hypothetical protein 8.33 20504 B similar to unknown proteins 5 BAC72927.1 Signal peptide CDS SAVERM_5216 6322057 6322722 hypothetical protein PF04203: Sortase family 6.27 23384 B similar to unknown proteins 5 BAC72928.1 Non-secretory protein CDS SAVERM_5217 6323049 6324065 cslZ putative endo-1,4-beta-glucanase, secreted PF01341: Glycosyl hydrolases family 6 5.49 35933 B specific pathways 2.1.1 BAC72929.1 Signal peptide CDS SAVERM_5218 6326123 6324186 cslC putative secreted protein PF07646: Kelch motif 10.17 71012 B miscellaneous 4.7 BAC72930.1 Non-secretory protein CDS SAVERM_5219 6328114 6326120 cslA putative glycosyltransferase (cellulose synthase-like protein) PF00535: Glycosyl transferase 9.66 73402 B specific pathways 2.1.1 BAC72931.1 Non-secretory protein CDS SAVERM_5220 6329161 6328439 putative GntR-family transcriptional regulator PF07729: FCD domain 7.17 26664 B regulation 3.5.2 BAC72932.1 Non-secretory protein CDS SAVERM_5221 6329508 6330707 hypothetical protein PF00877: NlpC/P60 family 6.05 42304 B similar to unknown proteins 5 BAC72933.1 Non-secretory protein CDS SAVERM_5222 6330754 6331950 hypothetical protein PF01145: SPFH domain / Band 7 family 9.19 43002 B similar to unknown proteins 5 BAC72934.1 Non-secretory protein CDS SAVERM_5223 6332060 6332716 cbpA putative chitin-binding protein, secreted Tat substrate, PF03067: Chitin binding domain 9.97 23089 B miscellaneous 4.7 BAC72935.1 Signal peptide CDS SAVERM_5224 6332821 6333291 hypothetical protein 6.07 16285 B no similarity 6 BAC72936.1 Non-secretory protein CDS SAVERM_5225 6333369 6335009 fadD11 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 5.69 58906 B metabolism of lipids 2.4 BAC72937.1 Non-secretory protein CDS SAVERM_5226 6336124 6335273 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 9.46 30503 B regulation 3.5.2 BAC72938.1 Non-secretory protein CDS SAVERM_5227 6337023 6336208 gltL1 putative polar amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 5.04 29560 B transport / binding proteins & lipoproteins 1.2 BAC72939.1 Non-secretory protein CDS SAVERM_5228 6337663 6337013 gltKB1 putative polar amino acid ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.01 23963 B transport / binding proteins & lipoproteins 1.2 BAC72940.1 Non-secretory protein CDS SAVERM_5229 6338409 6337660 gltKA1 putative polar amino acid ABC transporter substrate-binding protein PF00528: Binding-protein-dependent transport system inner membrane component 10.66 26649 B transport / binding proteins & lipoproteins 1.2 BAC72941.1 Non-secretory protein CDS SAVERM_5230 6339332 6338406 gltI1 putative polar amino acid ABC transporter substrate-binding protein Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.48 33146 B transport / binding proteins & lipoproteins 1.2 BAC72942.1 Signal peptide CDS SAVERM_5231 6339462 6339950 hypothetical protein 4.41 17876 B similar to unknown proteins 5 BAC72943.1 Non-secretory protein CDS SAVERM_5232 6341422 6339980 putative amidase PF01425: Amidase 6.43 50136 B miscellaneous 4.7 BAC72944.1 Non-secretory protein CDS SAVERM_5233 6342410 6341451 putative D-isomer specific 2-hydroxyacid dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 7.82 34990 B miscellaneous 4.7 BAC72945.1 Non-secretory protein CDS SAVERM_5234 6342585 6343388 putative decarboxylase PF01177: Asp/Glu/Hydantoin racemase 5.35 28581 B miscellaneous 4.7 BAC72946.1 Non-secretory protein CDS SAVERM_5235 6343385 6344119 putative decarboxylase PF01177: Asp/Glu/Hydantoin racemase 4.96 25871 B miscellaneous 4.7 BAC72947.1 Non-secretory protein CDS SAVERM_5236 6344263 6345414 putative LuxAB-like protein (oxygenase) PF00296: Luciferase-like monooxygenase 5.02 40659 B miscellaneous 4.7 BAC72948.1 Non-secretory protein CDS SAVERM_5237 6347328 6345466 putative sensory box/GGDEF family protein PF00563: EAL domain 5.52 67212 B sensors 1.3 BAC72949.1 Non-secretory protein CDS SAVERM_5238 6347684 6349207 putative secreted protein 5.41 53233 B similar to unknown proteins 5 BAC72950.1 Non-secretory protein CDS SAVERM_5239 6350023 6349376 hypothetical protein 5.82 22607 B similar to unknown proteins 5 BAC72951.1 Non-secretory protein CDS SAVERM_5240 6350588 6350223 hypothetical protein 4.6 13586 B similar to unknown proteins 5 BAC72952.1 Non-secretory protein CDS SAVERM_5241 6352318 6350999 hypothetical protein PF00270: DEAD/DEAH box helicase 6.35 46562 B similar to unknown proteins 5 BAC72953.1 Non-secretory protein CDS SAVERM_5242 6353910 6352315 hypothetical protein 5.25 57813 B similar to unknown proteins 5 BAC72954.1 Non-secretory protein CDS SAVERM_5243 6354941 6353901 putative secreted protein 4.91 35640 B miscellaneous 4.7 BAC72955.1 Non-secretory protein CDS SAVERM_5244 6356004 6355048 hypothetical protein 10.2 34112 B similar to unknown proteins 5 BAC72956.1 Non-secretory protein CDS SAVERM_5245 6356198 6356815 putative mutase 6.16 22924 B miscellaneous 4.7 BAC72957.1 Non-secretory protein CDS SAVERM_5246 6358461 6356869 hypothetical protein PF06036: Streptomyces protein of unknown function (DUF921) 6.64 57578 B similar to unknown proteins 5 BAC72958.1 Non-secretory protein CDS SAVERM_5247 6358763 6359197 hypothetical protein 4.22 15037 B similar to unknown proteins 5 BAC72959.1 Non-secretory protein CDS SAVERM_5248 6359325 6360218 hypothetical protein PF01564: Spermine/spermidine synthase 9.57 31775 B similar to unknown proteins 5 BAC72960.1 Non-secretory protein CDS SAVERM_5249 6360788 6360258 putative secreted protein Tat substrate 10.65 18695 B miscellaneous 4.7 BAC72961.1 Non-secretory protein CDS SAVERM_5250 6360937 6361680 putative two-component system response regulator PF00072: Response regulator receiver domain 6.26 27069 B regulation 3.5.2 BAC72962.1 Non-secretory protein CDS SAVERM_5251 6361677 6363050 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.29 47808 B sensors 1.3 BAC72963.1 Signal peptide CDS SAVERM_5252 6363284 6364753 putative sugar hydrolase, secreted PF00553: Cellulose binding domain 5.46 49544 B sensors 1.3 BAC72964.1 Signal peptide CDS SAVERM_5253 6366342 6364894 bglC2 putative beta-glucosidase PF00232: Glycosyl hydrolase family 1 5.26 52020 B specific pathways 2.1.1 BAC72965.1 Non-secretory protein CDS SAVERM_5254 6367435 6366512 cebG putative cellobiose ABC transporter permease protein multiple sugar ABC transporter permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 10.77 32980 B transport / binding proteins & lipoproteins 1.2 BAC72966.1 Non-secretory protein CDS SAVERM_5255 6368464 6367448 cebF putative cellobiose ABC transporter permease protein multiple sugar ABC transporter permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 9.7 37788 B transport / binding proteins & lipoproteins 1.2 BAC72967.1 Non-secretory protein CDS SAVERM_5256 6369831 6368470 cebE putative cellobiose ABC transporter substrate-binding protein multiple sugar ABC transporter solute-binding protein, PF01547: Bacterial extracellular solute-binding protein 8.39 48023 B transport / binding proteins & lipoproteins 1.2 BAC72968.1 Signal peptide CDS SAVERM_5257 6370230 6371285 cebR putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.51 37661 B regulation 3.5.2 BAC72969.1 Non-secretory protein CDS SAVERM_5258 6371977 6371369 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6.97 21121 B similar to unknown proteins 5 BAC72970.1 Non-secretory protein CDS SAVERM_5259 6372600 6372118 putative secreted protein 7.35 16381 B no similarity 6 BAC72971.1 Signal peptide CDS SAVERM_5260 6373497 6372895 orn putative 3’->5’ exoribonuclease PF00929: Exonuclease 4.64 21994 B RNA modification 3.6 BAC72972.1 Non-secretory protein CDS SAVERM_5261 6374929 6373649 bdpA AraC-family transcriptional regulator bldH, PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 9.09 45469 B regulation 3.5.2 BAC72973.1 Non-secretory protein CDS SAVERM_5262 6375745 6375308 hypothetical protein PF07172: Glycine rich protein family 12.13 14865 B no similarity 6 BAC72974.1 Non-secretory protein CDS SAVERM_5263 6376089 6376616 hypothetical protein PF00582: Universal stress protein family 5.26 18766 B similar to unknown proteins 5 BAC72975.1 Non-secretory protein CDS SAVERM_5264 6376767 6377333 hypothetical protein PF01184: GPR1/FUN34/yaaH family 6.23 18680 B similar to unknown proteins 5 BAC72976.1 Non-secretory protein CDS SAVERM_5265 6379255 6377438 glmS2 putative L-glutamine-D-fructose-6-phosphate amidotransferase PF01380: SIS domain 6.22 66154 B main glycolytic pathways 2.1.2 BAC72977.1 Non-secretory protein CDS SAVERM_5266 6379550 6379293 hypothetical protein 6.81 10033 B similar to unknown proteins 5 BAC72978.1 Non-secretory protein CDS SAVERM_5267 6379752 6381278 ppe2 putative phosphoesterase Tat substrate, PF00149: Calcineurin-like phosphoesterase 6.83 55113 B metabolism of phosphates 2.6 BAC72979.1 Signal peptide CDS SAVERM_5268 6381542 6383131 nagZ4 beta-N-acetylhexosaminidase, secreted PF00728: Glycosyl hydrolase family 20, catalytic domain 8.18 57024 B cell wall 1.1 BAC72980.1 Signal peptide CDS SAVERM_5269 6384953 6383181 sidA nocardamine synthetase nocardamin biosynthesis, PF04183: IucA / IucC family 4.88 66168 B antibiotic production 4.3 BAC72981.1 Non-secretory protein CDS SAVERM_5270 6385501 6384950 sidB succinyl-CoA transferase nocardamin biosynthesis, PF00583: Acetyltransferase (GNAT) family 4.81 20377 B antibiotic production 4.3 BAC72982.1 Non-secretory protein CDS SAVERM_5271 6386769 6385498 sidC cadaverine N-monooxygenase nocardamin biosynthesis 4.81 48121 B antibiotic production 4.3 BAC72983.1 Non-secretory protein CDS SAVERM_5272 6388216 6386774 sidD lysine decarboxylase nocardamin biosynthesis, PF00282: Pyridoxal-dependent decarboxylase conserved domain, putative IdeR-binding site: TTAGGCTAGCCTAACCTAA(6388296:6388314) 5.45 52558 B antibiotic production 4.3 BAC72984.1 Non-secretory protein CDS SAVERM_5273 6389226 6388354 sidE siderophore-interacting protein nocardamin biosynthesis, PF04954: Siderophore-interacting protein 5.24 32067 B transport / binding proteins & lipoproteins 1.2 BAC72985.1 Non-secretory protein CDS SAVERM_5274 6390351 6389302 sidF iron(III)/siderophore uptake ABC transporter substrate-binding protein nocardamin biosynthesis, Tat substrate, PF01497: Periplasmic binding protein, putative IdeR-binding site: GTAGGTTAGCCTAACCTCA(6390403:6390421) 8.87 36827 B transport / binding proteins & lipoproteins 1.2 BAC72986.1 Signal peptide CDS SAVERM_5275 6391645 6390485 fadE4 putative acyl-CoA dehydrogenase acdH, PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.91 41737 B metabolism of lipids 2.4 BAC72987.1 Non-secretory protein CDS SAVERM_5276 6392598 6391651 hmgL putative hydroxymethylglutaryl-CoA lyase PF00682: HMGL-like 5.18 33523 B specific pathways 2.1.1 BAC72988.1 Non-secretory protein CDS SAVERM_5277 6394697 6392595 accA1 putative acetyl/propionyl CoA carboxylase alpha subunit PF02786: Carbamoyl-phosphate synthase L chain, ATP binding domain 4.89 72960 B metabolism of lipids 2.4 BAC72989.1 Non-secretory protein CDS SAVERM_5278 6396337 6394706 accD1 putative acetyl/propionyl CoA carboxylase, beta subunit PF01039: Carboxyl transferase domain 6.3 57849 B metabolism of lipids 2.4 BAC72990.1 Non-secretory protein CDS SAVERM_5279 6396435 6397025 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.26 21113 B regulation 3.5.2 BAC72991.1 Non-secretory protein CDS SAVERM_5280 6397123 6398280 fadE7 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.34 42271 B metabolism of lipids 2.4 BAC72992.1 Non-secretory protein CDS SAVERM_5281 6398315 6399187 tesB2 putative acyl-CoA thioesterase PF02551: Acyl-CoA thioesterase 5.55 32055 B metabolism of lipids 2.4 BAC72993.1 Non-secretory protein CDS SAVERM_5282 6400061 6399273 hypothetical protein 4.79 28365 B similar to unknown proteins 5 BAC72994.1 Non-secretory protein CDS SAVERM_5283 6401757 6400144 putative regulatory protein PF07905: Purine catabolism regulatory protein-like family 6.51 54490 B regulation 3.5.2 BAC72995.1 Non-secretory protein CDS SAVERM_5284 6401945 6403405 putative sodium:solute symporter PF00474: Sodium:solute symporter family 9.36 50923 B transport / binding proteins & lipoproteins 1.2 BAC72996.1 Non-secretory protein CDS SAVERM_5285 6403444 6404412 speB putative agmatinase PF00491: Arginase family 4.73 34334 B metabolism of amino acids & related molecules 2.2 BAC72997.1 Non-secretory protein CDS SAVERM_5286 6404409 6406094 ilvB4 putative acetolactate synthase PF02776: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 4.89 58797 B metabolism of amino acids & related molecules 2.2 BAC72998.1 Non-secretory protein CDS SAVERM_5287 6407590 6406163 putative integrin-like protein PF01839: FG-GAP repeat 4.18 46618 B transport / binding proteins & lipoproteins 1.2 BAC72999.1 Signal peptide CDS SAVERM_5288 6408467 6407814 hypothetical protein 4.66 24067 B similar to unknown proteins 5 BAC73000.1 Non-secretory protein CDS SAVERM_5289 6409337 6408531 putative secreted ribonuclease PF04231: Endonuclease I 5.31 29315 B RNA modification 3.6 BAC73001.1 Signal peptide CDS SAVERM_5290 6411889 6409562 putative integral membrane protein PF02366: Dolichyl-phosphate-mannose-protein mannosyltransferase 9.48 77188 B miscellaneous 4.7 BAC73002.1 Non-secretory protein CDS SAVERM_5291 6412403 6412882 hypothetical protein 4.08 17677 B no similarity 6 BAC73003.1 Non-secretory protein CDS SAVERM_5292 6413260 6415170 putative secreted protein PF01079: Hint module 6.14 68536 B similar to unknown proteins 5 BAC73004.1 Signal peptide CDS SAVERM_5293 6415575 6416147 hypothetical protein 4.54 20686 B no similarity 6 BAC73005.1 Non-secretory protein CDS SAVERM_5294 6416413 6416192 putative regulatory protein PF04149: Domain of unknown function (DUF397) 5.57 7682 B regulation 3.5.2 BAC73006.1 Non-secretory protein CDS SAVERM_5295 6417206 6416406 putative DNA-binding protein PF01381: Helix-turn-helix 6.1 29561 B regulation 3.5.2 BAC73007.1 Non-secretory protein CDS SAVERM_5296 6417274 6417711 hypothetical protein 12.31 16217 B no similarity 6 BAC73008.1 Non-secretory protein CDS SAVERM_5297 6417708 6418046 hypothetical protein 4.55 11911 B similar to unknown proteins 5 BAC73009.1 Non-secretory protein CDS SAVERM_5298 6418264 6419196 putative secreted protein PF00905: Penicillin binding protein transpeptidase domain 10.49 32658 B miscellaneous 4.7 BAC73010.1 Signal peptide CDS SAVERM_5299 6419461 6423234 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.69 135885 B transport / binding proteins & lipoproteins 1.2 BAC73011.1 Non-secretory protein CDS SAVERM_5300 6423971 6425419 putative tripeptidyl aminopeptidase, secreted PF05576: PS-10 peptidase S37 7.74 53701 B protein modification 3.8 BAC73012.1 Signal peptide CDS SAVERM_5301 6426458 6425826 putative membrane protein 7.61 21439 B miscellaneous 4.7 BAC73013.1 Signal peptide CDS SAVERM_5302 6428423 6426573 nagZ5 putative beta-N-acetylhexosaminidase, secreted Tat substrate, PF00933: Glycosyl hydrolase family 3 N terminal domain 8.4 64009 B cell wall 1.1 BAC73014.1 Non-secretory protein CDS SAVERM_5303 6429768 6428842 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.86 32732 B regulation 3.5.2 BAC73015.1 Signal peptide CDS SAVERM_5304 6429856 6430776 putative secreted protein PF00892: Integral membrane protein DUF6 8.94 31369 B similar to unknown proteins 5 BAC73016.1 Non-secretory protein CDS SAVERM_5305 6430773 6431282 hypothetical protein 4.29 17562 B no similarity 6 BAC73017.1 Non-secretory protein CDS SAVERM_5306 6433035 6431284 hypothetical protein PF01145: SPFH domain / Band 7 family 4.84 63785 B similar to unknown proteins 5 BAC73018.1 Non-secretory protein CDS SAVERM_5307 6434729 6433101 hypothetical protein PF05419: GUN4-like 7.32 58476 B similar to unknown proteins 5 BAC73019.1 Non-secretory protein CDS SAVERM_5308 6435712 6434726 pkn25 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 8.73 34337 B protein modification 3.8 BAC73020.1 Non-secretory protein CDS SAVERM_5309 6436322 6435765 putative secreted protein 12.25 20580 B no similarity 6 BAC73021.1 Signal peptide CDS SAVERM_5310 6437257 6436457 hypothetical protein PF01261: AP endonuclease family 2 5.32 28347 B similar to unknown proteins 5 BAC73022.1 Non-secretory protein CDS SAVERM_5311 6438223 6437291 putative acetyltransferase:MarR-family transcriptional regulator PF00583: Acetyltransferase (GNAT) family, PF01047: MarR family 6.52 34781 B regulation 3.5.2 BAC73023.1 Non-secretory protein CDS SAVERM_5312 6439552 6438512 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.38 36030 B regulation 3.5.2 BAC73024.1 Non-secretory protein CDS SAVERM_5313 6439787 6440938 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 5.77 42781 B miscellaneous 4.7 BAC73025.1 Non-secretory protein CDS SAVERM_5314 6440935 6442086 hypothetical protein PF06187: Protein of unknown function (DUF993) 5.27 41171 B similar to unknown proteins 5 BAC73026.1 Non-secretory protein CDS SAVERM_5315 6442083 6442916 hypothetical protein PF01261: AP endonuclease family 2 4.47 29548 B similar to unknown proteins 5 BAC73027.1 Non-secretory protein CDS SAVERM_5316 6443541 6443152 rbsD putative D-ribose ABC transporter permease protein simple sugar ABC transporter permease protein, PF05025: RbsD / FucU transport protein family 6.94 13628 B transport / binding proteins & lipoproteins 1.2 BAC73028.1 Non-secretory protein CDS SAVERM_5317 6444437 6443538 rbsK putative ribokinase PF00294: pfkB family carbohydrate kinase 4.59 30080 B specific pathways 2.1.1 BAC73029.1 Non-secretory protein CDS SAVERM_5318 6446464 6444518 rbsB2 putative D-ribose ABC transporter substrate-binding protein/permease protein simple sugar ABC transporter substrate-binding protein/permease protein, PF02653: Branched-chain amino acid transport system / permease component 10.32 65021 B transport / binding proteins & lipoproteins 1.2 BAC73030.1 Non-secretory protein CDS SAVERM_5319 6448022 6446454 rbsA2 putative D-ribose ABC transporter ATP-binding protein simple sugar ABC transporter ATP-binding protein, PF00005: ABC transporter 5.22 55640 B transport / binding proteins & lipoproteins 1.2 BAC73031.1 Non-secretory protein CDS SAVERM_5320 6449083 6448019 rbsR putative LacI-family transcriptional regulator, ribose operon repressor transcriptional regulator mediating carbon catabolite repression, PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.27 38050 B regulation 3.5.2 BAC73032.1 Non-secretory protein CDS SAVERM_5321 6449441 6449773 hypothetical protein 4.54 11437 B no similarity 6 BAC73033.1 Non-secretory protein CDS SAVERM_5322 6449871 6450188 hypothetical protein 5.88 11155 B no similarity 6 BAC73034.1 Non-secretory protein CDS SAVERM_5323 6450229 6450627 hypothetical protein 5.56 13246 B no similarity 6 BAC73035.1 Non-secretory protein CDS SAVERM_5324 6450624 6453326 hypothetical protein 4.8 93368 B similar to unknown proteins 5 BAC73036.1 Non-secretory protein CDS SAVERM_5325 6453323 6454330 hypothetical protein 4.35 36712 B no similarity 6 BAC73037.1 Non-secretory protein CDS SAVERM_5326 6454562 6454924 hypothetical protein PF07661: MORN repeat variant 4.38 13806 B similar to unknown proteins 5 BAC73038.1 Non-secretory protein CDS SAVERM_5327 6454903 6455595 hypothetical protein 4.68 25221 B no similarity 6 BAC73039.1 Non-secretory protein CDS SAVERM_5328 6455728 6456090 hypothetical protein PF07661: MORN repeat variant 4.29 13548 B similar to unknown proteins 5 BAC73040.1 Non-secretory protein CDS SAVERM_5329 6456160 6458436 recD putative exodeoxyribonuclease V PF05127: Putative ATPase (DUF699) 6.53 82105 B RNA modification 3.6 BAC73041.1 Non-secretory protein CDS SAVERM_5330 6458679 6459968 citA1 putative citrate synthase PF00285: Citrate synthase 6.1 47873 B TCA cycle 2.1.3 BAC73042.1 Non-secretory protein CDS SAVERM_5331 6462877 6460625 copA putative cation(copper)-transporting P-type ATPase PF00122: E1-E2 ATPase 5.36 77884 B membrane bioenergetics 1.4 BAC73043.1 Non-secretory protein CDS SAVERM_5332 6463222 6462983 copZ putative copper chaperone PF00403: Heavy-metal-associated domain 3.81 7807 B regulation 3.5.2 BAC73044.1 Non-secretory protein CDS SAVERM_5333 6464231 6463533 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.54 25507 B regulation 3.5.2 BAC73045.1 Non-secretory protein CDS SAVERM_5334 6464399 6466717 putative membrane protein PF03176: MMPL family 7.86 80928 B miscellaneous 4.7 BAC73046.1 Non-secretory protein CDS SAVERM_5335 6466793 6467836 putative oxidoreductase PF00107: Zinc-binding dehydrogenase 6.07 35694 B miscellaneous 4.7 BAC73047.1 Non-secretory protein CDS SAVERM_5336 6468190 6467912 putative MarR-family transcriptional regulator PF01047: MarR family 11.57 10360 B regulation 3.5.2 BAC73048.1 Non-secretory protein CDS SAVERM_5337 6469664 6468756 iolE1 putative inositol dehydratase myo-inositol metabolism, PF06960: Myo-inositol catabolism protein N-terminus 4.66 33278 B specific pathways 2.1.1 BAC73049.1 Non-secretory protein CDS SAVERM_5338 6469797 6470747 iolC1 putative myo-inositol catabolism protein IolC (carbohydrate kinase) myo-inositol metabolism, PF00294: pfkB family carbohydrate kinase 4.73 33683 B specific pathways 2.1.1 BAC73050.1 Non-secretory protein CDS SAVERM_5339 6470744 6471778 hypothetical protein PF01791: DeoC/LacD family aldolase 5.89 35950 B similar to unknown proteins 5 BAC73051.1 Non-secretory protein CDS SAVERM_5340 6471786 6472607 iolB1 putative myo-inositol catabolism protein IolB (isomerase) myo-inositol metabolism, PF06845: Myo-inositol catabolism protein IolB 4.79 29607 B specific pathways 2.1.1 BAC73052.1 Non-secretory protein CDS SAVERM_5341 6472604 6474487 iolD1 putative myo-inositol catabolism protein IolD (hydratase) myo-inositol metabolism, PF00205: Thiamine pyrophosphate enzyme, central domain 5.59 67946 B specific pathways 2.1.1 BAC73053.1 Non-secretory protein CDS SAVERM_5342 6474502 6476004 iolA putative methylmalonic acid semialdehyde dehydrogenase (=mmsA) myo-inositol metabolism, PF00171: Aldehyde dehydrogenase family 5.43 52436 B specific pathways 2.1.1 BAC73054.1 Non-secretory protein CDS SAVERM_5343 6476304 6477713 putative amino acid transporter PF00324: Amino acid permease 6.24 48781 B transport / binding proteins & lipoproteins 1.2 BAC73055.1 Non-secretory protein CDS SAVERM_5344 6477929 6480523 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.47 90375 B transport / binding proteins & lipoproteins 1.2 BAC73056.1 Signal peptide CDS SAVERM_5345 6480520 6481383 putative ABC transporter permease protein Tat substrate, PF04544: Herpesvirus egress protein UL20 10.28 30243 B transport / binding proteins & lipoproteins 1.2 BAC73057.1 Non-secretory protein CDS SAVERM_5346 6481983 6482243 putative secreted protein 4.24 8600 B no similarity 6 BAC73058.1 Signal peptide CDS SAVERM_5347 6482542 6482802 putative secreted protein 4.7 8591 B no similarity 6 BAC73059.1 Signal peptide CDS SAVERM_5348 6483136 6483474 putative secreted protein 5.53 11258 B no similarity 6 BAC73060.1 Signal peptide CDS SAVERM_5349 6483734 6484015 putative secreted protein 4.04 9554 B no similarity 6 BAC73061.1 Signal peptide CDS SAVERM_5350 6485437 6487158 hypothetical protein PF00746: Gram positive anchor 4.73 57333 B similar to unknown proteins 5 BAC73062.1 Non-secretory protein CDS SAVERM_5351 6487510 6488730 putative secreted protein 6.06 45233 B miscellaneous 4.7 BAC73063.1 Signal peptide CDS SAVERM_5352 6489893 6488769 hypothetical protein 10.72 41192 B similar to unknown proteins 5 BAC73064.1 Non-secretory protein CDS SAVERM_5353 6490564 6489890 putative secreted protein PF02706: Chain length determinant protein 10.65 22584 B similar to unknown proteins 5 BAC73065.1 Non-secretory protein CDS SAVERM_5354 6491739 6490564 putative glycosyltransferase PF00534: Glycosyl transferases group 1 8.86 41350 B specific pathways 2.1.1 BAC73066.1 Non-secretory protein CDS SAVERM_5355 6492448 6491750 putative polysaccharide deacetylase PF01522: Polysaccharide deacetylase 9.18 25499 B cell wall 1.1 BAC73067.1 Non-secretory protein CDS SAVERM_5356 6494279 6492519 putative membrane protein PF03023: MviN-like protein 9.9 60729 B miscellaneous 4.7 BAC73068.1 Non-secretory protein CDS SAVERM_5357 6495631 6494276 hypothetical protein PF04932: O-Antigen Polymerase 9.16 46090 B similar to unknown proteins 5 BAC73069.1 Signal peptide CDS SAVERM_5358 6497113 6495638 putative sugar transferase PF02397: Bacterial sugar transferase 11.1 52442 B miscellaneous 4.7 BAC73070.1 Non-secretory protein CDS SAVERM_5359 6498351 6497110 putative glycosyltransferase PF00534: Glycosyl transferases group 1 9.05 43981 B specific pathways 2.1.1 BAC73071.1 Non-secretory protein CDS SAVERM_5360 6499049 6499312 putative secreted protein 10.62 8291 B miscellaneous 4.7 BAC73072.1 Signal peptide CDS SAVERM_5361 6500109 6500495 melC1-2 putative tyrosinase co-factor protein second mel operon, PF06236: Tyrosinase co-factor MelC1 7.26 13554 B metabolism of coenzymes & prosthetic groups 2.5 BAC73073.1 Non-secretory protein CDS SAVERM_5362 6500482 6501345 melC2-2 putative tyrosinase second mel operon but not form melanin, PF00264: Common central domain of tyrosinase 10.17 33345 B metabolism of coenzymes & prosthetic groups 2.5 BAC73074.1 Non-secretory protein CDS SAVERM_5363 6501856 6503502 possible ATP-binding protein PF00350: Dynamin family 6.12 59217 B miscellaneous 4.7 BAC73075.1 Non-secretory protein CDS SAVERM_5364 6503805 6505673 putative ATP-binding protein PF01926: GTPase of unknown function 6.55 65633 B miscellaneous 4.7 BAC73076.1 Non-secretory protein CDS SAVERM_5365 6505871 6506347 ssb2 putative single-strand DNA-binding protein PF00436: Single-strand binding protein family 6.8 17111 B DNA replication 3.1 BAC73077.1 Non-secretory protein CDS SAVERM_5366 6506611 6508026 putative secreted protein PF05506: Domain of unknown function (DUF756) 4.35 47724 B similar to unknown proteins 5 BAC73078.1 Signal peptide CDS SAVERM_5367 6508321 6509964 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.04 60572 B transport / binding proteins & lipoproteins 1.2 BAC73079.1 Non-secretory protein CDS SAVERM_5368 6509967 6510377 hypothetical protein PF03061: Thioesterase superfamily 5.68 16133 B similar to unknown proteins 5 BAC73080.1 Non-secretory protein CDS SAVERM_5369 6510374 6511069 hypothetical protein 6.55 24263 B similar to unknown proteins 5 BAC73081.1 Non-secretory protein CDS SAVERM_5370 6511502 6511098 glbO putative globin-like protein PF01152: Bacterial-like globin 5.54 15654 B miscellaneous 4.7 BAC73082.1 Non-secretory protein CDS SAVERM_5371 6511654 6512634 putative O-methyltransferase PF01135: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 6.19 35733 B miscellaneous 4.7 BAC73083.1 Non-secretory protein CDS SAVERM_5372 6514113 6512668 hypothetical protein PF00498: FHA domain 4.89 48559 B similar to unknown proteins 5 BAC73084.1 Non-secretory protein CDS SAVERM_5373 6515595 6514219 hypothetical protein PF00092: von Willebrand factor type A domain 5.36 47993 B similar to unknown proteins 5 BAC73085.1 Non-secretory protein CDS SAVERM_5374 6517065 6515722 prpB10 putative magnesium or manganese-dependent protein phosphatase PF00481: Protein phosphatase 2C 4.41 46299 B protein modification 3.8 BAC73086.1 Non-secretory protein CDS SAVERM_5375 6519570 6517066 pkn26 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.52 89463 B protein modification 3.8 BAC73087.1 Non-secretory protein CDS SAVERM_5376 6520915 6519590 hypothetical protein 5.82 48340 B similar to unknown proteins 5 BAC73088.1 Non-secretory protein CDS SAVERM_5377 6522010 6521003 putative polar amino acid ABC transporter substrate-binding protein gltI, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.47 35911 B transport / binding proteins & lipoproteins 1.2 BAC73089.1 Non-secretory protein CDS SAVERM_5378 6523488 6522025 putative secreted protein PF05137: Fimbrial assembly protein (PilN) 6.74 51338 B miscellaneous 4.7 BAC73090.1 Non-secretory protein CDS SAVERM_5379 6524753 6523797 putative N-acetylglucosamine kinase PF01869: BadF/BadG/BcrA/BcrD ATPase family 6.27 32874 B miscellaneous 4.7 BAC73091.1 Non-secretory protein CDS SAVERM_5380 6526051 6524786 bglA2 putative 6-phospho-beta-glucosidase PF02056: Family 4 glycosyl hydrolase 5.17 44941 B miscellaneous 4.7 BAC73092.1 Non-secretory protein CDS SAVERM_5381 6526948 6526055 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.48 33236 B transport / binding proteins & lipoproteins 1.2 BAC73093.1 Non-secretory protein CDS SAVERM_5382 6527892 6526951 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.83 34778 B transport / binding proteins & lipoproteins 1.2 BAC73094.1 Signal peptide CDS SAVERM_5383 6529232 6527895 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 6.33 48003 B transport / binding proteins & lipoproteins 1.2 BAC73095.1 Signal peptide CDS SAVERM_5384 6530589 6529378 putative ROK-family transcriptional regulator PF00480: ROK family 6.01 41907 B regulation 3.5.2 BAC73096.1 Non-secretory protein CDS SAVERM_5385 6532160 6531060 putative membrane protein PF00924: Mechanosensitive ion channel 5.49 38532 B miscellaneous 4.7 BAC73097.1 Signal peptide CDS SAVERM_5386 6532474 6533010 putative endonuclease PF01844: HNH endonuclease 10.69 19744 B DNA modification & repair 3.2 BAC73098.1 Non-secretory protein CDS SAVERM_5387 6534508 6533165 putative ABC transporter permease protein Tat substrate, PF02687: Predicted permease 12.3 45997 B transport / binding proteins & lipoproteins 1.2 BAC73099.1 Non-secretory protein CDS SAVERM_5388 6535218 6534505 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.67 24676 B transport / binding proteins & lipoproteins 1.2 BAC73100.1 Non-secretory protein CDS SAVERM_5389 6535748 6535215 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 6 19108 B regulation 3.5.2 BAC73101.1 Non-secretory protein CDS SAVERM_5390 6535919 6536170 hypothetical protein 3.66 8146 B similar to unknown proteins 5 BAC73102.1 Non-secretory protein CDS SAVERM_5391 6536171 6538393 malQ putative 4-alpha-glucanotransferase PF02446: 4-alpha-glucanotransferase 5.15 79175 B miscellaneous 4.7 BAC73103.1 Non-secretory protein CDS SAVERM_5392 6538495 6538734 putative secreted protein 7.55 8068 B similar to unknown proteins 5 BAC73104.1 Signal peptide CDS SAVERM_5393 6539465 6538935 putative MarR-family transcriptional regulator PF01047: MarR family 5.06 19216 B regulation 3.5.2 BAC73105.1 Non-secretory protein CDS SAVERM_5394 6539576 6540685 putative secreted protein PF00892: Integral membrane protein DUF6 11.97 36920 B similar to unknown proteins 5 BAC73106.1 Non-secretory protein CDS SAVERM_5395 6543314 6540741 pepN2 putative aminopeptidase N PF01433: Peptidase family M1 4.43 94934 B protein modification 3.8 BAC73107.1 Non-secretory protein CDS SAVERM_5396 6543427 6543948 hypothetical protein PF06718: Protein of unknown function (DUF1203) 5.61 18910 B similar to unknown proteins 5 BAC73108.1 Non-secretory protein CDS SAVERM_5397 6545006 6543990 asd2 putative aspartate-semialdehyde dehydrogenase PF02774: Semialdehyde dehydrogenase, dimerisation domain 4.88 35357 B metabolism of amino acids & related molecules 2.2 BAC73109.1 Non-secretory protein CDS SAVERM_5398 6545341 6545880 sig46 putative RNA polymerase ECF-subfamily sigma factor PF04545: Sigma-70, region 4 7.86 19757 B RNA initiation 3.5.1 BAC73110.1 Non-secretory protein CDS SAVERM_5399 6545882 6546634 hypothetical protein 4.9 25860 B similar to unknown proteins 5 BAC73111.1 Non-secretory protein CDS SAVERM_5400 6550009 6546704 putative serine protease, secreted PF00082: Subtilase family 4.74 113003 B protein modification 3.8 BAC73112.1 Signal peptide CDS SAVERM_5401 6550801 6550265 hypothetical protein PF07336: Protein of unknown function (DUF1470) 6.24 19505 B similar to unknown proteins 5 BAC73113.1 Non-secretory protein CDS SAVERM_5402 6550921 6551373 gloA putative lactoylglutathione lyase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.55 16272 B specific pathways 2.1.1 BAC73114.1 Non-secretory protein CDS SAVERM_5403 6551389 6552270 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 9.49 31419 B similar to unknown proteins 5 BAC73115.1 Non-secretory protein CDS SAVERM_5404 6552280 6552738 hypothetical protein PF00293: NUDIX domain 8.49 16794 B similar to unknown proteins 5 BAC73116.1 Non-secretory protein CDS SAVERM_5405 6552981 6554771 putative secreted protein Tat substrate, PF00149: Calcineurin-like phosphoesterase 9.58 63292 B similar to unknown proteins 5 BAC73117.1 Signal peptide CDS SAVERM_5406 6556161 6554938 hypothetical protein PF01833: IPT/TIG domain 4.55 38574 B similar to unknown proteins 5 BAC73118.1 Non-secretory protein CDS SAVERM_5407 6556738 6556529 hypothetical protein PF04149: Domain of unknown function (DUF397) 5.68 7320 B similar to unknown proteins 5 BAC73119.1 Non-secretory protein CDS SAVERM_5408 6557630 6556743 putative DNA-binding protein 7.22 33608 B regulation 3.5.2 BAC73120.1 Non-secretory protein CDS SAVERM_5409 6557797 6558324 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.43 19238 B regulation 3.5.2 BAC73121.1 Non-secretory protein CDS SAVERM_5410 6559105 6558356 hypothetical protein 8.5 26918 B similar to unknown proteins 5 BAC73122.1 Non-secretory protein CDS SAVERM_5411 6562129 6559622 pepG putative aminopeptidase G PF01433: Peptidase family M1 4.68 92499 B protein modification 3.8 BAC73123.1 Non-secretory protein CDS SAVERM_5412 6562354 6562992 hypothetical protein PF01323: DSBA-like thioredoxin domain 4.48 23457 B similar to unknown proteins 5 BAC73124.1 Non-secretory protein CDS SAVERM_5413 6564064 6563423 sodF putative superoxide dismutase Fe-containing superoxide dismutase, PF02777: Iron/manganese superoxide dismutases, C-terminal domain 5.03 23524 B detoxification 4.2 BAC73125.1 Non-secretory protein CDS SAVERM_5414 6565593 6564205 putative amino acid permease PF00324: Amino acid permease 9.07 48772 B transport / binding proteins & lipoproteins 1.2 BAC73126.1 Non-secretory protein CDS SAVERM_5415 6566651 6565752 putative taurine catabolism dioxygenase PF02668: Taurine catabolism dioxygenase TauD, TfdA family 5.75 32831 B miscellaneous 4.7 BAC73127.1 Non-secretory protein CDS SAVERM_5416 6568027 6566666 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 6.52 49755 B detoxification 4.2 BAC73128.1 Non-secretory protein CDS SAVERM_5417 6568776 6568024 ssuB6 putative ABC transporter ATP-binding protein sulfonate/nitrate/taurine transport system ATP-binding protein, PF00005: ABC transporter 6.25 27487 B transport / binding proteins & lipoproteins 1.2 BAC73129.1 Non-secretory protein CDS SAVERM_5418 6569624 6568752 ssuC6 putative ABC transporter permease protein sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 11.02 31176 B transport / binding proteins & lipoproteins 1.2 BAC73130.1 Non-secretory protein CDS SAVERM_5419 6570703 6569630 ssuA6 putative ABC transporter substrate-binding protein sulfonate/nitrate/taurine transport system substrate-binding protein, Tat substrate, PF09084: NMT1/THI5 like 9.98 38167 B transport / binding proteins & lipoproteins 1.2 BAC73131.1 Signal peptide CDS SAVERM_5420 6572269 6571037 putative ROK-family transcriptional regulator PF00480: ROK family 8.87 42665 B regulation 3.5.2 BAC73132.1 Non-secretory protein CDS SAVERM_5421 6572704 6573285 bioY putative biotin synthase PF02632: BioY family 10.98 18934 B metabolism of coenzymes & prosthetic groups 2.5 BAC73133.1 Non-secretory protein CDS SAVERM_5422 6574636 6573275 putative FAD-dependent oxygenase PF01565: FAD binding domain 5.76 47756 B miscellaneous 4.7 BAC73134.1 Non-secretory protein CDS SAVERM_5423 6575474 6574704 putative secreted protein 9.8 26062 B no similarity 6 BAC73135.1 Signal peptide CDS SAVERM_5424 6575595 6578006 pkn27 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 6.33 82197 B protein modification 3.8 BAC73136.1 Non-secretory protein CDS SAVERM_5425 6579576 6578092 gabP putative gamma-aminobutyrate permease PF00324: Amino acid permease 7.66 51889 B transport / binding proteins & lipoproteins 1.2 BAC73137.1 Non-secretory protein CDS SAVERM_5426 6579813 6580292 rpiB2 putative ribose-5-phosphate isomerase PF02502: Ribose/Galactose Isomerase 5.18 17082 B main glycolytic pathways 2.1.2 BAC73138.1 Non-secretory protein CDS SAVERM_5427 6580410 6581219 nei2 putative endonuclease VIII and DNA N-glycosylase with an AP lyase activity involved in DNA repair; nick DNA at apurinic/apyrimidinic sites. PF01149: Formamidopyrimidine-DNA glycosylase N-terminal domain 7.96 29714 B DNA modification & repair 3.2 BAC73139.1 Non-secretory protein CDS SAVERM_5428 6582576 6581347 hypothetical protein PF00583: Acetyltransferase (GNAT) family 5.96 44815 B similar to unknown proteins 5 BAC73140.1 Non-secretory protein CDS SAVERM_5429 6582735 6583910 prpB11 putative magnesium or manganese-dependent protein phosphatase membrane protein 8.1 41560 B protein modification 3.8 BAC73141.1 Non-secretory protein CDS SAVERM_5430 6584175 6585122 putative ABC transporter ATP-binding protein PF00005: ABC transporter 11.65 32822 B transport / binding proteins & lipoproteins 1.2 BAC73142.1 Non-secretory protein CDS SAVERM_5431 6585128 6587572 putative ABC transporter permease protein PF02687: Predicted permease 10.76 83058 B transport / binding proteins & lipoproteins 1.2 BAC73143.1 Non-secretory protein CDS SAVERM_5432 6587774 6588106 hypothetical protein 4.76 11480 B no similarity 6 BAC73144.1 Non-secretory protein CDS SAVERM_5433 6588160 6588474 hypothetical protein 5.88 11024 B no similarity 6 BAC73145.1 Non-secretory protein CDS SAVERM_5434 6588533 6588928 hypothetical protein 6.09 13335 B no similarity 6 BAC73146.1 Non-secretory protein CDS SAVERM_5435 6588925 6591399 hypothetical protein PF03496: Clostridial binary toxin A 5.17 86654 B similar to unknown proteins 5 BAC73147.1 Non-secretory protein CDS SAVERM_5436 6591450 6591863 hypothetical protein 4.43 14671 B no similarity 6 BAC73148.1 Non-secretory protein CDS SAVERM_5437 6591994 6592602 hypothetical protein 9.72 21664 B no similarity 6 BAC73149.1 Non-secretory protein CDS SAVERM_5438 6592636 6593160 hypothetical protein PF01966: HD domain 7.67 18578 B similar to unknown proteins 5 BAC73150.1 Non-secretory protein CDS SAVERM_5439 6593497 6593234 hypothetical protein 9.41 9659 B no similarity 6 BAC73151.1 Signal peptide CDS SAVERM_5440 6593623 6594978 hypothetical protein PF04600: Protein of unknown function (DUF571) 9.99 46389 B similar to unknown proteins 5 BAC73152.1 Non-secretory protein CDS SAVERM_5441 6595249 6596349 hypothetical protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 10.63 38888 B similar to unknown proteins 5 BAC73153.1 Non-secretory protein CDS SAVERM_5442 6596371 6600345 putative FtsK/SpoIIIE family protein PF01580: FtsK/SpoIIIE family 5.27 143400 B cell division 1.7 BAC73154.1 Non-secretory protein CDS SAVERM_5443 6600481 6601911 hypothetical protein 4.76 50471 B no similarity 6 BAC73155.1 Non-secretory protein CDS SAVERM_5444 6603157 6602030 hypothetical protein PF01757: acyltransferase family 9.87 42708 B similar to unknown proteins 5 BAC73156.1 Non-secretory protein CDS SAVERM_5445 6603863 6604057 putative secreted protein 9.69 6621 B similar to unknown proteins 5 BAC73157.1 Non-secretory protein CDS SAVERM_5446 6604924 6606315 tig putative cell division trigger factor PF05697: Bacterial trigger factor protein (TF) 4.02 50615 B cell division 1.7 BAC73158.1 Non-secretory protein CDS SAVERM_5447 6607644 6608303 clpP1 putative ATP-dependent Clp protease proteolytic subunit 1 PF00574: Clp protease 5.65 23204 B adaptation to atypical conditions 4.1 BAC73159.1 Non-secretory protein CDS SAVERM_5448 6608414 6609094 clpP2 putative ATP-dependent Clp protease proteolytic subunit 2 PF00574: Clp protease 4.72 24919 B adaptation to atypical conditions 4.1 BAC73160.1 Non-secretory protein CDS SAVERM_5449 6609255 6610541 clpX2 putative ATP-dependent Clp Protease ATP binding subunit PF07724: ATPase family associated with various cellular activities (AAA) 4.78 46868 B adaptation to atypical conditions 4.1 BAC73161.1 Non-secretory protein CDS SAVERM_5450 6611620 6610652 putative membrane protein PF00107: Zinc-binding dehydrogenase 6 33125 B miscellaneous 4.7 BAC73162.1 Non-secretory protein CDS SAVERM_5451 6611757 6614381 valS putative valyl-tRNA synthetase PF00133: tRNA synthetases class I (I, L, M and V) 4.91 97527 B aminoacyl-tRNA-synthetase 3.7.2 BAC73163.1 Non-secretory protein CDS SAVERM_5452 6614987 6616348 folC putative folylpolyglutamate synthase PF01225: Mur ligase family, catalytic domain 4.26 48037 B metabolism of coenzymes & prosthetic groups 2.5 BAC73164.1 Non-secretory protein CDS SAVERM_5453 6616354 6616722 hypothetical protein 7.35 12763 B similar to unknown proteins 5 BAC73165.1 Non-secretory protein CDS SAVERM_5454 6616789 6617202 ndkA putative nucleoside diphosphate kinase PF00334: Nucleoside diphosphate kinase 5.29 15048 B metabolism of nucleotides & nucleic acids 2.3 BAC73166.1 Non-secretory protein CDS SAVERM_5455 6617490 6618521 mreB1 putative rod shape-determining protein PF06723: MreB/Mbl protein 5.73 36607 B cell wall 1.1 BAC73167.1 Non-secretory protein CDS SAVERM_5456 6618682 6619626 mreC putative rod shape-determining protein PF04085: rod shape-determining protein MreC 9.45 32905 B cell wall 1.1 BAC73168.1 Non-secretory protein CDS SAVERM_5457 6619640 6620311 mreD putative rod shape-determining protein PF04093: rod shape-determining protein MreD 11.14 22463 B cell wall 1.1 BAC73169.1 Signal peptide CDS SAVERM_5458 6620398 6622647 pbp10 putative penicillin-binding protein PF00905: Penicillin binding protein transpeptidase domain 9.45 81612 B cell wall 1.1 BAC73170.1 Non-secretory protein CDS SAVERM_5459 6622682 6623878 ftsW2 putative cell division membrane protein PF01098: Cell cycle protein 8.42 42374 B cell division 1.7 BAC73171.1 Non-secretory protein CDS SAVERM_5460 6624084 6625607 hypothetical protein PF05235: CHAD domain 10.34 55585 B similar to unknown proteins 5 BAC73172.1 Non-secretory protein CDS SAVERM_5461 6625678 6627636 hypothetical protein PF04055: Radical SAM superfamily 4.8 73051 B similar to unknown proteins 5 BAC73173.1 Non-secretory protein CDS SAVERM_5462 6629124 6627793 putative secreted protein 8.45 46773 B similar to unknown proteins 5 BAC73174.1 Signal peptide CDS SAVERM_5463 6629472 6630719 putative integral membrane protein 12.37 45462 B miscellaneous 4.7 BAC73175.1 Non-secretory protein CDS SAVERM_5464 6630766 6631560 hypothetical protein PF10105: Uncharacterized protein conserved in bacteria (DUF2344) 5.78 28415 B similar to unknown proteins 5 BAC73176.1 Non-secretory protein CDS SAVERM_5465 6631806 6635969 hypothetical protein PF00575: S1 RNA binding domain 4.88 146080 B similar to unknown proteins 5 BAC73177.1 Non-secretory protein CDS SAVERM_5466 6636201 6637550 putative secreted protein 8.98 48663 B no similarity 6 BAC73178.1 Signal peptide CDS SAVERM_5467 6637749 6638069 rplU putative ribosomal protein L21 PF00829: Ribosomal prokaryotic L21 protein 10 11637 B ribosomal protein 3.7.1 BAC73179.1 Non-secretory protein CDS SAVERM_5468 6638084 6638338 rpmA putative ribosomal protein L27 PF01016: Ribosomal L27 protein 12.03 8877 B ribosomal protein 3.7.1 BAC73180.1 Non-secretory protein CDS SAVERM_5469 6638508 6639947 obg putative GTP-binding protein PF01018: GTP1/OBG 4.97 51071 B sporulation 1.8 BAC73181.1 Non-secretory protein CDS SAVERM_5470 6642423 6640249 hypothetical protein PF03810: Importin-beta N-terminal domain 7.14 78336 B similar to unknown proteins 5 BAC73182.1 Non-secretory protein CDS SAVERM_5471 6642604 6643731 proB putative glutamate 5-kinase PF00696: Amino acid kinase family 9.05 39138 B metabolism of amino acids & related molecules 2.2 BAC73183.1 Non-secretory protein CDS SAVERM_5472 6643870 6644415 hypothetical protein PF05671: GETHR pentapeptide repeat (5 copies) 4.97 20100 B similar to unknown proteins 5 BAC73184.1 Non-secretory protein CDS SAVERM_5473 6644624 6645910 proA putative gamma-glutamyl phosphate reductase PF00171: Aldehyde dehydrogenase family 4.73 45262 B metabolism of amino acids & related molecules 2.2 BAC73185.1 Non-secretory protein CDS SAVERM_5474 6645936 6646688 hypothetical protein 4.38 26709 B similar to unknown proteins 5 BAC73186.1 Non-secretory protein CDS SAVERM_5475 6646898 6647965 putative membrane protein PF00866: Ring hydroxylating beta subunit 6.29 37835 B miscellaneous 4.7 BAC73187.1 Non-secretory protein CDS SAVERM_5476 6649241 6648111 putative family M48 peptidase PF01435: Peptidase family M48 6.15 41047 B similar to unknown proteins 5 BAC73188.1 Non-secretory protein CDS SAVERM_5477 6649647 6649811 hypothetical protein 6.22 5883 B similar to unknown proteins 5 BAC73189.1 Non-secretory protein CDS SAVERM_5478 6649972 6650646 nadD putative nicotinate-nucleotide adenylyltransferase PF01467: Cytidylyltransferase 5.56 24189 B metabolism of coenzymes & prosthetic groups 2.5 BAC73190.1 Non-secretory protein CDS SAVERM_5479 6650663 6652465 putative membrane protein PF03816: Cell envelope-related transcriptional attenuator domain 4.36 63191 B miscellaneous 4.7 BAC73191.1 Non-secretory protein CDS SAVERM_5480 6652631 6653077 hypothetical protein PF02410: Domain of unknown function DUF143 4.4 16532 B similar to unknown proteins 5 BAC73192.1 Non-secretory protein CDS SAVERM_5481 6653074 6653748 gpmA2 putative 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase PF00300: Phosphoglycerate mutase family 6.31 24119 B main glycolytic pathways 2.1.2 BAC73193.1 Non-secretory protein CDS SAVERM_5482 6654909 6654016 putative DNA-binding protein PF01381: Helix-turn-helix 7.22 33237 B regulation 3.5.2 BAC73194.1 Non-secretory protein CDS SAVERM_5483 6655058 6656494 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 10.25 48737 B transport / binding proteins & lipoproteins 1.2 BAC73195.1 Non-secretory protein CDS SAVERM_5484 6656741 6656974 hypothetical protein 5.61 9013 B similar to unknown proteins 5 BAC73196.1 Non-secretory protein CDS SAVERM_5485 6658167 6656953 hypothetical protein PF09594: Protein of unknown function (DUF2029) 10.33 43046 B similar to unknown proteins 5 BAC73197.1 Non-secretory protein CDS SAVERM_5486 6660078 6658504 putative oxidoreductase PF01512: Respiratory-chain NADH dehydrogenase 51 Kd subunit 8.84 54787 B miscellaneous 4.7 BAC73198.1 Non-secretory protein CDS SAVERM_5487 6661424 6660114 putative integral membrane protein PF05252: Uncharacterised protein family (UPF0191) 8.56 45359 B miscellaneous 4.7 BAC73199.1 Non-secretory protein CDS SAVERM_5488 6661895 6664783 leuS putative leucyl-tRNA synthetase PF00133: tRNA synthetases class I (I, L, M and V) 4.76 106569 B aminoacyl-tRNA-synthetase 3.7.2 BAC73200.1 Non-secretory protein CDS SAVERM_5489 6664923 6665660 putative secreted protein 7.1 26992 B miscellaneous 4.7 BAC73201.1 Non-secretory protein CDS SAVERM_5490 6665733 6666578 hypothetical protein PF02645: Uncharacterized protein, DegV family COG1307 6.9 29280 B similar to unknown proteins 5 BAC73202.1 Non-secretory protein CDS SAVERM_5491 6666768 6667931 comEA putative exogenous DNA-binding protein PF00633: Helix-hairpin-helix motif 10.9 39122 B regulation 3.5.2 BAC73203.1 Non-secretory protein CDS SAVERM_5492 6667928 6670450 putative membrane protein PF03772: Competence protein 11.25 86517 B transformation & competence 1.1 BAC73204.1 Non-secretory protein CDS SAVERM_5493 6670511 6670789 hypothetical protein 4.42 10747 B phage-related functions 4.4 BAC73205.1 Non-secretory protein CDS SAVERM_5494 6671196 6671525 hypothetical protein 3.73 11501 B phage-related functions 4.4 BAC73206.1 Non-secretory protein CDS SAVERM_5495 6671918 6671598 hypothetical protein 4.41 11801 B phage-related functions 4.4 BAC73207.1 Non-secretory protein CDS SAVERM_5496 6672387 6672034 hypothetical protein 6.79 12530 B phage-related functions 4.4 BAC73208.1 Non-secretory protein CDS SAVERM_5497 6672529 6673287 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.41 28200 B regulation 3.5.2 BAC73209.1 Non-secretory protein CDS SAVERM_5498 6674246 6673473 putative N-acetylmuramoyl-L-alanine amidase precursor prophage genome, similar to phage structural protein, PF01510: N-acetylmuramoyl-L-alanine amidase 9.46 27704 B phage-related functions 4.4 BAC73210.1 Non-secretory protein CDS SAVERM_5499 6674634 6674323 hypothetical protein prophage genome 10.5 11944 B phage-related functions 4.4 BAC73211.1 Non-secretory protein CDS SAVERM_5500 6674873 6674649 hypothetical protein prophage genome 10.45 8377 B phage-related functions 4.4 BAC73212.1 Non-secretory protein CDS SAVERM_5501 6675222 6674875 hypothetical protein prophage genome 5.09 12334 B phage-related functions 4.4 BAC73213.1 Non-secretory protein CDS SAVERM_5502 6676260 6675313 hypothetical protein prophage genome 6.32 34211 B phage-related functions 4.4 BAC73214.1 Non-secretory protein CDS SAVERM_5503 6676564 6676364 hypothetical protein prophage genome 4.78 7459 B phage-related functions 4.4 BAC73215.1 Non-secretory protein CDS SAVERM_5504 6678273 6676585 hypothetical protein prophage genome 5.08 58060 B phage-related functions 4.4 BAC73216.1 Non-secretory protein CDS SAVERM_5505 6679331 6678303 hypothetical protein prophage genome, similar to phage structure protein 5.99 35986 B phage-related functions 4.4 BAC73217.1 Non-secretory protein CDS SAVERM_5506 6680535 6679345 putative phage tail protein prophage genome, similar to phage tail protein 4.77 41725 B phage-related functions 4.4 BAC73218.1 Non-secretory protein CDS SAVERM_5507 6681474 6680539 putative phage tail protein prophage genome, PF05709: Phage tail protein 4.3 33507 B phage-related functions 4.4 BAC73219.1 Non-secretory protein CDS SAVERM_5508 6684924 6681496 putative phage minor tail protein prophage genome, similar to phage tail protein 10.59 117482 B phage-related functions 4.4 BAC73220.1 Non-secretory protein CDS SAVERM_5509 6685366 6684968 hypothetical protein prophage genome 5.63 15072 B phage-related functions 4.4 BAC73221.1 Non-secretory protein CDS SAVERM_5510 6685797 6685465 hypothetical protein prophage genome 4.48 12355 B phage-related functions 4.4 BAC73222.1 Non-secretory protein CDS SAVERM_5511 6686568 6685951 putative phage major tail protein prophage genome, similar to phage structure protein 4.29 22398 B phage-related functions 4.4 BAC73223.1 Non-secretory protein CDS SAVERM_5512 6687072 6686629 hypothetical protein prophage genome 5.68 15988 B phage-related functions 4.4 BAC73224.1 Non-secretory protein CDS SAVERM_5513 6687330 6687091 hypothetical protein prophage genome 5.13 8726 B phage-related functions 4.4 BAC73225.1 Non-secretory protein CDS SAVERM_5514 6687618 6687334 putative phage protein prophage genome, PF04883: Bacteriophage protein of unknown function (DUF646) 4.11 10171 B phage-related functions 4.4 BAC73226.1 Non-secretory protein CDS SAVERM_5515 6687959 6687618 hypothetical protein prophage genome 4.55 12699 B phage-related functions 4.4 BAC73227.1 Non-secretory protein CDS SAVERM_5516 6688358 6687963 hypothetical protein prophage genome 4.33 13890 B phage-related functions 4.4 BAC73228.1 Non-secretory protein CDS SAVERM_5517 6688713 6688378 hypothetical protein prophage genome 7.36 11451 B phage-related functions 4.4 BAC73229.1 Non-secretory protein CDS SAVERM_5518 6690066 6688744 hypothetical protein prophage genome 4.47 45266 B phage-related functions 4.4 BAC73230.1 Non-secretory protein CDS SAVERM_5519 6690711 6690082 putative phage minor structural protein prophage genome, PF06810: Phage minor structural protein GP20 5.45 21967 B phage-related functions 4.4 BAC73231.1 Non-secretory protein CDS SAVERM_5520 6692330 6690753 putative phage minor capsid protein prophage genome, PF05133: Phage portal protein, SPP1 Gp6-like 4.61 57723 B phage-related functions 4.4 BAC73232.1 Non-secretory protein CDS SAVERM_5521 6693625 6692327 putative phage-related terminase prophage genome, PF03237: Terminate-like family, PF04466: Phage terminase large subunit 7.37 48199 B phage-related functions 4.4 BAC73233.1 Non-secretory protein CDS SAVERM_5522 6694117 6693629 putative cell-cycle regulator prophage genome, PF07750: GcrA cell cycle regulator 5.63 18280 B phage-related functions 4.4 BAC73234.1 Non-secretory protein CDS SAVERM_5523 6694850 6694605 hypothetical protein prophage genome 7.36 9396 B phage-related functions 4.4 BAC73235.1 Non-secretory protein CDS SAVERM_5524 6695024 6695500 hypothetical protein prophage genome 4.21 16939 B phage-related functions 4.4 BAC73236.1 Non-secretory protein CDS SAVERM_5525 6695725 6695516 hypothetical protein prophage genome 10.59 7870 B phage-related functions 4.4 BAC73237.1 Non-secretory protein CDS SAVERM_5526 6696484 6695861 hypothetical protein prophage genome 4.89 23058 B phage-related functions 4.4 BAC73238.1 Non-secretory protein CDS SAVERM_5527 6697143 6696583 hypothetical protein prophage genome 6.63 21085 B phage-related functions 4.4 BAC73239.1 Non-secretory protein CDS SAVERM_5528 6697772 6697257 hypothetical protein prophage genome 10.58 18176 B phage-related functions 4.4 BAC73240.1 Non-secretory protein CDS SAVERM_5529 6698022 6697861 hypothetical protein prophage genome 4.06 5671 B phage-related functions 4.4 BAC73241.1 Non-secretory protein CDS SAVERM_5530 6698700 6698032 hypothetical protein prophage genome 9.17 23814 B phage-related functions 4.4 BAC73242.1 Non-secretory protein CDS SAVERM_5531 6699254 6698718 hypothetical protein prophage genome 10.73 17451 B phage-related functions 4.4 BAC73243.1 Non-secretory protein CDS SAVERM_5532 6699643 6699251 hypothetical protein prophage genome 8.08 14453 B phage-related functions 4.4 BAC73244.1 Non-secretory protein CDS SAVERM_5533 6700657 6699713 hypothetical protein prophage genome 4.6 32899 B phage-related functions 4.4 BAC73245.1 Non-secretory protein CDS SAVERM_5534 6701424 6700777 hypothetical protein prophage genome 6.64 23931 B phage-related functions 4.4 BAC73246.1 Non-secretory protein CDS SAVERM_5535 6702266 6702042 hypothetical protein prophage genome 4.93 7932 B phage-related functions 4.4 BAC73247.1 Non-secretory protein CDS SAVERM_5536 6703810 6702263 savM2 putative type II restriction-modification system DNA cytosine-specific methylase prophage genome, PF00145: C-5 cytosine-specific DNA methylase 9.81 56540 B DNA modification & repair 3.2 BAC73248.1 Non-secretory protein CDS SAVERM_5537 6704228 6703791 hypothetical protein prophage genome 4.24 16461 B phage-related functions 4.4 BAC73249.1 Non-secretory protein CDS SAVERM_5538 6704467 6704225 hypothetical protein prophage genome 3.97 9130 B phage-related functions 4.4 BAC73250.1 Non-secretory protein CDS SAVERM_5539 6704691 6704464 hypothetical protein prophage genome 7.69 8288 B phage-related functions 4.4 BAC73251.1 Non-secretory protein CDS SAVERM_5540 6705548 6704688 putative phage-associated antirepressor prophage genome, PF02498: BRO family, N-terminal domain 9.18 31821 B phage-related functions 4.4 BAC73252.1 Non-secretory protein CDS SAVERM_5541 6705772 6707229 hypothetical protein prophage genome 6.73 52296 B phage-related functions 4.4 BAC73253.1 Non-secretory protein CDS SAVERM_5542 6707666 6708007 hypothetical protein prophage genome 4.96 12305 B phage-related functions 4.4 BAC73254.1 Non-secretory protein CDS SAVERM_5543 6708308 6708553 hypothetical protein prophage genome 4.11 9054 B phage-related functions 4.4 BAC73255.1 Non-secretory protein CDS SAVERM_5544 6708562 6708810 hypothetical protein prophage genome 4.27 9126 B phage-related functions 4.4 BAC73256.1 Non-secretory protein CDS SAVERM_5545 6708789 6708980 hypothetical protein prophage genome 4.76 7272 B phage-related functions 4.4 BAC73257.1 Non-secretory protein CDS SAVERM_5546 6709042 6709416 hypothetical protein prophage genome 11.71 13852 B phage-related functions 4.4 BAC73258.1 Non-secretory protein CDS SAVERM_5547 6709505 6710344 hypothetical protein prophage genome 5.73 30347 B phage-related functions 4.4 BAC73259.1 Non-secretory protein CDS SAVERM_5548 6711848 6710346 int13 putative serine-family recombinase/integrase prophage genome, PF07508: Recombinase 8.81 56685 B phage-related functions 4.4 BAC73260.1 Non-secretory protein CDS SAVERM_5549 6712190 6712546 hypothetical protein 4.79 12780 B phage-related functions 4.4 BAC73261.1 Non-secretory protein CDS SAVERM_5550 6713059 6712793 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.04 9359 B phage-related functions 4.4 BAC73262.1 Non-secretory protein CDS SAVERM_5551 6713593 6714810 hypothetical protein PF01381: Helix-turn-helix 6.03 43853 B phage-related functions 4.4 BAC73263.1 Non-secretory protein CDS SAVERM_5552 6715797 6715156 spdA3 putative transfer protein spdA PF10935: Protein of unknown function (DUF2637) 4.93 22715 B phage-related functions 4.4 BAC73264.1 Signal peptide CDS SAVERM_5553 6717978 6717295 hypothetical protein 4.72 24228 B phage-related functions 4.4 BAC73265.1 Non-secretory protein CDS SAVERM_5554 6719781 6719527 hypothetical protein 6.69 9635 B phage-related functions 4.4 BAC73266.1 Non-secretory protein CDS SAVERM_5555 6721444 6719828 int14 putative serine-family recombinase/integrase PF07508: Recombinase 8.9 59893 B phage-related functions 4.4 BAC73267.1 Non-secretory protein CDS SAVERM_5556 6721702 6722541 nhoA putative N-hydroxyarylamine O-acetyltransferase PF00797: N-acetyltransferase 5.83 30437 B miscellaneous 4.7 BAC73268.1 Non-secretory protein CDS SAVERM_5557 6722688 6722933 hypothetical protein 3.85 9244 B similar to unknown proteins 5 BAC73269.1 Non-secretory protein CDS SAVERM_5558 6723063 6724073 holA putative DNA polymerase III delta subunit PF06144: DNA polymerase III, delta subunit 5.98 34934 B regulation 3.5.2 BAC73270.1 Non-secretory protein CDS SAVERM_5559 6724127 6724297 hypothetical protein 11.71 6123 B no similarity 6 BAC73271.1 Non-secretory protein CDS SAVERM_5560 6724827 6724561 rpsT putative ribosomal protein S20 PF01649: Ribosomal protein S20 11.67 9496 B ribosomal protein 3.7.1 BAC73272.1 Non-secretory protein CDS SAVERM_5561 6725081 6726949 lepA putative GTP-binding elongation factor PF06421: GTP-binding protein LepA C-terminus 5.13 68232 B elongation 3.7.4 BAC73273.1 Non-secretory protein CDS SAVERM_5562 6727208 6729118 fadD12 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 5.16 68077 B metabolism of lipids 2.4 BAC73274.1 Non-secretory protein CDS SAVERM_5563 6729881 6729297 putative two-component system response regulator PF00072: Response regulator receiver domain 5.41 22055 B regulation 3.5.2 BAC73275.1 Non-secretory protein CDS SAVERM_5564 6734045 6729894 putative two-component system sensor kinase PF00672: HAMP domain 4.75 149844 B sensors 1.3 BAC73276.1 Non-secretory protein CDS SAVERM_5565 6734148 6736367 prpK putative magnesium or manganese-dependent protein phosphatase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.71 77478 B protein modification 3.8 BAC73277.1 Non-secretory protein CDS SAVERM_5566 6736403 6737635 hemN putative oxygen-independent coproporphyrinogen III oxidase PF06969: HemN C-terminal region 4.81 44236 B metabolism of coenzymes & prosthetic groups 2.5 BAC73278.1 Non-secretory protein CDS SAVERM_5567 6738484 6737672 hypothetical protein PF11296: Protein of unknown function (DUF3097) 6.26 29449 B similar to unknown proteins 5 BAC73279.1 Non-secretory protein CDS SAVERM_5568 6739318 6738590 blaB3 putative metallo-beta-lactamase PF00753: Metallo-beta-lactamase superfamily 4.85 25583 B detoxification 4.2 BAC73280.1 Non-secretory protein CDS SAVERM_5569 6739510 6740526 hrcA putative HrcA-family heat-inducible transcriptional repressor protein negatively regulate the transcription of heat shock genes 5.02 36661 B regulation 3.5.2 BAC73281.1 Non-secretory protein CDS SAVERM_5570 6740527 6741663 dnaJ3 putative heat shock protein DnaJ another copy of dnaJ; PF01556: DnaJ C terminal region 6.41 40566 B adaptation to atypical conditions 4.1 BAC73282.1 Non-secretory protein CDS SAVERM_5571 6741854 6742927 putative dioxygenase PF03060: 2-nitropropane dioxygenase 6.04 36693 B detoxification 4.2 BAC73283.1 Non-secretory protein CDS SAVERM_5572 6742924 6743673 sdrD putative protein involving differentiation PF04452: Protein of unknown function (DUF558) 6.25 26369 B miscellaneous 4.7 BAC73284.1 Non-secretory protein CDS SAVERM_5573 6743895 6744527 putative lipoprotein 11.06 22233 B transport / binding proteins & lipoproteins 1.2 BAC73285.1 Non-secretory protein CDS SAVERM_5574 6744599 6747820 pepD4 putative tricorn core peptidase PF03572: Peptidase family S41 5.52 115556 B protein modification 3.8 BAC73286.1 Non-secretory protein CDS SAVERM_5575 6747919 6748272 putative Hit-like protein PF01230: HIT domain 6.13 12395 B protein modification 3.8 BAC73287.1 Non-secretory protein CDS SAVERM_5576 6748279 6749184 putative hydrolase PF00753: Metallo-beta-lactamase superfamily 6.77 33264 B miscellaneous 4.7 BAC73288.1 Non-secretory protein CDS SAVERM_5577 6749205 6750206 add5 putative adenosine deaminase PF00962: Adenosine/AMP deaminase 4.59 37071 B metabolism of nucleotides & nucleic acids 2.3 BAC73289.1 Non-secretory protein CDS SAVERM_5578 6751508 6750219 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.92 42172 B transport / binding proteins & lipoproteins 1.2 BAC73290.1 Non-secretory protein CDS SAVERM_5579 6752531 6751740 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 5.99 28624 B regulation 3.5.2 BAC73291.1 Non-secretory protein CDS SAVERM_5580 6752657 6753652 dapA3 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 5.05 34707 B metabolism of amino acids & related molecules 2.2 BAC73292.1 Non-secretory protein CDS SAVERM_5581 6753649 6755235 gudD putative glucarate dehydratase PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain 5.34 56102 B metabolism of amino acids & related molecules 2.2 BAC73293.1 Non-secretory protein CDS SAVERM_5582 6755232 6756341 putative carbohydrate kinase PF00294: pfkB family carbohydrate kinase 4.54 38831 B miscellaneous 4.7 BAC73294.1 Non-secretory protein CDS SAVERM_5583 6756537 6757604 phoH putative phosphate starvation-induced protein PF02562: PhoH-like protein 6.88 38700 B metabolism of phosphates 2.6 BAC73295.1 Non-secretory protein CDS SAVERM_5584 6757634 6758131 hypothetical protein PF02130: Uncharacterized protein family UPF0054 3.99 18173 B similar to unknown proteins 5 BAC73296.1 Non-secretory protein CDS SAVERM_5585 6758128 6759435 putative transport protein PF00571: CBS domain 4.6 46979 B transport / binding proteins & lipoproteins 1.2 BAC73297.1 Non-secretory protein CDS SAVERM_5586 6759432 6759791 putative MmcQ-like protein PF04237: Protein of unknown function (DUF419) 5.22 13659 B miscellaneous 4.7 BAC73298.1 Non-secretory protein CDS SAVERM_5587 6761222 6759753 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 6.52 49783 B transport / binding proteins & lipoproteins 1.2 BAC73299.1 Non-secretory protein CDS SAVERM_5588 6761429 6762298 putative DNA-binding protein PF01381: Helix-turn-helix 6.26 32318 B regulation 3.5.2 BAC73300.1 Non-secretory protein CDS SAVERM_5589 6762340 6762693 hypothetical protein 4.63 11617 B similar to unknown proteins 5 BAC73301.1 Non-secretory protein CDS SAVERM_5590 6763077 6763556 putative secreted protein 6.43 15364 B no similarity 6 BAC73302.1 Signal peptide CDS SAVERM_5591 6763798 6765120 putative secreted protein 6.76 43037 B similar to unknown proteins 5 BAC73303.1 Signal peptide CDS SAVERM_5592 6765261 6766292 putative secreted protein 11.95 36624 B similar to unknown proteins 5 BAC73304.1 Signal peptide CDS SAVERM_5593 6766509 6766171 glnB2 putative nitrogen regulatory protein P-II regulatory protein for glutamine synthetase; glnB-homolog; PF00543: Nitrogen regulatory protein P-II 6.54 12183 B regulation 3.5.2 BAC73305.1 Non-secretory protein CDS SAVERM_5594 6767816 6766506 amtB2 putative ammonium transporter PF00909: Ammonium Transporter Family 6.34 44451 B transport / binding proteins & lipoproteins 1.2 BAC73306.1 Non-secretory protein CDS SAVERM_5595 6767983 6768975 era putative GTP-binding protein Era/ThdF family PF01926: GTPase of unknown function 6.73 35955 B miscellaneous 4.7 BAC73307.1 Non-secretory protein CDS SAVERM_5596 6769886 6769041 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.46 29369 B miscellaneous 4.7 BAC73308.1 Non-secretory protein CDS SAVERM_5597 6771194 6769929 putative membrane protein PF07690: Major Facilitator Superfamily 10.7 43903 B miscellaneous 4.7 BAC73309.1 Non-secretory protein CDS SAVERM_5598 6772516 6771191 bglC3 putative beta-glucosidase PF00232: Glycosyl hydrolase family 1 4.83 48741 B specific pathways 2.1.1 BAC73310.1 Non-secretory protein CDS SAVERM_5599 6772829 6772563 hypothetical protein 6.53 9431 B similar to unknown proteins 5 BAC73311.1 Non-secretory protein CDS SAVERM_5600 6773953 6772883 putative metalloprotease PF02868: Thermolysin metallopeptidase, alpha-helical domain 4.88 38486 B protein modification 3.8 BAC73312.1 Non-secretory protein CDS SAVERM_5601 6774328 6776049 leuA2 putative 2-isopropylmalate synthase PF00682: HMGL-like 4.61 63564 B metabolism of amino acids & related molecules 2.2 BAC73313.1 Non-secretory protein CDS SAVERM_5602 6776234 6776959 hypothetical protein PF05099: Tellurite resistance protein TerB 7.06 25157 B similar to unknown proteins 5 BAC73314.1 Non-secretory protein CDS SAVERM_5603 6777171 6779249 putative membrane protein Tat substrate, PF03176: MMPL family 6.34 72021 B miscellaneous 4.7 BAC73315.1 Signal peptide CDS SAVERM_5604 6779296 6780648 putative two-component system sensor kinase PF07730: Histidine kinase 7.41 47810 B sensors 1.3 BAC73316.1 Non-secretory protein CDS SAVERM_5605 6780660 6781343 putative two-component system response regulator PF00072: Response regulator receiver domain 4.71 23870 B regulation 3.5.2 BAC73317.1 Non-secretory protein CDS SAVERM_5606 6781453 6782664 neuA2 putative neuraminidase, secreted PF02012: BNR/Asp-box repeat 8.57 42111 B specific pathways 2.1.1 BAC73318.1 Signal peptide CDS SAVERM_5607 6783630 6782695 dapA4 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 5.17 32227 B metabolism of amino acids & related molecules 2.2 BAC73319.1 Non-secretory protein CDS SAVERM_5608 6784694 6783627 oppF7 putative peptide ABC transporter ATP-binding protein PF00005: ABC transporter 8.79 37975 B transport / binding proteins & lipoproteins 1.2 BAC73320.1 Non-secretory protein CDS SAVERM_5609 6786649 6784691 oppC7 putative peptide ABC transporter permease protein PF00005: ABC transporter 8.5 69215 B transport / binding proteins & lipoproteins 1.2 BAC73321.1 Non-secretory protein CDS SAVERM_5610 6787608 6786646 oppB7 putative peptide ABC transporter permease protein Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 10.12 34421 B transport / binding proteins & lipoproteins 1.2 BAC73322.1 Non-secretory protein CDS SAVERM_5611 6789259 6787628 oppA7 putative peptide ABC transporter substrate-binding protein Tat substrate, PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 9.27 59245 B transport / binding proteins & lipoproteins 1.2 BAC73323.1 Signal peptide CDS SAVERM_5612 6789482 6790195 putative GntR-family transcriptional regulator PF07729: FCD domain 5.8 26461 B regulation 3.5.2 BAC73324.1 Non-secretory protein CDS SAVERM_5613 6790221 6790655 hypothetical protein 10.2 16310 B no similarity 6 BAC73325.1 Non-secretory protein CDS SAVERM_5614 6792146 6790707 putative efflux protein PF01554: MatE 8.61 50207 B transport / binding proteins & lipoproteins 1.2 BAC73326.1 Non-secretory protein CDS SAVERM_5615 6793180 6792152 putative cysteine synthase (O-acetylserine sulfhydylase) PF00291: Pyridoxal-phosphate dependent enzyme 4.66 36019 B metabolism of amino acids & related molecules 2.2 BAC73327.1 Non-secretory protein CDS SAVERM_5616 6794596 6793223 putative amino acid decarboxylase PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain 6.26 48955 B miscellaneous 4.7 BAC73328.1 Non-secretory protein CDS SAVERM_5617 6795618 6794587 arcB3 putative ornithine cyclodeaminase PF02423: Ornithine cyclodeaminase/mu-crystallin family 6.13 36215 B metabolism of amino acids & related molecules 2.2 BAC73329.1 Non-secretory protein CDS SAVERM_5618 6796633 6795641 putative oxygenase PF02668: Taurine catabolism dioxygenase TauD, TfdA family, putative IdeR-binding site: TTAGGTTAGGCATACCTAA(6796788:6796806) 5.34 35528 B miscellaneous 4.7 BAC73330.1 Non-secretory protein CDS SAVERM_5619 6797004 6798554 oppA8 putative peptide ABC transporter substrate-binding protein putative IdeR-binding site: TTAGGGTAGGCAAACCTAA(6796946:6796964), Tat substrate, PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 8.28 55612 B transport / binding proteins & lipoproteins 1.2 BAC73331.1 Signal peptide CDS SAVERM_5620 6798668 6799558 oppB8 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 5.56 30167 B transport / binding proteins & lipoproteins 1.2 BAC73332.1 Signal peptide CDS SAVERM_5621 6799555 6800403 oppC8 putative peptide ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.66 28875 B transport / binding proteins & lipoproteins 1.2 BAC73333.1 Non-secretory protein CDS SAVERM_5622 6800400 6801986 oppF8 putative peptide ABC transporter ATP-binding protein PF00005: ABC transporter 10.49 54983 B transport / binding proteins & lipoproteins 1.2 BAC73334.1 Non-secretory protein CDS SAVERM_5623 6802201 6803397 putative two-component system sensor kinase PF07730: Histidine kinase 9.2 42349 B sensors 1.3 BAC73335.1 Non-secretory protein CDS SAVERM_5624 6803394 6804113 putative two-component system response regulator PF00072: Response regulator receiver domain 4.72 25890 B regulation 3.5.2 BAC73336.1 Non-secretory protein CDS SAVERM_5625 6804363 6804091 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.27 9675 B similar to unknown proteins 5 BAC73337.1 Non-secretory protein CDS SAVERM_5626 6805178 6804345 putative DNA-binding protein PF01381: Helix-turn-helix 4.98 30844 B regulation 3.5.2 BAC73338.1 Non-secretory protein CDS SAVERM_5627 6805580 6805807 hypothetical protein 6.76 8120 B similar to unknown proteins 5 BAC73339.1 Non-secretory protein CDS SAVERM_5628 6805871 6806626 recO putative DNA recombination and repair protein PF02565: Recombination protein O 8.59 27308 B DNA recombination 3.3 BAC73340.1 Non-secretory protein CDS SAVERM_5629 6806695 6807552 uppS2 putative undecaprenyl diphosphate synthase PF01255: Putative undecaprenyl diphosphate synthase 7.93 32730 B metabolism of lipids 2.4 BAC73341.1 Non-secretory protein CDS SAVERM_5630 6810019 6807623 zmp5 putative griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 6.3 81544 B protein modification 3.8 BAC73342.1 Signal peptide CDS SAVERM_5631 6810999 6810583 furB putative ferric uptake regulation protein PF01475: Ferric uptake regulator family 6.3 14817 B regulation 3.5.2 BAC73343.1 Non-secretory protein CDS SAVERM_5632 6811954 6811058 mntC putative zinc/manganese transport system ABC transporter permease znuB, PF00950: ABC 3 transport family 10.13 31144 B transport / binding proteins & lipoproteins 1.2 BAC73344.1 Non-secretory protein CDS SAVERM_5633 6812766 6811954 mntB putative zinc/manganese transport system ABC transporter ATP-binding protein znuC,PF00005: ABC transporter 7.14 28297 B transport / binding proteins & lipoproteins 1.2 BAC73345.1 Non-secretory protein CDS SAVERM_5634 6813746 6812784 mntA putative zinc/manganese transport system ABC transporter substrate-binding protein znuA, Tat substrate, PF01297: Periplasmic solute binding protein family 5.12 34056 B transport / binding proteins & lipoproteins 1.2 BAC73346.1 Signal peptide CDS SAVERM_5635 6813890 6815272 glyS putative glycyl-tRNA synthetase PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 5.56 52433 B aminoacyl-tRNA-synthetase 3.7.2 BAC73347.1 Non-secretory protein CDS SAVERM_5636 6816435 6815383 chiB putative secreted endochitinase PF00704: Glycosyl hydrolases family 18 8.54 36890 B specific pathways 2.1.1 BAC73348.1 Signal peptide CDS SAVERM_5637 6816672 6817688 putative oxidoreductase PF00248: Aldo/keto reductase family 5.11 36263 B specific pathways 2.1.1 BAC73349.1 Non-secretory protein CDS SAVERM_5638 6817715 6818302 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.95 21335 B regulation 3.5.2 BAC73350.1 Non-secretory protein CDS SAVERM_5639 6819186 6818362 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.78 29527 B similar to unknown proteins 5 BAC73351.1 Non-secretory protein CDS SAVERM_5640 6819748 6820596 putative secreted protein 6.91 28514 B no similarity 6 BAC73352.1 Signal peptide CDS SAVERM_5641 6820847 6822631 putative secreted protein 5.52 60742 B similar to unknown proteins 5 BAC73353.1 Signal peptide CDS SAVERM_5642 6823252 6822797 hypothetical protein 5.25 16750 B similar to unknown proteins 5 BAC73354.1 Non-secretory protein CDS SAVERM_5643 6823669 6823346 hypothetical protein 11.53 11909 B no similarity 6 BAC73355.1 Non-secretory protein CDS SAVERM_5644 6824236 6823727 putative MarR-family transcriptional regulator PF01047: MarR family 6.69 19041 B regulation 3.5.2 BAC73356.1 Non-secretory protein CDS SAVERM_5645 6824343 6825134 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 7.1 27347 B miscellaneous 4.7 BAC73357.1 Non-secretory protein CDS SAVERM_5646 6826558 6825131 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.45 48666 B transport / binding proteins & lipoproteins 1.2 BAC73358.1 Non-secretory protein CDS SAVERM_5647 6826717 6827619 putative DNA-binding protein 8.24 34078 B regulation 3.5.2 BAC73359.1 Non-secretory protein CDS SAVERM_5648 6829072 6827627 putative efflux membrane protein Tat substrate, PF07690: Major Facilitator Superfamily 10.51 50464 B transport / binding proteins & lipoproteins 1.2 BAC73360.1 Non-secretory protein CDS SAVERM_5649 6829246 6830451 dus putative dihydrouridine synthase PF01207: Dihydrouridine synthase (Dus) 6.19 42927 B metabolism of nucleotides & nucleic acids 2.3 BAC73361.1 Non-secretory protein CDS SAVERM_5650 6832137 6830452 putative membrane protein PF00884: Sulfatase 10.04 60939 B miscellaneous 4.7 BAC73362.1 Non-secretory protein CDS SAVERM_5651 6834455 6832512 putative amylo-alpha-1,6-glucosidase PF06202: Amylo-alpha-1,6-glucosidase 5.97 68522 B specific pathways 2.1.1 BAC73363.1 Non-secretory protein CDS SAVERM_5652 6836048 6834510 hypothetical protein PF06202: Amylo-alpha-1,6-glucosidase 6.43 55671 B similar to unknown proteins 5 BAC73364.1 Non-secretory protein CDS SAVERM_5653 6836162 6837388 putative ROK-family transcriptional regulator PF00480: ROK family 6.06 42001 B regulation 3.5.2 BAC73365.1 Non-secretory protein CDS SAVERM_5654 6837828 6840578 ppdK putative pyruvate phosphate dikinase PF01326: Pyruvate phosphate dikinase, PEP/pyruvate binding domain 4.87 99603 B specific pathways 2.1.1 BAC73366.1 Non-secretory protein CDS SAVERM_5655 6842214 6840721 putative two-component system sensor kinase Tat substrate, PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 11.37 53329 B sensors 1.3 BAC73367.1 Non-secretory protein CDS SAVERM_5656 6843059 6842211 putative two-component system response regulator PF00072: Response regulator receiver domain 6.68 30869 B regulation 3.5.2 BAC73368.1 Non-secretory protein CDS SAVERM_5657 6843298 6843903 cynT2 putative carbonic anhydrase PF00484: Carbonic anhydrase 4.78 21961 B specific pathways 2.1.1 BAC73369.1 Non-secretory protein CDS SAVERM_5658 6843900 6846017 putative transmembrane sulfate transport protein PF00916: Sulfate transporter family 9.13 71548 B transport / binding proteins & lipoproteins 1.2 BAC73370.1 Signal peptide CDS SAVERM_5659 6846056 6846982 putative dehydrogenase PF00106: short chain dehydrogenase 7.24 32965 B miscellaneous 4.7 BAC73371.1 Non-secretory protein CDS SAVERM_5660 6847420 6847070 nirD putative nitrite reductase (NAD(P)H) small subunit PF00355: Rieske [2Fe-2S] domain 5.67 12415 B specific pathways 2.1.1 BAC73372.1 Non-secretory protein CDS SAVERM_5661 6850023 6847417 nirB putative nitrite reductase (NAD(P)H) large subunit PF00070: Pyridine nucleotide-disulphide oxidoreductase 4.9 91720 B specific pathways 2.1.1 BAC73373.1 Non-secretory protein CDS SAVERM_5662 6850413 6851195 putative secreted protein PF01925: Domain of unknown function DUF81 10.28 25993 B similar to unknown proteins 5 BAC73374.1 Non-secretory protein CDS SAVERM_5663 6851917 6851297 putative secreted protein PF04203: sortase family 6.51 21361 B miscellaneous 4.7 BAC73375.1 Signal peptide CDS SAVERM_5664 6852544 6852035 hypothetical protein 9.25 16518 B similar to unknown proteins 5 BAC73376.1 Signal peptide CDS SAVERM_5665 6852929 6853573 putative reductase PF03358: NADPH-dependent FMN reductase 6.52 22615 B miscellaneous 4.7 BAC73377.1 Non-secretory protein CDS SAVERM_5666 6854281 6853604 putative secreted protein Tat substrate, PF04264: YceI like family 8.44 24260 B similar to unknown proteins 5 BAC73378.1 Signal peptide CDS SAVERM_5667 6855048 6854626 putative MarR-family transcriptional regulator PF01047: MarR family 9.37 15225 B regulation 3.5.2 BAC73379.1 Non-secretory protein CDS SAVERM_5668 6855110 6855859 putative hydrolase PF00561: alpha/beta hydrolase fold 5.27 26643 B miscellaneous 4.7 BAC73380.1 Non-secretory protein CDS SAVERM_5669 6857552 6855957 zmp6 putative griselysin (secreted neutral zinc metalloprotease) PF02868: Thermolysin metallopeptidase, alpha-helical domain 6.45 55092 B protein modification 3.8 BAC73381.1 Signal peptide CDS SAVERM_5670 6857841 6858284 hypothetical protein PF03674: Uncharacterised protein family (UPF0131) 4.82 15892 B similar to unknown proteins 5 BAC73382.1 Non-secretory protein CDS SAVERM_5671 6858335 6859426 putative protocatechuate dioxygenase PF00775: Dioxygenase 6.16 36472 B miscellaneous 4.7 BAC73383.1 Non-secretory protein CDS SAVERM_5672 6860195 6859503 putative integral membrane protein probable vancomycin sensitivity, Tat substrate, PF02698: DUF218 domain 9.59 25047 B miscellaneous 4.7 BAC73384.1 Non-secretory protein CDS SAVERM_5673 6860373 6861293 hypothetical protein PF01903: CbiX 11.68 31990 B similar to unknown proteins 5 BAC73385.1 Non-secretory protein CDS SAVERM_5674 6861343 6862695 dgt putative deoxyguanosinetriphosphate triphosphohydrolase PF01966: HD domain 5.26 49506 B metabolism of nucleotides & nucleic acids 2.3 BAC73386.1 Non-secretory protein CDS SAVERM_5675 6862850 6864115 fprD putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.63 45385 B membrane bioenergetics 1.4 BAC73387.1 Non-secretory protein CDS SAVERM_5676 6864460 6866358 dnaG putative DNA primase PF01807: CHC2 zinc finger 6.18 69200 B DNA replication 3.1 BAC73388.1 Non-secretory protein CDS SAVERM_5677 6867369 6866371 hypothetical protein PF08843: Domain of unknown function (DUF1814) 4.63 37123 B similar to unknown proteins 5 BAC73389.1 Non-secretory protein CDS SAVERM_5678 6868019 6867366 hypothetical protein 6.16 23311 B similar to unknown proteins 5 BAC73390.1 Non-secretory protein CDS SAVERM_5679 6868347 6869516 sig47 putative RNA polymerase sigma factor silimar to SCO2465:hrdA, sigma-70 family, PF04539: Sigma-70 region 3 4.69 43188 B RNA initiation 3.5.1 BAC73391.1 Non-secretory protein CDS SAVERM_5680 6871484 6869556 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.28 69377 B transport / binding proteins & lipoproteins 1.2 BAC73392.1 Non-secretory protein CDS SAVERM_5681 6873217 6871484 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.38 62577 B transport / binding proteins & lipoproteins 1.2 BAC73393.1 Non-secretory protein CDS SAVERM_5682 6873712 6873380 putative secreted protein Tat substrate 9.17 11295 B similar to unknown proteins 5 BAC73394.1 Non-secretory protein CDS SAVERM_5683 6874831 6873734 xylB3 putative xylulose kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 4.72 37386 B miscellaneous 4.7 BAC73395.1 Non-secretory protein CDS SAVERM_5684 6875421 6875107 hypothetical protein 10.9 11456 B similar to unknown proteins 5 BAC73396.1 Non-secretory protein CDS SAVERM_5685 6877157 6876741 putative IS4 family ISMg3-like transposase truncated 10.57 14621 B transposon & IS 4.5 BAC73397.1 Signal peptide CDS SAVERM_5686 6879389 6877533 mcjD putative ABC transporter ATP-binding protein microcin cluster, PF00005: ABC transporter 9.13 65791 B transport / binding proteins & lipoproteins 1.2 BAC73398.1 Non-secretory protein CDS SAVERM_5687 6879820 6879386 mcjB2 hypothetical protein microcin cluster 11.46 15289 B similar to unknown proteins 5 BAC73399.1 Non-secretory protein CDS SAVERM_5688 6880104 6879817 hypothetical protein microcin cluster 3.81 10174 B similar to unknown proteins 5 BAC73400.1 Non-secretory protein CDS SAVERM_5689 6881873 6880101 mcjC2 putative asparagine synthase microcin cluster, probably formation of amide bond, PF00733: Asparagine synthase 7.64 64538 B metabolism of amino acids & related molecules 2.2 BAC73401.1 Non-secretory protein CDS SAVERM_7585 6882094 6881984 mcjA2 putative microcin mature peptide microcin cluster 11.72 3919 B Non-secretory protein CDS SAVERM_5690 6883307 6882750 hypothetical protein 7.42 20991 B no similarity 6 BAC73402.1 Non-secretory protein CDS SAVERM_5691 6883585 6883337 hypothetical protein 11.99 8601 B no similarity 6 BAC73403.1 Non-secretory protein CDS SAVERM_5692 6883887 6883615 hypothetical protein 10.91 9585 B no similarity 6 BAC73404.1 Non-secretory protein CDS SAVERM_5693 6884073 6884306 hypothetical protein PF09957: Uncharacterized protein conserved in bacteria (DUF2191) 8.98 8521 B similar to unknown proteins 5 BAC73405.1 Non-secretory protein CDS SAVERM_5694 6884303 6884710 hypothetical protein PF01850: PIN domain 6.41 14976 B similar to unknown proteins 5 BAC73406.1 Non-secretory protein CDS SAVERM_5695 6885756 6887651 hypothetical protein PF00350: Dynamin family 6.63 67160 B similar to unknown proteins 5 BAC73407.1 Non-secretory protein CDS SAVERM_5696 6887655 6889511 hypothetical protein PF00350: Dynamin family 4.7 66556 B similar to unknown proteins 5 BAC73408.1 Non-secretory protein CDS SAVERM_5697 6889508 6891487 hypothetical protein PF00350: Dynamin family 4.79 72318 B similar to unknown proteins 5 BAC73409.1 Non-secretory protein CDS SAVERM_5698 6891487 6892749 hypothetical protein 6.84 45885 B similar to unknown proteins 5 BAC73410.1 Non-secretory protein CDS SAVERM_5699 6892750 6893244 hypothetical protein 9.73 17024 B no similarity 6 BAC73411.1 Non-secretory protein CDS SAVERM_5700 6893864 6893160 putative transcriptional regulator with cyclic nucleotide-binding domain PF00027: Cyclic nucleotide-binding domain 10.59 25470 B regulation 3.5.2 BAC73412.1 Non-secretory protein CDS SAVERM_5701 6895405 6894374 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 8.04 36382 B regulation 3.5.2 BAC73413.1 Non-secretory protein CDS SAVERM_5702 6896318 6895482 frcA putative fructose ABC transporter ATP-binding protein PF00005: ABC transporter 7.94 29354 B transport / binding proteins & lipoproteins 1.2 BAC73414.1 Non-secretory protein CDS SAVERM_5703 6897310 6896315 frcC putative fructose ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.11 34088 B transport / binding proteins & lipoproteins 1.2 BAC73415.1 Non-secretory protein CDS SAVERM_5704 6898488 6897466 frcB putative fructose ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 9.43 34425 B transport / binding proteins & lipoproteins 1.2 BAC73416.1 Signal peptide CDS SAVERM_5705 6898796 6899758 scrK1 putative fructokinase PF00294: pfkB family carbohydrate kinase 4.71 33092 B main glycolytic pathways 2.1.2 BAC73417.1 Non-secretory protein CDS SAVERM_5706 6899853 6900146 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 4.2 10854 B no similarity 6 BAC73418.1 Non-secretory protein CDS SAVERM_5707 6900279 6900848 putative secreted protein 6.78 19554 B no similarity 6 BAC73419.1 Signal peptide CDS SAVERM_5708 6901249 6901001 hypothetical protein 4.18 8373 B no similarity 6 BAC73420.1 Non-secretory protein CDS SAVERM_5709 6902580 6901246 putative protease PF00082: Subtilase family 4.93 45901 B protein modification 3.8 BAC73421.1 Non-secretory protein CDS SAVERM_5710 6903446 6902814 hypothetical protein PF00156: Phosphoribosyl transferase domain 5.19 22828 B similar to unknown proteins 5 BAC73422.1 Non-secretory protein CDS SAVERM_5711 6903717 6904673 putative hydrolase PF00561: alpha/beta hydrolase fold 11.14 34533 B miscellaneous 4.7 BAC73423.1 Non-secretory protein CDS SAVERM_5712 6908622 6904678 putative ATP/GTP-binding protein PF07721: Tetratricopeptide repeat 5.43 145524 B miscellaneous 4.7 BAC73424.1 Non-secretory protein CDS SAVERM_5713 6909953 6908619 hypothetical protein 6.08 49674 B no similarity 6 BAC73425.1 Non-secretory protein CDS SAVERM_5714 6910827 6910054 aac2 putative aminoglycoside N3-acetyltransferase PF02522: Aminoglycoside 3-N-acetyltransferase 5.89 27676 B detoxification 4.2 BAC73426.1 Non-secretory protein CDS SAVERM_5715 6912991 6910820 hypothetical protein PF04055: Radical SAM superfamily 5.84 79875 B similar to unknown proteins 5 BAC73427.1 Non-secretory protein CDS SAVERM_5716 6913272 6913090 hypothetical protein 12.03 6366 B no similarity 6 BAC73428.1 Non-secretory protein CDS SAVERM_5717 6913513 6914433 hypothetical protein 10.69 33819 B similar to unknown proteins 5 BAC73429.1 Non-secretory protein CDS SAVERM_5718 6914930 6914454 putative secreted protein 7.06 16791 B similar to unknown proteins 5 BAC73430.1 Non-secretory protein CDS SAVERM_5719 6916625 6915084 putative two-component system sensor kinase PF01590: GAF domain 6.13 54337 B sensors 1.3 BAC73431.1 Non-secretory protein CDS SAVERM_5720 6917690 6916653 mreB2 putative rod shape-determining protein PF06723: MreB/Mbl protein 8.87 36344 B cell wall 1.1 BAC73432.1 Non-secretory protein CDS SAVERM_5721 6918257 6921883 putative SAM-P45 peptidase, secreted PF00082: Subtilase family 5.99 125549 B protein modification 3.8 BAC73433.1 Signal peptide CDS SAVERM_5722 6923255 6921858 accD3 putative acetyl CoA carboxylase beta subunit PF01039: Carboxyl transferase domain 5.16 47585 B metabolism of lipids 2.4 BAC73434.1 Non-secretory protein CDS SAVERM_5723 6924728 6923259 acsF putative methylmalonyl-CoA synthetase PF00501: AMP-binding enzyme 5.92 50915 B metabolism of lipids 2.4 BAC73435.1 Non-secretory protein CDS SAVERM_5724 6925422 6924844 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.25 20862 B regulation 3.5.2 BAC73436.1 Non-secretory protein CDS SAVERM_5725 6925604 6925975 putative membrane protein 9.73 12764 B miscellaneous 4.7 BAC73437.1 Non-secretory protein CDS SAVERM_5726 6926010 6926501 hypothetical protein PF00190: Cupin 4.69 17660 B similar to unknown proteins 5 BAC73438.1 Non-secretory protein CDS SAVERM_5727 6927681 6926536 prpH putative magnesium or manganese-dependent protein phosphatase PF00376: MerR family regulatory protein, PF00481: Protein phosphatase 2C 5.12 40191 B protein modification 3.8 BAC73439.1 Non-secretory protein CDS SAVERM_5728 6927832 6928704 hypothetical protein 4.85 31850 B similar to unknown proteins 5 BAC73440.1 Non-secretory protein CDS SAVERM_5729 6929347 6928685 hypothetical protein 10.52 24345 B similar to unknown proteins 5 BAC73441.1 Non-secretory protein CDS SAVERM_5730 6930134 6929295 hypothetical protein 11.38 30550 B similar to unknown proteins 5 BAC73442.1 Non-secretory protein CDS SAVERM_5731 6930352 6930131 hypothetical protein PF03966: Protein of unknown function (DUF343) 4.74 8292 B similar to unknown proteins 5 BAC73443.1 Non-secretory protein CDS SAVERM_5732 6931269 6930349 hypothetical protein 10.2 32152 B similar to unknown proteins 5 BAC73444.1 Non-secretory protein CDS SAVERM_5733 6932007 6931273 putative methyltransferase PF08241: Methyltransferase domain 10.23 25892 B similar to unknown proteins 5 BAC73445.1 Non-secretory protein CDS SAVERM_5734 6933329 6932004 hypothetical protein PF00668: Condensation domain 10.07 48457 B similar to unknown proteins 5 BAC73446.1 Non-secretory protein CDS SAVERM_5735 6937870 6933326 putative membrane protein PF00754: F5/8 type C domain 9.21 159052 B miscellaneous 4.7 BAC73447.1 Non-secretory protein CDS SAVERM_5736 6938592 6937867 putative methyltransferase PF08241: Methyltransferase domain 9.08 26776 B similar to unknown proteins 5 BAC73448.1 Non-secretory protein CDS SAVERM_5737 6939824 6938589 putative glycosyltransferase PF00534: Glycosyl transferases group 1 10.81 44624 B specific pathways 2.1.1 BAC73449.1 Non-secretory protein CDS SAVERM_5738 6941026 6940049 putative secreted protein 10.24 35328 B similar to unknown proteins 5 BAC73450.1 Signal peptide CDS SAVERM_5739 6941273 6941461 putative secreted protein 4.73 6341 B no similarity 6 BAC73451.1 Non-secretory protein CDS SAVERM_5740 6941505 6942746 putative regulatory protein PF02954: Bacterial regulatory protein, Fis family 6.45 45889 B regulation 3.5.2 BAC73452.1 Non-secretory protein CDS SAVERM_5741 6942974 6943747 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 6.37 27684 B regulation 3.5.2 BAC73453.1 Non-secretory protein CDS SAVERM_5742 6943744 6944604 putative calcium-binding protein PF03758: Senescence marker protein-30 (SMP-30) 6.03 29940 B miscellaneous 4.7 BAC73454.1 Non-secretory protein CDS SAVERM_5743 6944863 6946374 abfA putative alpha-L-arabinofuranosidase PF06964: Alpha-L-arabinofuranosidase C-terminus 4.56 55206 B specific pathways 2.1.1 BAC73455.1 Non-secretory protein CDS SAVERM_5744 6948203 6946518 hypothetical protein PF01833: IPT/TIG domain 4.04 54332 B similar to unknown proteins 5 BAC73456.1 Signal peptide CDS SAVERM_5745 6948731 6948381 hypothetical protein 11.72 12184 B no similarity 6 BAC73457.1 Non-secretory protein CDS SAVERM_5746 6948850 6950259 putative two-component system sensor kinase PF07730: Histidine kinase 10.74 50188 B sensors 1.3 BAC73458.1 Non-secretory protein CDS SAVERM_5747 6950247 6950894 putative two-component system response regulator PF00072: Response regulator receiver domain 4.99 23215 B regulation 3.5.2 BAC73459.1 Non-secretory protein CDS SAVERM_5748 6950891 6951697 putative lipoprotein 9.95 28294 B transport / binding proteins & lipoproteins 1.2 BAC73460.1 Non-secretory protein CDS SAVERM_5749 6952241 6951786 hypothetical protein 11.85 16491 B no similarity 6 BAC73461.1 Non-secretory protein CDS SAVERM_5750 6952784 6952272 hypothetical protein 8.24 18246 B no similarity 6 BAC73462.1 Non-secretory protein CDS SAVERM_5751 6953421 6955928 hypothetical protein 4.95 87449 B similar to unknown proteins 5 BAC73463.1 Non-secretory protein CDS SAVERM_5752 6956080 6956331 hypothetical protein 4.02 9174 B no similarity 6 BAC73464.1 Non-secretory protein CDS SAVERM_5753 6956959 6956717 hypothetical protein PF04149: Domain of unknown function (DUF397) 5.58 8631 B similar to unknown proteins 5 BAC73465.1 Non-secretory protein CDS SAVERM_5754 6957798 6956956 putative DNA-binding protein PF01381: Helix-turn-helix 6.64 31316 B regulation 3.5.2 BAC73466.1 Non-secretory protein CDS SAVERM_5755 6957927 6958385 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.51 16425 B regulation 3.5.2 BAC73467.1 Non-secretory protein CDS SAVERM_5756 6961323 6958393 bga7 putative beta-galactosidase PF01301: Glycosyl hydrolases family 35 6.73 105719 B specific pathways 2.1.1 BAC73468.1 Non-secretory protein CDS SAVERM_5757 6961466 6961924 putative transcriptional regulator PF02082: Transcriptional regulator 5.96 16023 B regulation 3.5.2 BAC73469.1 Non-secretory protein CDS SAVERM_5758 6962970 6962101 putative protocatechuate dioxygenase Tat substrate, PF00775: Dioxygenase 4.14 30455 B miscellaneous 4.7 BAC73470.1 Non-secretory protein CDS SAVERM_5759 6964288 6963098 putative monooxygenase PF01360: Monooxygenase 5.25 41838 B miscellaneous 4.7 BAC73471.1 Non-secretory protein CDS SAVERM_5760 6965106 6964312 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 4.7 27591 B regulation 3.5.2 BAC73472.1 Non-secretory protein CDS SAVERM_5761 6966052 6965288 putative protocatechuate dioxygenase Tat substrate, PF00775: Dioxygenase 4.69 25902 B miscellaneous 4.7 BAC73473.1 Signal peptide CDS SAVERM_5762 6966932 6967120 hypothetical protein 9.17 7226 B no similarity 6 BAC73474.1 Non-secretory protein CDS SAVERM_5763 6967178 6967900 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.22 25012 B transport / binding proteins & lipoproteins 1.2 BAC73475.1 Non-secretory protein CDS SAVERM_5764 6968103 6968936 blaA4 putative beta-lactamase PF00144: Beta-lactamase 8.51 29989 B detoxification 4.2 BAC73476.1 Non-secretory protein CDS SAVERM_5765 6970655 6969006 putative aminotransferase PF00155: Aminotransferase class I and II 6.01 58373 B metabolism of amino acids & related molecules 2.2 BAC73477.1 Non-secretory protein CDS SAVERM_5766 6971994 6970843 galM1 putative aldose 1-epimerase Tat substrate, PF01263: Aldose 1-epimerase 8.97 41438 B miscellaneous 4.7 BAC73478.1 Signal peptide CDS SAVERM_5767 6973295 6972051 gguB putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.27 42952 B transport / binding proteins & lipoproteins 1.2 BAC73479.1 Non-secretory protein CDS SAVERM_5768 6974842 6973301 gguA putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 6.77 56366 B transport / binding proteins & lipoproteins 1.2 BAC73480.1 Non-secretory protein CDS SAVERM_5769 6975998 6974886 chvE putative simple sugar ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 5.34 39927 B transport / binding proteins & lipoproteins 1.2 BAC73481.1 Signal peptide CDS SAVERM_5770 6977109 6976141 hypothetical protein PF07027: Protein of unknown function (DUF1318) 6.52 34268 B similar to unknown proteins 5 BAC73482.1 Non-secretory protein CDS SAVERM_5771 6978206 6977202 adhA7 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.22 34709 B specific pathways 2.1.1 BAC73483.1 Non-secretory protein CDS SAVERM_5772 6979360 6978203 putative dehydratase PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain 5.57 42295 B miscellaneous 4.7 BAC73484.1 Non-secretory protein CDS SAVERM_5773 6979650 6980393 hypothetical protein 8.12 24448 B similar to unknown proteins 5 BAC73485.1 Non-secretory protein CDS SAVERM_5774 6981416 6980613 putative secreted protein 9.01 27075 B no similarity 6 BAC73486.1 Signal peptide CDS SAVERM_5775 6981912 6981481 putative MarR-family transcriptional regulator PF01047: MarR family 6.95 15854 B regulation 3.5.2 BAC73487.1 Non-secretory protein CDS SAVERM_5776 6982063 6983085 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.89 36435 B miscellaneous 4.7 BAC73488.1 Non-secretory protein CDS SAVERM_5777 6983533 6983345 putative esterase 4.98 7257 B miscellaneous 4.7 BAC73489.1 Non-secretory protein CDS SAVERM_5778 6983796 6983557 putative esterase 5.02 8399 B miscellaneous 4.7 BAC73490.1 Non-secretory protein CDS SAVERM_5779 6984012 6984974 hypothetical protein 6.55 32536 B similar to unknown proteins 5 BAC73491.1 Non-secretory protein CDS SAVERM_5780 6985071 6985787 putative integral membrane protein PF04401: Protein of unknown function (DUF540) 9.55 26160 B miscellaneous 4.7 BAC73492.1 Non-secretory protein CDS SAVERM_5781 6987193 6985862 putative secreted protein PF01470: Pyroglutamyl peptidase 7.1 47370 B similar to unknown proteins 5 BAC73493.1 Signal peptide CDS SAVERM_5782 6988471 6987491 galM2 putative aldose 1-epimerase PF01263: Aldose 1-epimerase 5.59 35139 B miscellaneous 4.7 BAC73494.1 Non-secretory protein CDS SAVERM_5783 6989401 6988499 putative lipoprotein PF00657: GDSL-like Lipase/Acylhydrolase 9.31 31943 B transport / binding proteins & lipoproteins 1.2 BAC73495.1 Signal peptide CDS SAVERM_5784 6989596 6990090 hypothetical protein PF11343: Protein of unknown function (DUF3145) 6.01 18171 B similar to unknown proteins 5 BAC73496.1 Non-secretory protein CDS SAVERM_5785 6991437 6990166 fabB1 putative 3-oxoacyl-ACP synthase II PF00109: Beta-ketoacyl synthase, N-terminal domain 5.13 43546 B metabolism of lipids 2.4 BAC73497.1 Non-secretory protein CDS SAVERM_5786 6991768 6991520 fabC1 putative acyl carrier protein PF00550: Phosphopantetheine attachment site 3.73 8960 B metabolism of lipids 2.4 BAC73498.1 Non-secretory protein CDS SAVERM_5787 6992906 6991839 fabH1 putative 3-oxoacyl-ACP synthase III PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 4.88 37173 B metabolism of lipids 2.4 BAC73499.1 Non-secretory protein CDS SAVERM_5788 6993859 6992909 fabD putative malonyl-CoA:acyl carrier protein malonyltransferase PF00698: Acyl transferase domain 4.52 31770 B metabolism of lipids 2.4 BAC73500.1 Non-secretory protein CDS SAVERM_5789 6995154 6993949 hypothetical protein 4.88 42630 B similar to unknown proteins 5 BAC73501.1 Non-secretory protein CDS SAVERM_5790 6995237 6995890 hypothetical protein PF02678: Pirin 4.88 23341 B similar to unknown proteins 5 BAC73502.1 Non-secretory protein CDS SAVERM_5791 6996754 6995924 blaA5 putative beta-lactamase PF00144: Beta-lactamase 5.54 29275 B detoxification 4.2 BAC73503.1 Non-secretory protein CDS SAVERM_5792 6996911 6997393 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 7.07 18095 B regulation 3.5.2 BAC73504.1 Non-secretory protein CDS SAVERM_5793 6997390 6998406 putative oxidoreductase PF00248: Aldo/keto reductase family 5.14 36254 B specific pathways 2.1.1 BAC73505.1 Non-secretory protein CDS SAVERM_5794 6999317 6998454 hypothetical protein 5.7 30922 B similar to unknown proteins 5 BAC73506.1 Non-secretory protein CDS SAVERM_5795 7000601 6999393 putative secreted protein PF06259: Domain of unknown function (DUF1023) 10.55 42968 B miscellaneous 4.7 BAC73507.1 Non-secretory protein CDS SAVERM_5796 7001456 7000776 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.99 25059 B regulation 3.5.2 BAC73508.1 Non-secretory protein CDS SAVERM_5797 7001572 7003194 tcmA putative tetracenomycin C resistance and export protein PF07690: Major Facilitator Superfamily 6.51 55171 B transport / binding proteins & lipoproteins 1.2 BAC73509.1 Non-secretory protein CDS SAVERM_5798 7003435 7003746 putative small hydrophobic protein 12.2 10730 B miscellaneous 4.7 BAC73510.1 Non-secretory protein CDS SAVERM_5799 7004684 7003857 putative ion transport integral membrane protein PF00520: Ion transport protein 9.54 29853 B transport / binding proteins & lipoproteins 1.2 BAC73511.1 Non-secretory protein CDS SAVERM_5800 7007451 7004704 aceE1 putative pyruvate dehydrogenase E1 component PF00456: Transketolase, thiamine diphosphate binding domain 5.91 101798 B main glycolytic pathways 2.1.2 BAC73512.1 Non-secretory protein CDS SAVERM_5801 7007846 7008325 hypothetical protein PF11253: Protein of unknown function (DUF3052) 3.91 17378 B similar to unknown proteins 5 BAC73513.1 Non-secretory protein CDS SAVERM_5802 7008510 7008968 ahpE putative thiol-specific antioxidant protein PF00578: AhpC/TSA family 4.4 16970 B detoxification 4.2 BAC73514.1 Non-secretory protein CDS SAVERM_5803 7009081 7009656 terD3 putative tellurium resistance protein PF02342: Bacterial stress protein 4.13 20382 B detoxification 4.2 BAC73515.1 Non-secretory protein CDS SAVERM_5804 7009785 7010360 terD4 putative tellurium resistance protein PF02342: Bacterial stress protein 4.17 20444 B detoxification 4.2 BAC73516.1 Non-secretory protein CDS SAVERM_5805 7010466 7011611 putative integral membrane protein PF04332: Protein of unknown function (DUF475) 5.07 41444 B miscellaneous 4.7 BAC73517.1 Non-secretory protein CDS SAVERM_5806 7011775 7012509 hypothetical protein PF02342: Bacterial stress protein 7.15 27569 B similar to unknown proteins 5 BAC73518.1 Non-secretory protein CDS SAVERM_5807 7013463 7012537 hypothetical protein PF02342: Bacterial stress protein 4.41 32251 B similar to unknown proteins 5 BAC73519.1 Non-secretory protein CDS SAVERM_5808 7013655 7014818 putative ATP/GTP-binding protein 5.68 42925 B miscellaneous 4.7 BAC73520.1 Non-secretory protein CDS SAVERM_5809 7014926 7017394 hypothetical protein PF11202: Protein of unknown function (DUF2983) 5.38 88693 B similar to unknown proteins 5 BAC73521.1 Non-secretory protein CDS SAVERM_5810 7017394 7018212 hypothetical protein 5.22 29644 B similar to unknown proteins 5 BAC73522.1 Non-secretory protein CDS SAVERM_5811 7018524 7018297 hypothetical protein PF09723: Zinc ribbon domain 7.69 7376 B similar to unknown proteins 5 BAC73523.1 Non-secretory protein CDS SAVERM_5812 7019208 7018528 hypothetical protein 12.01 24861 B similar to unknown proteins 5 BAC73524.1 Non-secretory protein CDS SAVERM_5813 7020761 7019337 hypothetical protein PF01442: Apolipoprotein A1/A4/E family 9.06 51483 B similar to unknown proteins 5 BAC73525.1 Non-secretory protein CDS SAVERM_5814 7021716 7020916 putative lipoprotein 7.7 27872 B transport / binding proteins & lipoproteins 1.2 BAC73526.1 Signal peptide CDS SAVERM_5815 7022579 7022151 int15 putative tyrosine-family recombinase/integrase PF00589: Phage integrase family 12.08 15633 B phage-related functions 4.4 BAC73527.1 Non-secretory protein CDS SAVERM_5816 7023358 7024203 putative secreted protein 9.54 29736 B no similarity 6 BAC73528.1 Signal peptide CDS SAVERM_5817 7024312 7025148 hypothetical protein 10.65 31231 B no similarity 6 BAC73529.1 Non-secretory protein CDS SAVERM_5818 7025833 7025513 hypothetical protein 5.73 12518 B similar to unknown proteins 5 BAC73530.1 Non-secretory protein CDS SAVERM_5819 7026895 7025939 apbA putative 2-dehydropantoate 2-reductase PF02558: Ketopantoate reductase PanE/ApbA 6.25 33495 B miscellaneous 4.7 BAC73531.1 Non-secretory protein CDS SAVERM_5820 7027419 7027009 hypothetical protein 5.47 14024 B similar to unknown proteins 5 BAC73532.1 Non-secretory protein CDS SAVERM_5821 7027787 7027524 hypothetical protein 4.25 9053 B similar to unknown proteins 5 BAC73533.1 Non-secretory protein CDS SAVERM_5822 7027841 7028095 hypothetical protein PF10041: Uncharacterized conserved protein (DUF2277) 7.52 8790 B similar to unknown proteins 5 BAC73534.1 Non-secretory protein CDS SAVERM_5823 7028678 7028067 hypothetical protein PF00597: DedA family 10.81 20791 B similar to unknown proteins 5 BAC73535.1 Non-secretory protein CDS SAVERM_5824 7029411 7028956 hypothetical protein PF07681: DoxX, putative IdeR-binding site: CCACGTTAGGCGTACCTAA(7029485:7029503) 7.52 15281 B similar to unknown proteins 5 BAC73536.1 Non-secretory protein CDS SAVERM_5825 7031464 7029500 hypothetical protein 6.76 70557 B similar to unknown proteins 5 BAC73537.1 Non-secretory protein CDS SAVERM_5826 7033306 7031672 hypothetical protein PF09423: PhoD-like phosphatase 5.35 60144 B similar to unknown proteins 5 BAC73538.1 Non-secretory protein CDS SAVERM_5827 7034030 7033386 putative secreted protein 5.9 23130 B miscellaneous 4.7 BAC73539.1 Signal peptide CDS SAVERM_5828 7034613 7035194 putative secreted protein PF01169: Uncharacterized protein family UPF0016 9.49 20142 B similar to unknown proteins 5 BAC73540.1 Non-secretory protein CDS SAVERM_5829 7035454 7036116 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.55 22994 B miscellaneous 4.7 BAC73541.1 Non-secretory protein CDS SAVERM_5830 7037331 7036327 putative peptidoglycan-binding membrane protein PF01471: Putative peptidoglycan binding domain 4.5 33201 B cell wall 1.1 BAC73542.1 Non-secretory protein CDS SAVERM_5831 7037506 7039593 putative multidrug-efflux transporter PF07690: Major Facilitator Superfamily 7.32 73387 B transport / binding proteins & lipoproteins 1.2 BAC73543.1 Non-secretory protein CDS SAVERM_5832 7040132 7039590 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.66 19327 B miscellaneous 4.7 BAC73544.1 Non-secretory protein CDS SAVERM_5833 7040278 7041012 putative secreted protein 8.96 26452 B miscellaneous 4.7 BAC73545.1 Non-secretory protein CDS SAVERM_5834 7041018 7041797 hypothetical protein 6.59 27697 B similar to unknown proteins 5 BAC73546.1 Non-secretory protein CDS SAVERM_5835 7042325 7041912 hypothetical protein PF09350: Domain of unknown function (DUF1992) 9 15301 B similar to unknown proteins 5 BAC73547.1 Non-secretory protein CDS SAVERM_5836 7042375 7042836 hypothetical protein 5.9 15949 B similar to unknown proteins 5 BAC73548.1 Non-secretory protein CDS SAVERM_5837 7043534 7042860 putative O-methyltransferase PF02409: O-methyltransferase N-terminus 4.73 24117 B miscellaneous 4.7 BAC73549.1 Non-secretory protein CDS SAVERM_5838 7044782 7043634 putative secreted protein 10.26 41611 B similar to unknown proteins 5 BAC73550.1 Non-secretory protein CDS SAVERM_5839 7046345 7044873 putative integral membrane transport protein PF00083: Sugar (and other) transporter 9.74 51403 B transport / binding proteins & lipoproteins 1.2 BAC73551.1 Non-secretory protein CDS SAVERM_5840 7046733 7047638 putative integral membrane protein 9.7 31374 B transport / binding proteins & lipoproteins 1.2 BAC73552.1 Non-secretory protein CDS SAVERM_5841 7049112 7047868 cyp22 cytochrome P450 hydroxylase CYP125A2, fadA7 is located at upstream 5.07 46038 B metabolism of coenzymes & prosthetic groups 2.5 BAC73553.1 Non-secretory protein CDS SAVERM_5842 7049394 7050563 fadA7 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF02803: Thiolase, C-terminal domain 6.44 41375 B metabolism of lipids 2.4 BAC73554.1 Non-secretory protein CDS SAVERM_5843 7051283 7050588 hypothetical protein PF06912: Protein of unknown function (DUF1275) 11.78 23138 B similar to unknown proteins 5 BAC73555.1 Non-secretory protein CDS SAVERM_5844 7051388 7052638 putative lipase, secreted Tat substrate, PF03583: Secretory lipase 9.08 44925 B similar to unknown proteins 5 BAC73556.1 Non-secretory protein CDS SAVERM_5845 7053178 7052717 putative secreted protein PF06737: Transglycosylase-like domain 10.83 16053 B similar to unknown proteins 5 BAC73557.1 Signal peptide CDS SAVERM_5846 7054434 7053469 putative integral membrane protein PF03806: AbgT putative transporter family 11.78 33185 B transport / binding proteins & lipoproteins 1.2 BAC73558.1 Non-secretory protein CDS SAVERM_5847 7056116 7054431 ecfA putative cobalt ABC transporter ATP-binding protein PF00005: ABC transporter 6.66 58592 B transport / binding proteins & lipoproteins 1.2 BAC73559.1 Non-secretory protein CDS SAVERM_5848 7057258 7056113 ecfT putative cobalt ABC transporter permease protein PF02361: Cobalt transport protein 11.85 39332 B transport / binding proteins & lipoproteins 1.2 BAC73560.1 Non-secretory protein CDS SAVERM_5849 7057939 7057265 putative secreted protein 10.24 23287 B similar to unknown proteins 5 BAC73561.1 Signal peptide CDS SAVERM_5850 7059213 7057936 putative secreted protein PF00432: Prenyltransferase and squalene oxidase repeat 9.08 42398 B similar to unknown proteins 5 BAC73562.1 Signal peptide CDS SAVERM_5851 7060649 7059531 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 6.58 40630 B similar to unknown proteins 5 BAC73563.1 Non-secretory protein CDS SAVERM_5852 7060741 7062249 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.81 53623 B specific pathways 2.1.1 BAC73564.1 Non-secretory protein CDS SAVERM_5853 7062249 7062482 fdxF putative ferredoxin PF06902: Protein of unknown function (DUF1271) 4.41 8339 B membrane bioenergetics 1.4 BAC73565.1 Non-secretory protein CDS SAVERM_5854 7063376 7062720 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.24 23945 B regulation 3.5.2 BAC73566.1 Non-secretory protein CDS SAVERM_5855 7063585 7065060 wbpY putative glycosyltransferase PF00534: Glycosyl transferases group 1 6.2 51624 B specific pathways 2.1.1 BAC73567.1 Non-secretory protein CDS SAVERM_5856 7065054 7065800 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 6.68 27106 B miscellaneous 4.7 BAC73568.1 Non-secretory protein CDS SAVERM_5857 7065797 7066867 hypothetical protein 4.45 39370 B similar to unknown proteins 5 BAC73569.1 Non-secretory protein CDS SAVERM_5858 7067221 7066928 hypothetical protein 9.63 10830 B similar to unknown proteins 5 BAC73570.1 Non-secretory protein CDS SAVERM_5859 7067360 7067920 putative secreted protein Tat substrate 10.61 19052 B no similarity 6 BAC73571.1 Signal peptide CDS SAVERM_5860 7068139 7068789 hypothetical protein 5.24 23003 B similar to unknown proteins 5 BAC73572.1 Non-secretory protein CDS SAVERM_5861 7068812 7069810 hypothetical protein PF01520: N-acetylmuramoyl-L-alanine amidase 8.84 33936 B similar to unknown proteins 5 BAC73573.1 Non-secretory protein CDS SAVERM_5862 7070586 7069951 hypothetical protein 10.22 23033 B no similarity 6 BAC73574.1 Non-secretory protein CDS SAVERM_5863 7070987 7071784 putative integral membrane protein PF04964: Flp/Fap pilin component 5.05 26905 B miscellaneous 4.7 BAC73575.1 Non-secretory protein CDS SAVERM_5864 7071899 7072909 putative FMN-dependent monooxygenase PF00296: Luciferase-like monooxygenase 8.25 36898 B specific pathways 2.1.1 BAC73576.1 Non-secretory protein CDS SAVERM_5865 7074785 7073034 putative membrane transport protein PF07690: Major Facilitator Superfamily 10.02 59348 B transport / binding proteins & lipoproteins 1.2 BAC73577.1 Non-secretory protein CDS SAVERM_5866 7074961 7076199 ltp1 putative lipid-transfer protein PF02803: Thiolase, C-terminal domain 6.29 43691 B metabolism of lipids 2.4 BAC73578.1 Non-secretory protein CDS SAVERM_5867 7076342 7077796 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10.64 48820 B transport / binding proteins & lipoproteins 1.2 BAC73579.1 Non-secretory protein CDS SAVERM_5868 7078479 7077847 putative two-component system response regulator PF00072: Response regulator receiver domain 4.94 22058 B regulation 3.5.2 BAC73580.1 Non-secretory protein CDS SAVERM_5869 7079885 7078512 putative two-component system sensor kinase PF07730: Histidine kinase 7.15 48478 B sensors 1.3 BAC73581.1 Non-secretory protein CDS SAVERM_5870 7080294 7081151 ufaA putative MaoC-like dehydratase PF01575: MaoC like domain 5.86 30539 B miscellaneous 4.7 BAC73582.1 Non-secretory protein CDS SAVERM_5871 7081196 7082272 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.79 37164 B miscellaneous 4.7 BAC73583.1 Non-secretory protein CDS SAVERM_5872 7082308 7083282 fabG5 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 6.24 33698 B metabolism of lipids 2.4 BAC73584.1 Non-secretory protein CDS SAVERM_5873 7083590 7083426 hypothetical protein 6.33 5985 B similar to unknown proteins 5 BAC73585.1 Non-secretory protein CDS SAVERM_5874 7084970 7083639 hypothetical protein 5.13 45908 B similar to unknown proteins 5 BAC73586.1 Non-secretory protein CDS SAVERM_5875 7085244 7086107 putative NGG1-interacting factor 3 PF01784: NIF3 (NGG1p interacting factor 3) 5.01 30580 B miscellaneous 4.7 BAC73587.1 Non-secretory protein CDS SAVERM_5876 7086257 7086847 hypothetical protein PF02591: Uncharacterized ACR, COG1579 4.83 21853 B similar to unknown proteins 5 BAC73588.1 Non-secretory protein CDS SAVERM_5877 7086857 7088173 putative bifunctional protein (ribonuclease H/phosphoglycerate mutase) PF00300: Phosphoglycerate mutase family, PF00075: RNase H 7.17 45630 B miscellaneous 4.7 BAC73589.1 Non-secretory protein CDS SAVERM_5878 7088942 7088283 kdgA putative 2-keto-3-deoxygluconate 6-phosphate aldolase and 2-keto-4-hydroxyglutarate aldolase PF01081: KDPG and KHG aldolase 4.43 22190 B specific pathways 2.1.1 BAC73590.1 Non-secretory protein CDS SAVERM_5879 7089839 7089039 hypothetical protein PF03883: Protein of unknown function (DUF328) 9.63 27598 B similar to unknown proteins 5 BAC73591.1 Non-secretory protein CDS SAVERM_5880 7090363 7091718 rnr putative ribonuclease R PF00773: RNB-like protein 5.44 48517 F RNA modification 3.6 BAC73592.1 Non-secretory protein CDS SAVERM_5881 7091804 7092652 putative AraC-family transcriptional regulator PF02311: AraC-like ligand binding domain 7.66 30598 F regulation 3.5.2 BAC73593.1 Non-secretory protein CDS SAVERM_5882 7092672 7093748 putative integral membrane protein PF00892: Integral membrane protein DUF6 10.14 36776 F miscellaneous 4.7 BAC73594.1 Non-secretory protein CDS SAVERM_5883 7095764 7094601 putative O-methyltransferase PF01135: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 5.25 41831 F miscellaneous 4.7 BAC73595.1 Non-secretory protein CDS SAVERM_5884 7096726 7095761 hypothetical protein 4.85 36139 F similar to unknown proteins 5 BAC73596.1 Non-secretory protein CDS SAVERM_5885 7096986 7096726 hypothetical protein 6.23 9091 F similar to unknown proteins 5 BAC73597.1 Non-secretory protein CDS SAVERM_5886 7097425 7097219 hypothetical protein 6.97 7309 F no similarity 6 BAC73598.1 Non-secretory protein CDS SAVERM_5887 7097918 7099063 hypothetical protein PF06036: Streptomyces protein of unknown function (DUF921) 6.05 40925 F similar to unknown proteins 5 BAC73599.1 Non-secretory protein CDS SAVERM_5888 7099080 7099433 hypothetical protein 4.94 13599 F no similarity 6 BAC73600.1 Non-secretory protein CDS SAVERM_5889 7100128 7099811 hypothetical protein 6.8 11908 F no similarity 6 BAC73601.1 Non-secretory protein CDS SAVERM_5890 7100211 7101026 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.29 29258 F similar to unknown proteins 5 BAC73602.1 Non-secretory protein CDS SAVERM_5891 7101223 7101762 putative secreted protein Tat substrate, PF05079: Protein of unknown function (DUF680) 6.94 19065 F similar to unknown proteins 5 BAC73603.1 Signal peptide CDS SAVERM_5892 7102672 7101854 putative secreted protein 10.36 28874 F similar to unknown proteins 5 BAC73604.1 Signal peptide CDS SAVERM_5893 7103246 7102713 hypothetical protein 9.55 19595 F similar to unknown proteins 5 BAC73605.1 Non-secretory protein CDS SAVERM_5894 7104490 7103213 mceF putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 5.24 43915 F miscellaneous 4.7 BAC73606.1 Non-secretory protein CDS SAVERM_5895 7105764 7104487 mceE putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 6.08 44700 F miscellaneous 4.7 BAC73607.1 Non-secretory protein CDS SAVERM_5896 7106885 7105761 mceD putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 9.77 39613 F miscellaneous 4.7 BAC73608.1 Signal peptide CDS SAVERM_5897 7108060 7106882 mceC putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 11.06 42752 F miscellaneous 4.7 BAC73609.1 Non-secretory protein CDS SAVERM_5898 7109148 7108057 mceB putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 10.37 38930 F miscellaneous 4.7 BAC73610.1 Non-secretory protein CDS SAVERM_5899 7110392 7109145 mceA putative mce(mammalian cell entry)-related protein mlaD, PF02470: mce related protein 7.22 44633 F miscellaneous 4.7 BAC73611.1 Non-secretory protein CDS SAVERM_5900 7111192 7110389 mlaE1 putative ABC transporter permease protein PF02405: Domain of unknown function DUF140 9.36 28434 F transport / binding proteins & lipoproteins 1.2 BAC73612.1 Non-secretory protein CDS SAVERM_5901 7111966 7111196 mlaE2 putative ABC transporter permease protein PF02405: Domain of unknown function DUF140 10.58 26694 F transport / binding proteins & lipoproteins 1.2 BAC73613.1 Non-secretory protein CDS SAVERM_5902 7112943 7111963 mlaF putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.81 36061 F transport / binding proteins & lipoproteins 1.2 BAC73614.1 Non-secretory protein CDS SAVERM_5903 7114112 7113078 sig48 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 8.28 36721 F RNA initiation 3.5.1 BAC73615.1 Non-secretory protein CDS SAVERM_5904 7115219 7114167 putative secreted protein PF01464: Transglycosylase SLT domain 9.02 36225 F miscellaneous 4.7 BAC73616.1 Signal peptide CDS SAVERM_5905 7117315 7115405 hypothetical protein PF09471: IgA Peptidase M64 6.25 67780 F similar to unknown proteins 5 BAC73617.1 Non-secretory protein CDS SAVERM_5906 7117882 7117325 hypothetical protein 5.98 19335 F no similarity 6 BAC73618.1 Non-secretory protein CDS SAVERM_5907 7119543 7118092 hypothetical protein PF12275: Protein of unknown function (DUF3616) 5.14 49618 F similar to unknown proteins 5 BAC73619.1 Non-secretory protein CDS SAVERM_5908 7120029 7119676 hypothetical protein PF03819: MazG nucleotide pyrophosphohydrolase domain 4.86 12532 F similar to unknown proteins 5 BAC73620.1 Non-secretory protein CDS SAVERM_5909 7120597 7120052 hypothetical protein PF07681: DoxX 8.51 17833 F similar to unknown proteins 5 BAC73621.1 Non-secretory protein CDS SAVERM_5910 7120763 7121089 hypothetical protein 5.13 12030 F similar to unknown proteins 5 BAC73622.1 Non-secretory protein CDS SAVERM_5911 7121960 7121220 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.76 26301 F transport / binding proteins & lipoproteins 1.2 BAC73623.1 Non-secretory protein CDS SAVERM_5912 7123522 7122065 putative ABC transporter permease protein PF02687: Predicted permease 10.59 48828 F transport / binding proteins & lipoproteins 1.2 BAC73624.1 Signal peptide CDS SAVERM_5913 7123858 7125198 dacF putative D-alanyl-D-alanine carboxypeptidase Tat substrate, PF00768: D-alanyl-D-alanine carboxypeptidase 10.43 45925 F cell wall 1.1 BAC73625.1 Non-secretory protein CDS SAVERM_5914 7126298 7125477 putative dehydrogenase PF00106: short chain dehydrogenase 7.56 28748 F miscellaneous 4.7 BAC73626.1 Non-secretory protein CDS SAVERM_5915 7126402 7128048 phoA putative alkaline phosphatase, secreted Tat substrate, PF00245: Alkaline phosphatase 6.11 60547 F metabolism of phosphates 2.6 BAC73627.1 Signal peptide CDS SAVERM_5916 7129202 7128195 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 4.66 35628 F miscellaneous 4.7 BAC73628.1 Non-secretory protein CDS SAVERM_5917 7129278 7130717 putative bicyclomycin resistance protein PF07690: Major Facilitator Superfamily 10.35 49030 F detoxification 4.2 BAC73629.1 Non-secretory protein CDS SAVERM_5918 7130795 7131844 blaA6 putative beta-lactamase PF00144: Beta-lactamase 8.33 36959 F detoxification 4.2 BAC73630.1 Non-secretory protein CDS SAVERM_5919 7131857 7132855 hypothetical protein PF09243: Mitochondrial small ribosomal subunit Rsm22 6.4 35254 F similar to unknown proteins 5 BAC73631.1 Non-secretory protein CDS SAVERM_5920 7132960 7133619 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.16 23795 F regulation 3.5.2 BAC73632.1 Non-secretory protein CDS SAVERM_5921 7134478 7133588 glpQ7 putative glycerophosphoryl diester phosphodiesterase F03009: Glycerophosphoryl diester phosphodiesterase family 11.75 31783 F metabolism of lipids 2.4 BAC73633.1 Non-secretory protein CDS SAVERM_5922 7134665 7135393 hypothetical protein PF09250: Bifunctional DNA primase/polymerase, N-terminal 5.13 26447 F similar to unknown proteins 5 BAC73634.1 Non-secretory protein CDS SAVERM_5923 7136491 7135421 hypothetical protein 10.45 37699 F similar to unknown proteins 5 BAC73635.1 Non-secretory protein CDS SAVERM_5924 7137390 7136524 putative membrane protein PF03239: Iron permease FTR1 family 8.22 30702 F miscellaneous 4.7 BAC73636.1 Non-secretory protein CDS SAVERM_5925 7138692 7137394 putative iron-dependent peroxidase PF04261: Dyp-type peroxidase family 6.44 46261 F miscellaneous 4.7 BAC73637.1 Non-secretory protein CDS SAVERM_5926 7139837 7138689 putative lipoprotein PF04302: Protein of unknown function (DUF451), putative IdeR-binding site: CATGGTGAGGCTGGCCTAA(7139887:7139905) 5.18 41309 F transport / binding proteins & lipoproteins 1.2 BAC73638.1 Signal peptide CDS SAVERM_5927 7140248 7139994 hypothetical protein 12.9 8948 F no similarity 6 BAC73639.1 Non-secretory protein CDS SAVERM_5928 7140301 7141176 hypothetical protein 8.85 33061 F similar to unknown proteins 5 BAC73640.1 Non-secretory protein CDS SAVERM_5929 7141169 7141813 hypothetical protein PF02567: phenazine biosynthesis-like protein 4.25 23077 F similar to unknown proteins 5 BAC73641.1 Non-secretory protein CDS SAVERM_5930 7142540 7141893 hmuO putative heme oxygenase PF01126: Heme oxygenase, putative IdeR-binding site: TATGGTTAGGCTTACCTAA(7142586:7142604) 6.68 24278 F metabolism of coenzymes & prosthetic groups 2.5 BAC73642.1 Non-secretory protein CDS SAVERM_5931 7143572 7142715 map4 putative methionyl aminopeptidase PF00557: metallopeptidase family M24 5.98 30986 F protein modification 3.8 BAC73643.1 Non-secretory protein CDS SAVERM_5932 7143631 7143867 hypothetical protein 4.75 9189 F similar to unknown proteins 5 BAC73644.1 Non-secretory protein CDS SAVERM_5933 7144648 7144040 hypothetical protein 7.43 21425 F similar to unknown proteins 5 BAC73645.1 Non-secretory protein CDS SAVERM_5934 7144755 7145828 neuA3 putative neuraminidase PF02012: BNR/Asp-box repeat 6.73 38201 F specific pathways 2.1.1 BAC73646.1 Non-secretory protein CDS SAVERM_5935 7145867 7146571 putative NADPH-dependent F420 reductase PF03807: NADP oxidoreductase coenzyme F420-dependent 5.63 24548 F miscellaneous 4.7 BAC73647.1 Non-secretory protein CDS SAVERM_5936 7146634 7146816 putative secreted protein 11.19 6435 F similar to unknown proteins 5 BAC73648.1 Signal peptide CDS SAVERM_5937 7147606 7146806 putative membrane protein PF02163: Peptidase family M50 7.18 28974 F miscellaneous 4.7 BAC73649.1 Non-secretory protein CDS SAVERM_5938 7147711 7148265 hypothetical protein 4.34 19994 F no similarity 6 BAC73650.1 Non-secretory protein CDS SAVERM_5939 7148262 7151792 putative multi-domain regulatory protein PF03704: Bacterial transcriptional activator domain 5.13 125092 F regulation 3.5.2 BAC73651.1 Non-secretory protein CDS SAVERM_5940 7152632 7151814 oleC5 putative ABC transporter permease protein PF01061: ABC-2 type transporter 10.01 29276 F transport / binding proteins & lipoproteins 1.2 BAC73652.1 Non-secretory protein CDS SAVERM_5941 7153669 7152629 oleC4 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.32 36564 F transport / binding proteins & lipoproteins 1.2 BAC73653.1 Non-secretory protein CDS SAVERM_5942 7153958 7154353 hypothetical protein 7.84 14180 F similar to unknown proteins 5 BAC73654.1 Non-secretory protein CDS SAVERM_5943 7155241 7154378 panB putative 3-methyl-2-oxobutanoate hydroxymethyltransferase PF02548: Ketopantoate hydroxymethyltransferase 5.67 30365 F metabolism of coenzymes & prosthetic groups 2.5 BAC73655.1 Non-secretory protein CDS SAVERM_5944 7155444 7157036 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 6.97 55335 F miscellaneous 4.7 BAC73656.1 Non-secretory protein CDS SAVERM_5945 7157137 7157757 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.92 22974 F regulation 3.5.2 BAC73657.1 Non-secretory protein CDS SAVERM_5946 7158034 7159071 putative membrane protein PF03372: Endonuclease/Exonuclease/phosphatase family 9.58 36527 F miscellaneous 4.7 BAC73658.1 Non-secretory protein CDS SAVERM_5947 7159217 7160443 putative transmembrane efflux protein similar to cmlR, PF07690: Major Facilitator Superfamily 10.56 40933 F transport / binding proteins & lipoproteins 1.2 BAC73659.1 Non-secretory protein CDS SAVERM_5948 7162291 7160537 nadE putative NH(3)-dependent NAD(+) synthetase PF02540: NAD synthase 4.77 63044 F metabolism of coenzymes & prosthetic groups 2.5 BAC73660.1 Non-secretory protein CDS SAVERM_5949 7164576 7162675 putative physarolisin II (secrted serine protease) PF00082: Subtilase family 8.11 65071 F protein modification 3.8 BAC73661.1 Signal peptide CDS SAVERM_5950 7165520 7164894 putative secreted protein PF03713: Domain of unknown function (DUF305) 5.59 22223 F miscellaneous 4.7 BAC73662.1 Signal peptide CDS SAVERM_5951 7166185 7165517 putative membrane protein PF11303: Protein of unknown function (DUF3105) 10.07 23949 F miscellaneous 4.7 BAC73663.1 Non-secretory protein CDS SAVERM_5952 7166321 7166821 hypothetical protein PF02082: Transcriptional regulator 8.93 17344 F similar to unknown proteins 5 BAC73664.1 Non-secretory protein CDS SAVERM_5953 7167978 7166776 fhbB putative flavohemoprotein PF00970: Oxidoreductase FAD-binding domain 6.23 43248 F membrane bioenergetics 1.4 BAC73665.1 Non-secretory protein CDS SAVERM_5954 7168307 7169668 glnA1 putative glutamine synthetase PF00120: Glutamine synthetase, catalytic domain 4.81 50529 F metabolism of amino acids & related molecules 2.2 BAC73666.1 Non-secretory protein CDS SAVERM_5955 7170057 7169746 hypothetical protein PF00589: Phage integrase family 6.97 11476 F similar to unknown proteins 5 BAC73667.1 Non-secretory protein CDS SAVERM_5956 7170364 7170603 hypothetical protein 4.1 9071 F no similarity 6 BAC73668.1 Non-secretory protein CDS SAVERM_5957 7170603 7171262 hypothetical protein 4.59 23064 F no similarity 6 BAC73669.1 Signal peptide CDS SAVERM_5958 7171640 7173271 hypothetical protein 11.58 60464 F similar to unknown proteins 5 BAC73670.1 Non-secretory protein CDS SAVERM_5959 7173320 7176457 putative LuxR-family transcriptional regulator PF03704: Bacterial transcriptional activator domain 5.82 111411 F regulation 3.5.2 BAC73671.1 Non-secretory protein CDS SAVERM_5960 7177229 7176435 putative ABC transporter permease protein Tat substrate, PF01061: ABC-2 type transporter 9.73 28448 F transport / binding proteins & lipoproteins 1.2 BAC73672.1 Non-secretory protein CDS SAVERM_5961 7178224 7177226 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.69 35448 F transport / binding proteins & lipoproteins 1.2 BAC73673.1 Non-secretory protein CDS SAVERM_5962 7179432 7178491 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.9 33836 F similar to unknown proteins 5 BAC73674.1 Non-secretory protein CDS SAVERM_5963 7180094 7179438 hypothetical protein 6.63 24257 F no similarity 6 BAC73675.1 Non-secretory protein CDS SAVERM_5964 7180920 7180384 hypothetical protein 5.62 20274 F no similarity 6 BAC73676.1 Non-secretory protein CDS SAVERM_5965 7182849 7182115 putative hydrolase PF01738: Dienelactone hydrolase family 5.04 26139 F miscellaneous 4.7 BAC73677.1 Non-secretory protein CDS SAVERM_5966 7183341 7183132 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.92 7251 F similar to unknown proteins 5 BAC73678.1 Non-secretory protein CDS SAVERM_5967 7183542 7183754 hypothetical protein 3.95 7625 F similar to unknown proteins 5 BAC73680.1 Non-secretory protein CDS SAVERM_5968 7183568 7183338 hypothetical protein 6.24 8536 F similar to unknown proteins 5 BAC73679.1 Non-secretory protein CDS SAVERM_5969 7184826 7183804 hypothetical protein 9.56 36844 F no similarity 6 BAC73681.1 Signal peptide CDS SAVERM_5970 7186142 7184823 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10.85 45350 F similar to unknown proteins 5 BAC73682.1 Non-secretory protein CDS SAVERM_5971 7187037 7186144 phoC putative secreted acid phosphatase PF04185: Phosphoesterase family 7 31362 F miscellaneous 4.7 BAC73683.1 Signal peptide CDS SAVERM_5972 7187469 7190471 glnE putative glutamate-ammonia-ligase adenylyltransferase PF03710: Glutamate-ammonia ligase adenylyltransferase 6.27 108700 F metabolism of amino acids & related molecules 2.2 BAC73684.1 Non-secretory protein CDS SAVERM_5973 7191448 7190459 hypothetical protein PF00892: Integral membrane protein DUF6 11.61 33473 F similar to unknown proteins 5 BAC73685.1 Non-secretory protein CDS SAVERM_5974 7191520 7192413 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 5.46 31306 F regulation 3.5.2 BAC73686.1 Signal peptide CDS SAVERM_5975 7193720 7192845 hypothetical protein 8.93 32511 F similar to unknown proteins 5 BAC73687.1 Non-secretory protein CDS SAVERM_5976 7194858 7193824 malR1 putative repressor of malE transcription PF00356: Bacterial regulatory proteins, lacI family 5.43 36560 F regulation 3.5.2 BAC73688.1 Non-secretory protein CDS SAVERM_5977 7195314 7196585 malE putative maltose-binding protein Tat substrate, multiple sugar ABC transporter solute-binding protein, PF01547: Bacterial extracellular solute-binding protein 9.38 44570 F transport / binding proteins & lipoproteins 1.2 BAC73689.1 Signal peptide CDS SAVERM_5978 7196707 7197711 malF putative maltose permease multiple sugar ABC transporter permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 9.79 37690 F transport / binding proteins & lipoproteins 1.2 BAC73690.1 Non-secretory protein CDS SAVERM_5979 7197731 7198639 malG putative maltose permease multiple sugar ABC transporter permease protein, PF00528: Binding-protein-dependent transport system inner membrane component 9.14 33070 F transport / binding proteins & lipoproteins 1.2 BAC73691.1 Non-secretory protein CDS SAVERM_5980 7198686 7200536 aglA2 putative alpha-glucosidase PF00128: Alpha amylase, catalytic domain 4.69 67591 F specific pathways 2.1.1 BAC73692.1 Non-secretory protein CDS SAVERM_5981 7200765 7202147 amyA4 putative secreted alpha-amylase PF00128: Alpha amylase, catalytic domain 5.07 49330 F specific pathways 2.1.1 BAC73693.1 Signal peptide CDS SAVERM_5982 7202286 7207706 amyX putative pullulanase, secreted PF00128: Alpha amylase, catalytic domain 6.18 194324 F specific pathways 2.1.1 BAC73694.1 Signal peptide CDS SAVERM_5983 7207777 7209381 prpG2 putative magnesium or manganese-dependent protein phosphatase PF00072: Response regulator receiver domain 5.97 56001 F protein modification 3.8 BAC73695.1 Non-secretory protein CDS SAVERM_5984 7209413 7209769 putative isomerase PF02962: 5-carboxymethyl-2-hydroxymuconate isomerase 5.62 12760 F miscellaneous 4.7 BAC73696.1 Non-secretory protein CDS SAVERM_5985 7210474 7209773 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.73 25602 F regulation 3.5.2 BAC73697.1 Non-secretory protein CDS SAVERM_5986 7212469 7210553 hypothetical protein 9.89 65851 F similar to unknown proteins 5 BAC73698.1 Non-secretory protein CDS SAVERM_5987 7213139 7212627 hypothetical protein 4.36 18516 F similar to unknown proteins 5 BAC73699.1 Non-secretory protein CDS SAVERM_5988 7216312 7213196 putative alpha-N-acetylglucosaminidase, secreted Tat substrate, PF05089: Alpha-N-acetylglucosaminidase (NAGLU) 8.83 111175 F cell wall 1.1 BAC73700.1 Signal peptide CDS SAVERM_5989 7216425 7216892 putative lipoprotein 6.67 15965 F transport / binding proteins & lipoproteins 1.2 BAC73701.1 Signal peptide CDS SAVERM_5990 7218526 7216982 putative secreted protein 9.67 54317 F miscellaneous 4.7 BAC73702.1 Signal peptide CDS SAVERM_5991 7219431 7218778 putative two-component system response regulator PF00072: Response regulator receiver domain 4.97 23617 F regulation 3.5.2 BAC73703.1 Non-secretory protein CDS SAVERM_5992 7220696 7219416 putative two-component system sensor kinase PF07730: Histidine kinase 9.14 45287 F sensors 1.3 BAC73704.1 Non-secretory protein CDS SAVERM_5993 7221815 7220796 putative reductase PF01370: NAD dependent epimerase/dehydratase family 4.88 36166 F miscellaneous 4.7 BAC73705.1 Non-secretory protein CDS SAVERM_5994 7222472 7221888 putative regulatory protein PF00486: Transcriptional regulatory protein, C terminal 7.38 21182 F regulation 3.5.2 BAC73706.1 Non-secretory protein CDS SAVERM_5995 7222801 7222592 hypothetical protein 10.25 7878 F similar to unknown proteins 5 BAC73707.1 Non-secretory protein CDS SAVERM_5996 7223723 7222803 hypothetical protein 4.39 34074 F similar to unknown proteins 5 BAC73708.1 Non-secretory protein CDS SAVERM_5997 7224837 7223809 glnA2 putative glutamine synthetase PF00120: Glutamine synthetase, catalytic domain 4.48 37256 F metabolism of amino acids & related molecules 2.2 BAC73709.1 Non-secretory protein CDS SAVERM_5998 7226128 7225433 putative secreted protein 8.66 23004 F miscellaneous 4.7 BAC73710.1 Signal peptide CDS SAVERM_5999 7226613 7226254 arsC putative arsenate reductase PF03960: ArsC family 4.51 13473 F detoxification 4.2 BAC73711.1 Non-secretory protein CDS SAVERM_6000 7226778 7227086 hypothetical protein 11.41 11595 F similar to unknown proteins 5 BAC73712.1 Non-secretory protein CDS SAVERM_6001 7229018 7227342 hypothetical protein PF01636: Phosphotransferase enzyme family 5.84 60028 F similar to unknown proteins 5 BAC73713.1 Non-secretory protein CDS SAVERM_6002 7230203 7229562 hypothetical protein 5.07 22753 F similar to unknown proteins 5 BAC73714.1 Non-secretory protein CDS SAVERM_6003 7231142 7230210 htpX2 putative heat shock protein, protease HtpX homolog (EC 3.4.24.-), Tat substrate, PF01435: Peptidase family M48 9.94 33906 F adaptation to atypical conditions 4.1 BAC73715.1 Non-secretory protein CDS SAVERM_6004 7231516 7231839 putative secreted protein Tat substrate 11.48 10740 F no similarity 6 BAC73716.1 Signal peptide CDS SAVERM_6005 7233360 7231951 glnA3 putative glutamine synthetase PF00120: Glutamine synthetase, catalytic domain 4.91 52391 F metabolism of amino acids & related molecules 2.2 BAC73717.1 Non-secretory protein CDS SAVERM_6006 7233548 7234039 putative membrane protein PF06271: RDD family 10.73 17710 F miscellaneous 4.7 BAC73718.1 Non-secretory protein CDS SAVERM_6007 7234938 7234237 putative integral membrane protein 11.52 24720 F miscellaneous 4.7 BAC73719.1 Non-secretory protein CDS SAVERM_6008 7235195 7234998 hypothetical protein 12.08 7237 F similar to unknown proteins 5 BAC73720.1 Non-secretory protein CDS SAVERM_6009 7236458 7235472 lipA putative lipoic acid synthetase PF04055: Radical SAM superfamily 5.96 36964 F metabolism of coenzymes & prosthetic groups 2.5 BAC73721.1 Non-secretory protein CDS SAVERM_6010 7237364 7236567 lipB putative lipoate-protein ligase PF03099: Biotin/lipoate A/B protein ligase family 5.24 29264 F metabolism of coenzymes & prosthetic groups 2.5 BAC73722.1 Non-secretory protein CDS SAVERM_6011 7237623 7239062 putative regulatory protein 9.88 52316 F regulation 3.5.2 BAC73723.1 Non-secretory protein CDS SAVERM_6012 7240597 7239200 putative oxidoreductase PF01593: Flavin containing amine oxidoreductase 10 48323 F miscellaneous 4.7 BAC73724.1 Non-secretory protein CDS SAVERM_6013 7241899 7240979 putative NAD dependent epimerase/dehydratase family PF01370: NAD dependent epimerase/dehydratase family 6.53 31816 F miscellaneous 4.7 BAC73725.1 Non-secretory protein CDS SAVERM_6014 7241962 7242480 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 7.26 19146 F miscellaneous 4.7 BAC73726.1 Non-secretory protein CDS SAVERM_6015 7243659 7242475 putative serine protease PF00089: Trypsin 5.8 40470 F protein modification 3.8 BAC73727.1 Non-secretory protein CDS SAVERM_6016 7243750 7244703 hypothetical protein PF01510: N-acetylmuramoyl-L-alanine amidase 11.87 33489 F similar to unknown proteins 5 BAC73728.1 Non-secretory protein CDS SAVERM_6017 7244790 7245017 putative secreted protein 11.22 7779 F no similarity 6 BAC73729.1 Signal peptide CDS SAVERM_6018 7245573 7245052 hypothetical protein 3.76 19690 F similar to unknown proteins 5 BAC73730.1 Non-secretory protein CDS SAVERM_6019 7246649 7245678 putative DeoR-family transcriptional regulator PF08279: HTH domain 6.33 35585 F regulation 3.5.2 BAC73731.1 Non-secretory protein CDS SAVERM_6020 7249440 7246738 aceE2 putative pyruvate dehydrogenase E1 component PF00456: Transketolase, thiamine diphosphate binding domain 5.39 98961 F main glycolytic pathways 2.1.2 BAC73732.1 Non-secretory protein CDS SAVERM_6021 7250414 7249791 putative GntR-family transcriptional regulator PF07729: FCD domain 6.24 22893 F regulation 3.5.2 BAC73733.1 Non-secretory protein CDS SAVERM_6022 7252471 7250648 sucB putative dihydrolipoamide S-succinyltransferase PF00198: 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 4.3 60547 F TCA cycle 2.1.3 BAC73734.1 Non-secretory protein CDS SAVERM_6024 7253969 7252581 lpdA1 putative dihydrolipoamide dehydrogenase PF07992: Pyridine nucleotide-disulphide oxidoreductase 6.16 52690 F TCA cycle 2.1.3 BAC73735.1 Non-secretory protein CDS SAVERM_6025 7255809 7254268 pepA putative leucyl aminopeptidase (cytosol aminopeptidase) PF00883: Cytosol aminopeptidase family, catalytic domain 5.26 51922 F protein modification 3.8 BAC73736.1 Non-secretory protein CDS SAVERM_6026 7256993 7256211 cobS putative cobalamin (5’-phosphate) synthase cobalamin biosynthesis, PF02654: Cobalamin-5-phosphate synthase 9.89 25667 F metabolism of coenzymes & prosthetic groups 2.5 BAC73737.1 Non-secretory protein CDS SAVERM_6027 7257067 7257831 putative integral membrane protein PF00499: NADH-ubiquinone/plastoquinone oxidoreductase chain 6 11.79 27479 F miscellaneous 4.7 BAC73738.1 Non-secretory protein CDS SAVERM_6028 7258483 7257812 putative integral membrane protein 10.03 23769 F miscellaneous 4.7 BAC73739.1 Non-secretory protein CDS SAVERM_6029 7260474 7258540 putative integral membrane protein PF04329: Family of unknown function (DUF470) 10.6 71775 F miscellaneous 4.7 BAC73740.1 Non-secretory protein CDS SAVERM_6030 7261820 7260693 cobT1 putative nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase cobalamin biosynthesis, PF02277: Phosphoribosyltransferase 4.32 38742 F metabolism of coenzymes & prosthetic groups 2.5 BAC73741.1 Non-secretory protein CDS SAVERM_6031 7261933 7263144 hypothetical protein PF08242: Methyltransferase domain 9.31 45280 F similar to unknown proteins 5 BAC73742.1 Non-secretory protein CDS SAVERM_6032 7264525 7263206 cobU putative adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase cobalamin biosynthesis, PF02283: Cobinamide kinase / cobinamide phosphate guanyltransferase 5.48 45559 F miscellaneous 4.7 BAC73743.1 Non-secretory protein CDS SAVERM_6033 7264667 7264891 hypothetical protein 3.81 8375 F similar to unknown proteins 5 BAC73744.1 Non-secretory protein CDS SAVERM_6034 7265704 7264991 putative methyltransferase PF01739: CheR methyltransferase, SAM binding domain 5.3 25036 F miscellaneous 4.7 BAC73745.1 Non-secretory protein CDS SAVERM_6035 7266414 7265788 putative integral membrane protein 11.95 23892 F miscellaneous 4.7 BAC73746.1 Non-secretory protein CDS SAVERM_6036 7266712 7267482 pspA putative phage shock protein A PF04012: PspA/IM30 family 4.98 28127 F phage-related functions 4.4 BAC73747.1 Non-secretory protein CDS SAVERM_6037 7267507 7267785 hypothetical protein 3.87 10024 F similar to unknown proteins 5 BAC73748.1 Non-secretory protein CDS SAVERM_6038 7268025 7269245 putative two-component system sensor kinase PF07730: Histidine kinase 9.86 42804 F sensors 1.3 BAC73749.1 Non-secretory protein CDS SAVERM_6039 7269242 7269925 putative two-component system response regulator PF00072: Response regulator receiver domain 4.51 24118 F regulation 3.5.2 BAC73750.1 Non-secretory protein CDS SAVERM_6040 7270082 7273243 putative cation/multidrug efflux protein involving efflux of acriflavin-related compounds, PF00873: AcrB/AcrD/AcrF family 5.09 109726 F transport / binding proteins & lipoproteins 1.2 BAC73751.1 Non-secretory protein CDS SAVERM_6041 7274618 7273374 nadA putative quinolinate synthetase PF02445: Quinolinate synthetase A protein 4.96 45621 F metabolism of coenzymes & prosthetic groups 2.5 BAC73752.1 Non-secretory protein CDS SAVERM_6042 7274893 7275249 hypothetical protein PF01521: HesB-like domain 3.98 12431 F similar to unknown proteins 5 BAC73753.1 Non-secretory protein CDS SAVERM_6043 7276913 7275456 putative membrane protein PF04886: PT repeat 5.18 49133 F miscellaneous 4.7 BAC73754.1 Non-secretory protein CDS SAVERM_6044 7277700 7277491 hypothetical protein 6.22 7271 F similar to unknown proteins 5 BAC73755.1 Non-secretory protein CDS SAVERM_6045 7277792 7278808 putative carbohydrate kinase PF00294: pfkB family carbohydrate kinase 4.91 36813 F miscellaneous 4.7 BAC73756.1 Non-secretory protein CDS SAVERM_6046 7280226 7278844 putative aminotransferase PF00266: Aminotransferase class-V 5.67 48198 F metabolism of amino acids & related molecules 2.2 BAC73757.1 Non-secretory protein CDS SAVERM_6047 7280555 7281514 ctaC putative cytochrome c oxidase subunit II (complex IV) Tat substrate, PF00116: Cytochrome C oxidase subunit II, periplasmic domain 10.28 35493 F membrane bioenergetics 1.4 BAC73758.1 Non-secretory protein CDS SAVERM_6048 7281511 7283250 ctaD1 putative cytochrome c oxidase subunit I (complex IV) PF00115: Cytochrome C and Quinol oxidase polypeptide I 7.31 63950 F membrane bioenergetics 1.4 BAC73759.1 Non-secretory protein CDS SAVERM_6049 7283247 7283645 putative integral membrane protein 4.97 14643 F miscellaneous 4.7 BAC73760.1 Non-secretory protein CDS SAVERM_6050 7283820 7285085 lppS putative lipoprotein PF03734: ErfK/YbiS/YcfS/YnhG 7.34 44770 F miscellaneous 4.7 BAC73761.1 Signal peptide CDS SAVERM_6051 7285540 7285142 putative two-component system response regulator PF00072: Response regulator receiver domain 4.27 14026 F regulation 3.5.2 BAC73762.1 Non-secretory protein CDS SAVERM_6052 7285719 7286339 ctaE putative cytochrome c oxidase subunit III (complex IV) PF00510: Cytochrome c oxidase subunit III 8.45 22895 F membrane bioenergetics 1.4 BAC73763.1 Non-secretory protein CDS SAVERM_6053 7286403 7287212 qcrC putative cytochrome c heme-binding subunit PF00034: Cytochrome c 8.61 27509 F membrane bioenergetics 1.4 BAC73764.1 Signal peptide CDS SAVERM_6054 7287209 7288282 qcrA putative ubiquinol-cytochrome c reductase iron-sulphur 'Rieske' subunit PF00355: Rieske [2Fe-2S] domain 5.27 39278 F membrane bioenergetics 1.4 BAC73765.1 Non-secretory protein CDS SAVERM_6055 7288279 7289925 qcrB putative cytochrome b subunit PF00033: Cytochrome b(N-terminal)/b6/petB 8.57 61195 F membrane bioenergetics 1.4 BAC73766.1 Non-secretory protein CDS SAVERM_6056 7290084 7291148 trpD putative anthranilate phosphoribosyltransferase PF00591: Glycosyl transferase family, a/b domain 5.1 36520 F metabolism of amino acids & related molecules 2.2 BAC73767.1 Non-secretory protein CDS SAVERM_6057 7291526 7292899 putative aminotransferase PF00266: Aminotransferase class-V 5.41 48677 F metabolism of amino acids & related molecules 2.2 BAC73768.1 Non-secretory protein CDS SAVERM_6058 7293207 7292926 putative AsnC-family transcriptional regulator PF01037: AsnC family 4.25 9901 F regulation 3.5.2 BAC73769.1 Non-secretory protein CDS SAVERM_6059 7293947 7293204 putative integral membrane protein PF01694: Rhomboid family 9.13 26134 F miscellaneous 4.7 BAC73770.1 Non-secretory protein CDS SAVERM_6060 7294035 7294313 hypothetical protein 4.64 10213 F similar to unknown proteins 5 BAC73771.1 Non-secretory protein CDS SAVERM_6061 7294349 7295698 hypothetical protein PF05991: Protein of unknown function (DUF901) 7.53 48287 F similar to unknown proteins 5 BAC73772.1 Non-secretory protein CDS SAVERM_6062 7296036 7297076 putative NLP/P60-family secreted protein (PgpA peptidase) PF00877: NlpC/P60 family 9.82 37006 F miscellaneous 4.7 BAC73773.1 Signal peptide CDS SAVERM_6063 7297300 7298313 putative NLP/P60-family secreted protein (PgpA peptidase) PF00877: NlpC/P60 family 9.91 35887 F miscellaneous 4.7 BAC73774.1 Signal peptide CDS SAVERM_6064 7298336 7299556 putative secreted protein 9.7 42817 F similar to unknown proteins 5 BAC73775.1 Signal peptide CDS SAVERM_6065 7299741 7301087 putative transporter PF01554: MatE 10.99 45652 F transport / binding proteins & lipoproteins 1.2 BAC73776.1 Non-secretory protein CDS SAVERM_6066 7302280 7301048 putative membrane protein 10.17 44336 F similar to unknown proteins 5 BAC73777.1 Non-secretory protein CDS SAVERM_6067 7302443 7303585 putative glycosyltransferase PF00534: Glycosyl transferases group 1 8.48 40942 F specific pathways 2.1.1 BAC73778.1 Non-secretory protein CDS SAVERM_6068 7303865 7305499 putative cholesterol oxidase, secreted Tat substrate, PF05199: GMC oxidoreductase 8.62 58640 F specific pathways 2.1.1 BAC73779.1 Non-secretory protein CDS SAVERM_6069 7307315 7305519 fadD14 putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.46 64335 F metabolism of lipids 2.4 BAC73780.1 Non-secretory protein CDS SAVERM_6070 7307611 7308408 hypothetical protein PF00149: Calcineurin-like phosphoesterase 6.88 29293 F similar to unknown proteins 5 BAC73781.1 Non-secretory protein CDS SAVERM_6071 7308543 7308986 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 4.62 16199 F similar to unknown proteins 5 BAC73782.1 Non-secretory protein CDS SAVERM_6072 7309096 7310265 putative ion transporting ATPase PF02374: Anion-transporting ATPase 4.92 41730 F miscellaneous 4.7 BAC73783.1 Signal peptide CDS SAVERM_6073 7310369 7310884 hypothetical protein 4.63 18164 F similar to unknown proteins 5 BAC73784.1 Non-secretory protein CDS SAVERM_6074 7310940 7311893 glkA1 glucokinase PF00480: ROK family 6.25 33018 F main glycolytic pathways 2.1.2 BAC73785.1 Non-secretory protein CDS SAVERM_6075 7311988 7312761 hypothetical protein PF03372: Endonuclease/Exonuclease/phosphatase family 8.39 27351 F similar to unknown proteins 5 BAC73786.1 Non-secretory protein CDS SAVERM_6076 7313819 7312758 hypothetical protein 7.97 39406 F no similarity 6 BAC73787.1 Non-secretory protein CDS SAVERM_6077 7314393 7313773 sig49 putative RNA polymerase ECF-subfamily sigma factor PF04545: Sigma-70, region 4 9.62 22758 F RNA initiation 3.5.1 BAC73788.1 Non-secretory protein CDS SAVERM_6078 7315308 7314664 hypothetical protein 3.62 21672 F similar to unknown proteins 5 BAC73789.1 Non-secretory protein CDS SAVERM_6079 7316218 7315301 putative esterase/lipase PF00975: Thioesterase domain 7.5 33276 F miscellaneous 4.7 BAC73790.1 Signal peptide CDS SAVERM_6080 7316297 7317079 plsC3 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 9.97 28274 F metabolism of lipids 2.4 BAC73791.1 Non-secretory protein CDS SAVERM_6081 7317110 7318342 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.67 43338 F sensors 1.3 BAC73792.1 Non-secretory protein CDS SAVERM_6082 7318369 7319016 putative two-component system response regulator PF00072: Response regulator receiver domain 6.03 22979 F regulation 3.5.2 BAC73793.1 Non-secretory protein CDS SAVERM_6083 7319161 7320189 pfkA2 6-phosphofructokinase PF00365: Phosphofructokinase 6.41 36724 F main glycolytic pathways 2.1.2 BAC73794.1 Non-secretory protein CDS SAVERM_6084 7322268 7320283 phzE putative anthranilate/para-aminobenzoate synthases component I PF00117: Glutamine amidotransferase class-I 5 71543 F metabolism of amino acids & related molecules 2.2 BAC73795.1 Non-secretory protein CDS SAVERM_6085 7322604 7323869 putative secreted protein 6.6 44726 F no similarity 6 BAC73796.1 Signal peptide CDS SAVERM_6086 7323905 7325257 aroG putative 2-dehydro-3-deoxyphosphoheptonate aldolase EC:2.5.1.54, DAHP synthase 5.16 49696 F metabolism of amino acids & related molecules 2.2 BAC73797.1 Non-secretory protein CDS SAVERM_6087 7325434 7325697 hypothetical protein PF04324: BFD-like [2Fe-2S] binding domain, putative IdeR-binding site: TAAGGTTAGGTTAGCCTCA(7325372:7325390) 8.04 9336 F similar to unknown proteins 5 BAC73798.1 Non-secretory protein CDS SAVERM_6088 7326218 7325739 bfrA putative bacterioferritin PF00210: Ferritin-like domain 4.31 18603 F miscellaneous 4.7 BAC73799.1 Non-secretory protein CDS SAVERM_6089 7326374 7327006 hypothetical protein PF00174: Oxidoreductase molybdopterin binding domain 6.03 23965 F similar to unknown proteins 5 BAC73800.1 Non-secretory protein CDS SAVERM_6090 7327631 7327035 hypothetical protein 7.53 20611 F similar to unknown proteins 5 BAC73801.1 Non-secretory protein CDS SAVERM_6091 7328612 7327680 nfo putative endonuclease IV PF01261: Xylose isomerase-like TIM barrel 6.01 32790 F DNA modification & repair 3.2 BAC73802.1 Non-secretory protein CDS SAVERM_6092 7330617 7328671 pkn28 putative eukaryotic-type serine/threonine protein kinase PF03793: PASTA domain, PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 5.1 68588 F protein modification 3.8 BAC73803.1 Non-secretory protein CDS SAVERM_6093 7331477 7330683 thiG putative thiamine biosynthesis protein: thiazole moiety synthesis PF05690: Thiazole biosynthesis protein ThiG 4.68 27682 F metabolism of coenzymes & prosthetic groups 2.5 BAC73804.1 Non-secretory protein CDS SAVERM_6094 7331681 7331481 thiS putative sulfur transfer protein involved in thiamine biosynthesis PF02597: ThiS family 6.72 6775 F metabolism of coenzymes & prosthetic groups 2.5 BAC73805.1 Non-secretory protein CDS SAVERM_6095 7332844 7331678 goxB putative glycine oxidase PF01266: FAD dependent oxidoreductase 6.61 41136 F metabolism of amino acids & related molecules 2.2 BAC73806.1 Non-secretory protein CDS SAVERM_6096 7332974 7333357 hypothetical protein 5.19 14015 F similar to unknown proteins 5 BAC73807.1 Non-secretory protein CDS SAVERM_6097 7333390 7334619 fprE putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.03 42976 F membrane bioenergetics 1.4 BAC73808.1 Non-secretory protein CDS SAVERM_6098 7334766 7335131 putative transcriptional regulatory protein 4.5 13281 F regulation 3.5.2 BAC73809.1 Non-secretory protein CDS SAVERM_6099 7335277 7335954 thiE putative thiamine-phosphate pyrophosphorylase PF02581: Thiamine monophosphate synthase/TENI 5.56 24160 F metabolism of coenzymes & prosthetic groups 2.5 BAC73810.1 Non-secretory protein CDS SAVERM_6100 7336079 7337002 metF putative 5,10-methylenetetrahydrofolate reductase PF02219: Methylenetetrahydrofolate reductase 6.1 33430 F metabolism of coenzymes & prosthetic groups 2.5 BAC73811.1 Non-secretory protein CDS SAVERM_6101 7337059 7337976 putative membrane protein 4.15 32932 F miscellaneous 4.7 BAC73812.1 Non-secretory protein CDS SAVERM_6102 7339571 7338078 crtI2 putative phytoene dehydrogenase PF01266: FAD dependent oxidoreductase 7.09 52361 F metabolism of lipids 2.4 BAC73813.1 Non-secretory protein CDS SAVERM_6103 7340270 7339617 putative membrane protein 9.03 22645 F miscellaneous 4.7 BAC73814.1 Signal peptide CDS SAVERM_6104 7341317 7340634 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.79 24440 F regulation 3.5.2 BAC73815.1 Non-secretory protein CDS SAVERM_6105 7343398 7341314 putative ABC transporter permease protein PF01061: ABC-2 type transporter 9.46 73098 F transport / binding proteins & lipoproteins 1.2 BAC73816.1 Non-secretory protein CDS SAVERM_6106 7344392 7343370 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.04 35439 F transport / binding proteins & lipoproteins 1.2 BAC73817.1 Non-secretory protein CDS SAVERM_6107 7344573 7345121 hypothetical protein 11.14 19403 F no similarity 6 BAC73818.1 Non-secretory protein CDS SAVERM_6108 7345418 7346188 putative methyltransferase PF05401: Nodulation protein S (NodS) 5.01 26644 F miscellaneous 4.7 BAC73819.1 Non-secretory protein CDS SAVERM_6109 7346464 7346856 putative membrane protein PF04143: YeeE/YedE family (DUF395) 11.5 14753 F miscellaneous 4.7 BAC73820.1 Non-secretory protein CDS SAVERM_6110 7349633 7347246 putative membrane protein PF01841: Transglutaminase-like superfamily 9.78 84083 F miscellaneous 4.7 BAC73821.1 Signal peptide CDS SAVERM_6111 7350991 7349630 putative membrane protein PF01882: Protein of unknown function DUF58 9.09 49010 F miscellaneous 4.7 BAC73822.1 Non-secretory protein CDS SAVERM_6112 7352019 7350988 putative regulatory protein PF07726: ATPase family associated with various cellular activities (AAA) 6.06 37504 F regulation 3.5.2 BAC73823.1 Non-secretory protein CDS SAVERM_6113 7352815 7352267 cynT3 putative carbonic anhydrase PF00484: Carbonic anhydrase 4.77 19965 F miscellaneous 4.7 BAC73824.1 Non-secretory protein CDS SAVERM_6114 7353263 7354219 mraW putative S-adenosylmethionine-dependent methyltransferase PF01795: MraW methylase family 6.54 34703 F miscellaneous 4.7 BAC73825.1 Non-secretory protein CDS SAVERM_6115 7354230 7354757 putative membrane protein PF04977: Septum formation initiator 11.01 18203 F miscellaneous 4.7 BAC73826.1 Non-secretory protein CDS SAVERM_6116 7354754 7356715 ftsI putative cell division protein FtsI/penicillin-binding protein PF00905: Penicillin binding protein transpeptidase domain 10.19 69334 F cell wall 1.1 BAC73827.1 Non-secretory protein CDS SAVERM_6117 7356881 7358401 murE putative UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase PF01225: Mur ligase family, catalytic domain 5.06 53261 F cell wall 1.1 BAC73828.1 Non-secretory protein CDS SAVERM_6118 7358406 7359821 murF putative UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase PF01225: Mur ligase family, catalytic domain 4.83 48845 F cell wall 1.1 BAC73829.1 Non-secretory protein CDS SAVERM_6119 7359818 7360891 murX putative phospho-N-acetylmuramoyl-pentapeptide-transferase mraY, PF00953: Glycosyl transferase 9.84 38440 F cell wall 1.1 BAC73830.1 Non-secretory protein CDS SAVERM_6120 7360888 7362291 murD putative UDP-N-acetylmuramoylalanine-D-glutamate ligase PF01225: Mur ligase family, catalytic domain 4.9 48546 F cell wall 1.1 BAC73831.1 Non-secretory protein CDS SAVERM_6121 7362356 7363705 ftsW1 putative cell division membrane protein FtsW PF01098: Cell cycle protein 11.86 47879 F cell division 1.7 BAC73832.1 Non-secretory protein CDS SAVERM_6122 7363712 7364803 murG putative UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol N-acetylglucosamine transferase PF04101: Glycosyltransferase family 28 C-terminal domain 9.39 38524 F cell wall 1.1 BAC73833.1 Non-secretory protein CDS SAVERM_6123 7365019 7365810 ftsQ putative cell division septal protein FtsQ PF03799: Cell division protein FtsQ 11.04 27898 F cell division 1.7 BAC73834.1 Non-secretory protein CDS SAVERM_6124 7366087 7367277 ftsZ putative cell division GTPase FtsZ PF00091: Tubulin/FtsZ family, GTPase domain 4.19 40730 F cell division 1.7 BAC73835.1 Non-secretory protein CDS SAVERM_6125 7367274 7368002 hypothetical protein PF02578: Uncharacterised ACR, YfiH family COG1496 4.63 25355 F similar to unknown proteins 5 BAC73836.1 Non-secretory protein CDS SAVERM_6126 7368009 7368728 hypothetical protein PF01168: Alanine racemase, N-terminal domain 5.81 25218 F similar to unknown proteins 5 BAC73837.1 Non-secretory protein CDS SAVERM_6127 7368859 7369500 hypothetical protein PF04472: Protein of unknown function (DUF552) 5.17 23925 F similar to unknown proteins 5 BAC73838.1 Non-secretory protein CDS SAVERM_6128 7369552 7369836 putative membrane protein PF02325: YGGT family 9.63 10786 F miscellaneous 4.7 BAC73839.1 Non-secretory protein CDS SAVERM_6129 7369883 7371109 hypothetical protein PF05103: DivIVA protein 4.82 42520 F similar to unknown proteins 5 BAC73840.1 Non-secretory protein CDS SAVERM_6130 7374491 7371348 ileS putative isoleucyl-tRNA synthetase PF00133: tRNA synthetases class I (I, L, M and V) 4.85 117130 F aminoacyl-tRNA-synthetase 3.7.2 BAC73841.1 Non-secretory protein CDS SAVERM_6131 7375244 7376314 putative DNA-binding protein PF01258: Prokaryotic dksA/traR C4-type zinc finger 10.62 35822 F regulation 3.5.2 BAC73842.1 Non-secretory protein CDS SAVERM_6132 7376393 7376995 lspA putative signal peptidase II PF01252: Signal peptidase (SPase) II 5.66 21000 F protein secretion 1.6 BAC73843.1 Non-secretory protein CDS SAVERM_6133 7377080 7378024 rluD putative pseudouridylate synthase PF00849: RNA pseudouridylate synthase 6.46 34026 F RNA modification 3.6 BAC73844.1 Non-secretory protein CDS SAVERM_6134 7378506 7378015 hypothetical protein 8.59 17949 F no similarity 6 BAC73845.1 Non-secretory protein CDS SAVERM_6135 7378547 7380142 putative sodium/proton antiporter PF00999: Sodium/hydrogen exchanger family 5.93 57165 F transport / binding proteins & lipoproteins 1.2 BAC73846.1 Non-secretory protein CDS SAVERM_6136 7380357 7381097 fabG6 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 5.58 25315 F metabolism of lipids 2.4 BAC73847.1 Non-secretory protein CDS SAVERM_6137 7382324 7381221 putative membrane protein PF00924: Mechanosensitive ion channel 9.96 40276 F miscellaneous 4.7 BAC73848.1 Non-secretory protein CDS SAVERM_6138 7382444 7383013 hypothetical protein PF01738: Dienelactone hydrolase family 4.27 20515 F similar to unknown proteins 5 BAC73849.1 Non-secretory protein CDS SAVERM_6139 7384772 7383111 phoD1 putative alkaline phosphatase, secereted Tat substrate, PF00245: Alkaline phosphatase 7.01 59976 F miscellaneous 4.7 BAC73850.1 Signal peptide CDS SAVERM_6140 7385710 7384871 hypothetical protein PF01323: DSBA-like thioredoxin domain 10.06 30270 F similar to unknown proteins 5 BAC73851.1 Non-secretory protein CDS SAVERM_6141 7386463 7385777 putative membrane protein 12.43 23502 F miscellaneous 4.7 BAC73852.1 Non-secretory protein CDS SAVERM_6142 7387857 7386532 hypothetical protein PF10009: Uncharacterized protein conserved in bacteria (DUF2252) 4.6 48262 F similar to unknown proteins 5 BAC73853.1 Non-secretory protein CDS SAVERM_6143 7388156 7391695 dnaE1 putative DNA polymerase III alpha subunit PF07733: Bacterial DNA polymerase III alpha subunit 5.66 130781 F DNA replication 3.1 BAC73854.1 Non-secretory protein CDS SAVERM_6144 7392008 7391829 hypothetical protein 11.65 6626 F no similarity 6 BAC73855.1 Non-secretory protein CDS SAVERM_6145 7392224 7393450 hypothetical protein PF01936: Protein of unknown function DUF88 5.8 44602 F similar to unknown proteins 5 BAC73856.1 Non-secretory protein CDS SAVERM_6146 7393410 7394549 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10.76 40535 F transport / binding proteins & lipoproteins 1.2 BAC73857.1 Non-secretory protein CDS SAVERM_6147 7394581 7395435 putative ABC transporter permease protein PF01061: ABC-2 type transporter 6.78 29257 F transport / binding proteins & lipoproteins 1.2 BAC73858.1 Non-secretory protein CDS SAVERM_6148 7395470 7396135 putative membrane protein PF08041: PetM family of cytochrome b6f complex subunit 7 6.51 22677 F miscellaneous 4.7 BAC73859.1 Non-secretory protein CDS SAVERM_6149 7396885 7396385 putative transcriptional regulator PF04073: YbaK / prolyl-tRNA synthetases associated domain 8.47 16945 F regulation 3.5.2 BAC73860.1 Non-secretory protein CDS SAVERM_6150 7397649 7396909 hypothetical protein PF02190: ATP-dependent protease La (LON) domain 4.79 26444 F similar to unknown proteins 5 BAC73861.1 Non-secretory protein CDS SAVERM_6151 7398749 7397661 hypothetical protein 6.59 39929 F similar to unknown proteins 5 BAC73862.1 Non-secretory protein CDS SAVERM_6152 7400481 7398901 hypothetical protein 7.7 57566 F similar to unknown proteins 5 BAC73863.1 Non-secretory protein CDS SAVERM_6153 7400715 7402040 hisD putative histidinol dehydrogenase EC 1.1.1.23 4.86 46169 F metabolism of amino acids & related molecules 2.2 BAC73864.1 Non-secretory protein CDS SAVERM_6154 7402037 7403146 hisC1 putative histidinol-phosphate aminotransferase EC:2.6.1.9 4.87 40311 F metabolism of amino acids & related molecules 2.2 BAC73865.1 Non-secretory protein CDS SAVERM_6155 7403143 7403736 hisB putative imidazoleglycerol-phosphate dehydratase EC:4.2.1.19 6.28 21577 F metabolism of amino acids & related molecules 2.2 BAC73866.1 Non-secretory protein CDS SAVERM_6156 7403733 7403897 hypothetical protein 9.4 5695 F similar to unknown proteins 5 BAC73867.1 Non-secretory protein CDS SAVERM_6157 7403888 7404535 hisH putative amidotransferase EC:2.4.2.- 4.89 23052 F metabolism of amino acids & related molecules 2.2 BAC73868.1 Non-secretory protein CDS SAVERM_6158 7404535 7405263 hisA putative phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase EC:5.3.1.16, possessing TrpF function 4.43 25263 F metabolism of amino acids & related molecules 2.2 BAC73869.1 Non-secretory protein CDS SAVERM_6159 7405326 7405658 hypothetical protein PF01042: Endoribonuclease L-PSP 4.5 12018 F similar to unknown proteins 5 BAC73870.1 Non-secretory protein CDS SAVERM_6160 7405655 7406410 hisF putative cyclase EC:4.1.3.- 5.03 26551 F metabolism of amino acids & related molecules 2.2 BAC73871.1 Non-secretory protein CDS SAVERM_6161 7406528 7407115 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 7.16 21771 F miscellaneous 4.7 BAC73872.1 Non-secretory protein CDS SAVERM_6162 7407247 7408479 putative integral membrane efflux protein PF07690: Major Facilitator Superfamily 10.47 40871 F transport / binding proteins & lipoproteins 1.2 BAC73873.1 Non-secretory protein CDS SAVERM_6163 7409008 7410264 putative regulatory protein 7.17 45744 F regulation 3.5.2 BAC73874.1 Non-secretory protein CDS SAVERM_6164 7410741 7411832 livF2 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 5.1 36605 F transport / binding proteins & lipoproteins 1.2 BAC73875.1 Non-secretory protein CDS SAVERM_6165 7411829 7412623 livG2 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 8.92 28232 F transport / binding proteins & lipoproteins 1.2 BAC73876.1 Non-secretory protein CDS SAVERM_6166 7412620 7413510 livH2 putative branched-chain amino acid ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 6.35 30313 F transport / binding proteins & lipoproteins 1.2 BAC73877.1 Non-secretory protein CDS SAVERM_6167 7413503 7414684 livM2 putative branched-chain amino acid ABC transporter permease protein Tat substrate, PF02653: Branched-chain amino acid transport system / permease component 10.29 39866 F transport / binding proteins & lipoproteins 1.2 BAC73878.1 Non-secretory protein CDS SAVERM_6168 7414681 7415943 livK2 putative branched-chain amino acid ABC transporter substrate-binding protein PF01094: Receptor family ligand binding region 9.64 43443 F transport / binding proteins & lipoproteins 1.2 BAC73879.1 Signal peptide CDS SAVERM_6169 7417250 7416615 hypothetical protein PF07398: Protein of unknown function (DUF1503) 7.06 23411 F similar to unknown proteins 5 BAC73880.1 Non-secretory protein CDS SAVERM_6170 7417371 7417772 hisI putative phosphoribosyl-AMP cyclohydrolase EC:3.5.4.19, PF01502: Phosphoribosyl-AMP cyclohydrolase 4.68 14299 F metabolism of amino acids & related molecules 2.2 BAC73881.1 Non-secretory protein CDS SAVERM_6171 7417784 7419265 trpE putative anthranilate synthase component I PF00425: chorismate binding enzyme 4.63 53355 F metabolism of amino acids & related molecules 2.2 BAC73882.1 Non-secretory protein CDS SAVERM_6172 7419325 7419969 putative membrane protein PF09534: Tryptophan-associated transmembrane protein (Trp_oprn_chp) 7.36 21444 F miscellaneous 4.7 BAC73883.1 Non-secretory protein CDS SAVERM_6173 7420103 7420342 putative membrane protein 8.58 7929 F miscellaneous 4.7 BAC73884.1 Non-secretory protein CDS SAVERM_6174 7420443 7420931 hypothetical protein PF10825: Protein of unknown function (DUF2752) 9.31 16962 F similar to unknown proteins 5 BAC73885.1 Non-secretory protein CDS SAVERM_6175 7421097 7421906 trpC putative indole-3-glycerol phosphate synthase PF00218: Indole-3-glycerol phosphate synthase 4.97 28142 F metabolism of amino acids & related molecules 2.2 BAC73886.1 Non-secretory protein CDS SAVERM_6176 7421914 7422222 hypothetical protein 12.41 10782 F similar to unknown proteins 5 BAC73887.1 Non-secretory protein CDS SAVERM_6177 7422537 7423823 trpB putative tryptophan synthase beta subunit PF00291: Pyridoxal-phosphate dependent enzyme 4.88 45574 F metabolism of amino acids & related molecules 2.2 BAC73888.1 Non-secretory protein CDS SAVERM_6178 7423820 7424653 trpA putative tryptophan synthase alpha subunit PF00290: Tryptophan synthase alpha chain 4.61 28408 F metabolism of amino acids & related molecules 2.2 BAC73889.1 Non-secretory protein CDS SAVERM_6179 7424712 7425542 putative integral membrane protein PF01323: DSBA-like thioredoxin domain 9.42 29179 F miscellaneous 4.7 BAC73890.1 Non-secretory protein CDS SAVERM_6180 7425659 7426681 lgt putative prolipoprotein diacylglyceryl transferase PF01790: Prolipoprotein diacylglyceryl transferase 5.67 37372 F protein modification 3.8 BAC73891.1 Non-secretory protein CDS SAVERM_6181 7427591 7426734 citE1 putative citrate lyase beta chain PF03328: HpcH/HpaI aldolase/citrate lyase family 6.37 30097 F main glycolytic pathways 2.1.2 BAC73892.1 Non-secretory protein CDS SAVERM_6182 7428796 7427588 putative acyl-CoA transferases/carnitine dehydratase PF02515: CoA-transferase family III 5.02 42909 F metabolism of lipids 2.4 BAC73893.1 Non-secretory protein CDS SAVERM_6183 7430303 7428930 hypothetical protein PF03747: ADP-ribosylglycohydrolase 7.66 49414 F similar to unknown proteins 5 BAC73894.1 Non-secretory protein CDS SAVERM_6184 7431496 7430300 hypothetical protein PF03747: ADP-ribosylglycohydrolase 6.4 41818 F similar to unknown proteins 5 BAC73895.1 Non-secretory protein CDS SAVERM_6185 7432013 7431504 putative secreted protein frameshift 4.72 16756 F miscellaneous 4.7 BAC73896.1 Signal peptide CDS SAVERM_6186 7432746 7431829 hypothetical protein frameshift 12.59 33278 F miscellaneous 4.7 BAC73897.1 Non-secretory protein CDS SAVERM_6187 7434029 7432743 hypothetical protein PF03747: ADP-ribosylglycohydrolase 4.84 42952 F similar to unknown proteins 5 BAC73898.1 Non-secretory protein CDS SAVERM_6188 7434278 7435009 putative membrane protein PF01988: Integral membrane protein DUF125 4.8 25281 F miscellaneous 4.7 BAC73899.1 Non-secretory protein CDS SAVERM_6189 7435466 7440016 gltB putative glutamate synthase(NADPH) large subunit PF01645: Conserved region in glutamate synthase 5.16 163001 F metabolism of amino acids & related molecules 2.2 BAC73900.1 Non-secretory protein CDS SAVERM_6190 7440009 7441469 gltD1 putative glutamate synthase small subunit PF00070: Pyridine nucleotide-disulphide oxidoreductase 6.3 52667 F metabolism of amino acids & related molecules 2.2 BAC73901.1 Non-secretory protein CDS SAVERM_6191 7442489 7441635 csn2 putative chitosanase, secreted PF01374: Glycosyl hydrolase family 46 7.29 30915 F specific pathways 2.1.1 BAC73902.1 Signal peptide CDS SAVERM_6192 7443493 7442528 putative membrane protein PF01694: Rhomboid family 8.01 34175 F miscellaneous 4.7 BAC73903.1 Non-secretory protein CDS SAVERM_6193 7443640 7444359 putative toxic cation resistance protein PF00092: von Willebrand factor type A domain 5.93 25956 F detoxification 4.2 BAC73904.1 Non-secretory protein CDS SAVERM_6194 7444320 7444934 hypothetical protein PF05962: Bacterial protein of unknown function (DUF886) 8.54 21247 F similar to unknown proteins 5 BAC73905.1 Non-secretory protein CDS SAVERM_6195 7445871 7444912 fadE26 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 9.14 33231 F metabolism of lipids 2.4 BAC73906.1 Non-secretory protein CDS SAVERM_6196 7447010 7445871 fadE20 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.77 41325 F metabolism of lipids 2.4 BAC73907.1 Non-secretory protein CDS SAVERM_6197 7447071 7447862 putative dehydrogenase PF00106: short chain dehydrogenase 5.34 27717 F miscellaneous 4.7 BAC73908.1 Non-secretory protein CDS SAVERM_6198 7447916 7448530 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.19 23487 F regulation 3.5.2 BAC73909.1 Non-secretory protein CDS SAVERM_6199 7448557 7449714 fadA3 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF00108: Thiolase, N-terminal domain 6.14 40463 F metabolism of lipids 2.4 BAC73910.1 Non-secretory protein CDS SAVERM_6200 7450811 7449753 fabK putative enoyl-ACP reductase II NADH-dependent, FAD-containing enoyl-ACP reductase, PF03060: 2-nitropropane dioxygenase 10.43 36585 F metabolism of lipids 2.4 BAC73911.1 Non-secretory protein CDS SAVERM_6201 7451551 7450811 cotB putative coenzyme A transferase, subunit B PF01144: Coenzyme A transferase 7.65 26924 F metabolism of lipids 2.4 BAC73912.1 Non-secretory protein CDS SAVERM_6202 7452396 7451548 cotA putative coenzyme A transferase, subunit A PF01144: Coenzyme A transferase 5.83 30752 F metabolism of lipids 2.4 BAC73913.1 Non-secretory protein CDS SAVERM_6203 7453151 7452393 echA13 putative enoyl-CoA hydratase PF00378: Enoyl-CoA hydratase/isomerase family 6.67 26517 F metabolism of lipids 2.4 BAC73914.1 Non-secretory protein CDS SAVERM_6204 7453206 7454036 putative dehydrogenase PF00106: short chain dehydrogenase 6.81 28743 F miscellaneous 4.7 BAC73915.1 Non-secretory protein CDS SAVERM_6205 7453994 7454941 putative dehydrogenase PF00106: short chain dehydrogenase 8.89 31466 F miscellaneous 4.7 BAC73916.1 Non-secretory protein CDS SAVERM_6206 7456320 7455394 hypothetical protein PF00023: Ankyrin repeat 4.61 32212 F similar to unknown proteins 5 BAC73917.1 Non-secretory protein CDS SAVERM_6207 7457328 7456432 hypothetical protein 8.24 33399 F similar to unknown proteins 5 BAC73918.1 Non-secretory protein CDS SAVERM_6208 7457485 7458360 putative trypsin-like protease PF00089: Trypsin 9.23 29780 F protein modification 3.8 BAC73919.1 Signal peptide CDS SAVERM_6209 7458572 7459027 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.24 16530 F miscellaneous 4.7 BAC73920.1 Non-secretory protein CDS SAVERM_6210 7459188 7459577 aroH2 putative chorismate mutase EC:5.4.99.5, PF01817: Chorismate mutase type II 6 13925 F miscellaneous 4.7 BAC73921.1 Non-secretory protein CDS SAVERM_6211 7459706 7460263 putative two-component system response regulator PF00072: Response regulator receiver domain 6.9 20579 F regulation 3.5.2 BAC73922.1 Non-secretory protein CDS SAVERM_6212 7460355 7462895 pepN3 putative aminopeptidase N PF01433: Peptidase family M1 4.73 93662 F protein modification 3.8 BAC73923.1 Non-secretory protein CDS SAVERM_6213 7463143 7464585 putative amino acid decarboxylase PF00282: Pyridoxal-dependent decarboxylase conserved domain 6.22 49934 F miscellaneous 4.7 BAC73924.1 Non-secretory protein CDS SAVERM_6214 7464582 7466000 putative monooxygenase PF00070: Pyridine nucleotide-disulphide oxidoreductase 6.71 52870 F miscellaneous 4.7 BAC73925.1 Non-secretory protein CDS SAVERM_6215 7467917 7466097 cpdB putative 2’,3’-cyclic-nucleotide 2’-phosphodiesterase, secreted Tat substrate, PF02872: 5'-nucleotidase, C-terminal domain 7.65 65346 F metabolism of nucleotides & nucleic acids 2.3 BAC73926.1 Signal peptide CDS SAVERM_6216 7468007 7468768 hypothetical protein PF04402: Protein of unknown function (DUF541) 6.81 27680 F similar to unknown proteins 5 BAC73927.1 Non-secretory protein CDS SAVERM_6217 7468937 7470373 pykA2 putative pyruvate kinase PF00224: Pyruvate kinase, barrel domain 5.09 51551 F main glycolytic pathways 2.1.2 BAC73928.1 Non-secretory protein CDS SAVERM_6218 7471197 7470385 hypothetical protein 9.72 31109 F no similarity 6 BAC73929.1 Non-secretory protein CDS SAVERM_6219 7471444 7472100 putative two-component system response regulator PF00072: Response regulator receiver domain 4.43 24158 F regulation 3.5.2 BAC73930.1 Non-secretory protein CDS SAVERM_6220 7472920 7472204 livF3 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 7.09 25479 F transport / binding proteins & lipoproteins 1.2 BAC73931.1 Non-secretory protein CDS SAVERM_6221 7473861 7472917 livG3 putative branched-chain amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 4.69 33420 F transport / binding proteins & lipoproteins 1.2 BAC73932.1 Non-secretory protein CDS SAVERM_6222 7475633 7473858 livM3 putative branched-chain amino acid ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 5.41 61799 F transport / binding proteins & lipoproteins 1.2 BAC73933.1 Non-secretory protein CDS SAVERM_6223 7476571 7475639 livH3 putative branched-chain amino acid ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 8.85 32772 F transport / binding proteins & lipoproteins 1.2 BAC73934.1 Non-secretory protein CDS SAVERM_6224 7477912 7476683 livK3 putative branched-chain amino acid ABC transporter substrate-binding protein PF01094: Receptor family ligand binding region 9.35 43368 F transport / binding proteins & lipoproteins 1.2 BAC73935.1 Signal peptide CDS SAVERM_6225 7479293 7478832 hypothetical protein PF03061: Thioesterase superfamily 6.88 15999 F similar to unknown proteins 5 BAC73936.1 Non-secretory protein CDS SAVERM_6226 7481642 7479360 fdhF putative formate dehydrogenase PF00384: Molybdopterin oxidoreductase 6.59 82672 F membrane bioenergetics 1.4 BAC73937.1 Non-secretory protein CDS SAVERM_6227 7481798 7484521 polA1 putative DNA polymerase I PF00476: DNA polymerase family A 4.72 98556 F DNA replication 3.1 BAC73938.1 Non-secretory protein CDS SAVERM_6228 7486030 7484789 putative membrane protein PF04307: Predicted membrane-bound metal-dependent hydrolase (DUF457) 10.33 43099 F miscellaneous 4.7 BAC73939.1 Non-secretory protein CDS SAVERM_6229 7486082 7487791 putative secreted protein PF01464: Transglycosylase SLT domain 5.12 58139 F miscellaneous 4.7 BAC73940.1 Signal peptide CDS SAVERM_6230 7488093 7489085 hypothetical protein PF11271: Protein of unknown function (DUF3068) 10.06 37031 F similar to unknown proteins 5 BAC73941.1 Signal peptide CDS SAVERM_6231 7491708 7489075 putative ATP-dependent RNA helicase PF04408: Helicase associated domain (HA2) 8.98 92352 F RNA modification 3.6 BAC73942.1 Non-secretory protein CDS SAVERM_6232 7492582 7491713 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 4.58 31989 F miscellaneous 4.7 BAC73943.1 Non-secretory protein CDS SAVERM_6233 7492899 7494404 rpsA putative ribosomal protein S1 PF00575: S1 RNA binding domain 4.27 55061 F ribosomal protein 3.7.1 BAC73944.1 Non-secretory protein CDS SAVERM_6234 7494729 7495667 hypothetical protein PF05601: Protein of unknown function (DUF774) 4.46 34482 F similar to unknown proteins 5 BAC73945.1 Non-secretory protein CDS SAVERM_6235 7495699 7496340 coaE putative dephospho-CoA kinase PF01121: Dephospho-CoA kinase 4.65 22557 F metabolism of coenzymes & prosthetic groups 2.5 BAC73946.1 Non-secretory protein CDS SAVERM_6236 7496391 7496771 hypothetical protein PF00515: TPR Domain 9.85 14187 F similar to unknown proteins 5 BAC73947.1 Non-secretory protein CDS SAVERM_6237 7497092 7496817 putative secreted protein 11.96 10171 F similar to unknown proteins 5 BAC73948.1 Non-secretory protein CDS SAVERM_6238 7497119 7498156 hypothetical protein 6.61 38203 F similar to unknown proteins 5 BAC73949.1 Non-secretory protein CDS SAVERM_6239 7498232 7498915 hypothetical protein PF08242: Methyltransferase domain 4.38 24509 F similar to unknown proteins 5 BAC73950.1 Non-secretory protein CDS SAVERM_6240 7498976 7499518 hypothetical protein PF07681: DoxX 11.3 18696 F similar to unknown proteins 5 BAC73951.1 Non-secretory protein CDS SAVERM_6241 7500416 7499778 hypothetical protein PF01479: S4 domain 10.34 22493 F similar to unknown proteins 5 BAC73952.1 Non-secretory protein CDS SAVERM_6242 7500537 7501331 hypothetical protein PF03167: Uracil DNA glycosylase superfamily 7.51 28102 F similar to unknown proteins 5 BAC73953.1 Non-secretory protein CDS SAVERM_6243 7501735 7501328 hypothetical protein 8.6 14503 F similar to unknown proteins 5 BAC73954.1 Non-secretory protein CDS SAVERM_6244 7502471 7501884 hypothetical protein PF01042: Endoribonuclease L-PSP 4.89 19515 F similar to unknown proteins 5 BAC73955.1 Signal peptide CDS SAVERM_6245 7502573 7502950 hypothetical protein 12.01 14193 F no similarity 6 BAC73956.1 Non-secretory protein CDS SAVERM_6246 7503439 7504629 putative secreted protein 6.32 42979 F similar to unknown proteins 5 BAC73957.1 Signal peptide CDS SAVERM_6247 7504662 7505135 putative secreted protein Tat substrate 10.16 16996 F no similarity 6 BAC73958.1 Signal peptide CDS SAVERM_6248 7506001 7507863 putative integral membrane protein PF05976: Bacterial membrane protein of unknown function (DUF893) 10.56 63640 F miscellaneous 4.7 BAC73959.1 Non-secretory protein CDS SAVERM_6249 7508111 7509277 cyp23 cytochrome P450 hydroxylase CYP107X1 5.62 42468 F metabolism of coenzymes & prosthetic groups 2.5 BAC73960.1 Non-secretory protein CDS SAVERM_6250 7509535 7509708 hypothetical protein 4.37 6192 F similar to unknown proteins 5 BAC73961.1 Non-secretory protein CDS SAVERM_6251 7510226 7509771 hypothetical protein 7.38 16008 F similar to unknown proteins 5 BAC73962.1 Non-secretory protein CDS SAVERM_6252 7510921 7510217 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.63 24813 F regulation 3.5.2 BAC73963.1 Non-secretory protein CDS SAVERM_6253 7511100 7511960 putative DNA-binding protein PF01381: Helix-turn-helix 6.65 32314 F regulation 3.5.2 BAC73964.1 Non-secretory protein CDS SAVERM_6254 7511961 7512254 abaA2 putative AbaA-like protein regulatory protein, PF04149: Domain of unknown function (DUF397) 5.89 10696 F adaptation to atypical conditions 4.1 BAC73965.1 Non-secretory protein CDS SAVERM_6255 7512494 7513309 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.52 29948 F similar to unknown proteins 5 BAC73966.1 Non-secretory protein CDS SAVERM_6256 7514980 7513568 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 10.46 50344 F regulation 3.5.2 BAC73967.1 Non-secretory protein CDS SAVERM_6257 7515022 7515537 hypothetical protein PF02627: Carboxymuconolactone decarboxylase family 6.34 18628 F similar to unknown proteins 5 BAC73968.1 Non-secretory protein CDS SAVERM_6258 7517100 7515610 gltD2 putative glutamate synthase small subunit PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.18 53403 F metabolism of amino acids & related molecules 2.2 BAC73969.1 Non-secretory protein CDS SAVERM_6259 7517767 7517288 putative integral membrane protein PF01277: Oleosin 5.7 16530 F miscellaneous 4.7 BAC73970.1 Non-secretory protein CDS SAVERM_6260 7518884 7518066 hypothetical protein PF00643: B-box zinc finger 11.69 29354 F similar to unknown proteins 5 BAC73971.1 Non-secretory protein CDS SAVERM_6261 7518944 7519588 hypothetical protein 5.63 23892 F similar to unknown proteins 5 BAC73972.1 Non-secretory protein CDS SAVERM_6262 7519576 7520064 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 8.69 18055 F similar to unknown proteins 5 BAC73973.1 Non-secretory protein CDS SAVERM_6263 7520157 7520630 hypothetical protein PF00571: CBS domain 5 17360 F similar to unknown proteins 5 BAC73974.1 Non-secretory protein CDS SAVERM_6264 7521739 7520675 corA1 putative metal-transport protein PF01544: CorA-like Mg2+ transporter protein 5.4 39608 F transport / binding proteins & lipoproteins 1.2 BAC73975.1 Non-secretory protein CDS SAVERM_6265 7522014 7522808 putative methyltransferase PF01209: ubiE/COQ5 methyltransferase family 6.6 28373 F miscellaneous 4.7 BAC73976.1 Non-secretory protein CDS SAVERM_6266 7523795 7522851 putative carbohydrate kinase PF00294: pfkB family carbohydrate kinase 5.67 31505 F miscellaneous 4.7 BAC73977.1 Non-secretory protein CDS SAVERM_6267 7524697 7523792 indA putative pigment biosynthetic protein uncharacterized enzyme involved in pigment biosynthesis, PF04227: Indigoidine synthase A like protein 5.18 31565 F miscellaneous 4.7 BAC73978.1 Non-secretory protein CDS SAVERM_6268 7524759 7525223 putative dioxygenase PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.24 17138 F miscellaneous 4.7 BAC73979.1 Non-secretory protein CDS SAVERM_6269 7525326 7525688 hypothetical protein PF05899: Protein of unknown function (DUF861) 4.31 12731 F similar to unknown proteins 5 BAC73980.1 Non-secretory protein CDS SAVERM_6270 7526264 7525710 ogt3 putative methylated-DNA--protein-cysteine S-methyltransferase PF01035: 6-O-methylguanine DNA methyltransferase, DNA binding domain 4.83 19390 F DNA modification & repair 3.2 BAC73981.1 Non-secretory protein CDS SAVERM_6271 7527243 7526371 glpQ6 putative glycerophosphoryl diester phosphodiesterase PF03009: Glycerophosphoryl diester phosphodiesterase family 10.16 31644 F miscellaneous 4.7 BAC73982.1 Signal peptide CDS SAVERM_6272 7527524 7528390 putative integral membrane protein PF03707: Bacterial signalling protein N terminal repeat 10.48 29935 F miscellaneous 4.7 BAC73983.1 Non-secretory protein CDS SAVERM_6273 7528431 7530572 uvrB putative excinuclease ABC subunit B PF00271: Helicase conserved C-terminal domain 4.97 80226 F DNA modification & repair 3.2 BAC73984.1 Non-secretory protein CDS SAVERM_6274 7530828 7531406 terD6 putative tellurium resistance protein PF02342: Bacterial stress protein 5.99 20726 F detoxification 4.2 BAC73985.1 Non-secretory protein CDS SAVERM_6275 7531487 7533574 putative export associated protein PF02342: Bacterial stress protein 5.62 72723 F transport / binding proteins & lipoproteins 1.2 BAC73986.1 Non-secretory protein CDS SAVERM_6276 7533900 7534889 putative integral membrane export protein PF03741: Integral membrane protein TerC family 7.16 35867 F transport / binding proteins & lipoproteins 1.2 BAC73987.1 Non-secretory protein CDS SAVERM_6277 7535097 7536197 chaA putative ionic transporter integral membrane protein PF01699: Sodium/calcium exchanger protein 7.77 37369 F transport / binding proteins & lipoproteins 1.2 BAC73988.1 Non-secretory protein CDS SAVERM_6278 7537561 7536257 putative transmembrane efflux protein PF00083: Sugar (and other) transporter 8.98 45472 F transport / binding proteins & lipoproteins 1.2 BAC73989.1 Non-secretory protein CDS SAVERM_6279 7538758 7537643 putative LD-carboxypeptidase PF02016: LD-carboxypeptidase 5.79 41141 F protein modification 3.8 BAC73990.1 Non-secretory protein CDS SAVERM_6280 7538791 7539270 aroQ putative 3-dehydroquinate dehydratase EC:4.2.1.10, PF01220: Dehydroquinase class II 6.16 17077 F metabolism of amino acids & related molecules 2.2 BAC73991.1 Non-secretory protein CDS SAVERM_6281 7540092 7539316 gtlL2 putative polar amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 4.86 28198 F transport / binding proteins & lipoproteins 1.2 BAC73992.1 Non-secretory protein CDS SAVERM_6282 7541042 7540089 gtlK2 putative polar amino acid ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 11.13 34411 F transport / binding proteins & lipoproteins 1.2 BAC73993.1 Non-secretory protein CDS SAVERM_6283 7541941 7541003 gtlL2 putative polar amino acid ABC transporter substrate-binding protein PF00497: Bacterial extracellular solute-binding proteins, family 3 9.05 32918 F transport / binding proteins & lipoproteins 1.2 BAC73994.1 Signal peptide CDS SAVERM_6284 7542894 7542238 putative Zn-dependent hydrolase PF00753: Metallo-beta-lactamase superfamily 4.92 23478 F miscellaneous 4.7 BAC73995.1 Non-secretory protein CDS SAVERM_6285 7543690 7542905 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 5.4 28601 F similar to unknown proteins 5 BAC73996.1 Non-secretory protein CDS SAVERM_6286 7543816 7546845 uvrA1 putative excinuclease ABC subunit A PF00005: ABC transporter 7.93 110787 F DNA modification & repair 3.2 BAC73997.1 Non-secretory protein CDS SAVERM_6287 7548153 7547242 scrK2 putative fructokinase PF00294: pfkB family carbohydrate kinase 4.36 30922 F main glycolytic pathways 2.1.2 BAC73998.1 Non-secretory protein CDS SAVERM_6288 7549199 7548150 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.63 37103 F regulation 3.5.2 BAC73999.1 Non-secretory protein CDS SAVERM_6289 7549417 7549842 putative iron-sulfur protein Tat substrate, PF00355: Rieske [2Fe-2S] domain 8.22 14007 F miscellaneous 4.7 BAC74000.1 Signal peptide CDS SAVERM_6290 7550847 7549900 hypothetical protein 9.46 34947 F similar to unknown proteins 5 BAC74001.1 Non-secretory protein CDS SAVERM_6291 7551262 7553307 uvrC putative excinuclease ABC subunit C PF01541: GIY-YIG catalytic domain 6.36 76321 F DNA modification & repair 3.2 BAC74002.1 Non-secretory protein CDS SAVERM_6292 7553304 7554317 putative P-loop ATPase PF03668: P-loop ATPase protein family 4.81 37156 F miscellaneous 4.7 BAC74003.1 Non-secretory protein CDS SAVERM_6293 7554314 7555381 hypothetical protein PF01933: Uncharacterised protein family UPF0052 7.02 37886 F similar to unknown proteins 5 BAC74004.1 Non-secretory protein CDS SAVERM_6294 7555372 7556361 whiA putative sporulation regulatory protein PF02650: Uncharacterized BCR, COG1481 10.42 35079 F regulation 3.5.2 BAC74005.1 Non-secretory protein CDS SAVERM_6295 7556529 7559483 putative carboxypeptidase T (secreted zinc-binding carboxypeptidase) PF00246: Zinc carboxypeptidase 4.94 104192 F protein modification 3.8 BAC74006.1 Signal peptide CDS SAVERM_6296 7559711 7560718 gap2 glyceraldehyde-3-phosphate dehydrogenase (sensitive to pentalenolactone) PF02800: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain 4.89 36162 F main glycolytic pathways 2.1.2 BAC74007.1 Non-secretory protein CDS SAVERM_6297 7560846 7562057 pgk putative phosphoglycerate kinase PF00162: Phosphoglycerate kinase 4.66 42184 F main glycolytic pathways 2.1.2 BAC74008.1 Non-secretory protein CDS SAVERM_6298 7562063 7562839 tpiA putative triosephosphate isomerase PF00121: Triosephosphate isomerase 5.18 27950 F main glycolytic pathways 2.1.2 BAC74009.1 Non-secretory protein CDS SAVERM_6299 7562893 7563207 secG putative preprotein translocase SecG subunit PF03840: Preprotein translocase SecG subunit 11.51 11022 F protein secretion 1.6 BAC74010.1 Non-secretory protein CDS SAVERM_6300 7563427 7563762 putative electron transport protein 4.89 12024 F transport / binding proteins & lipoproteins 1.2 BAC74011.1 Non-secretory protein CDS SAVERM_6301 7563791 7565161 putative antibiotic transport protein PF07690: Major Facilitator Superfamily 11.8 46739 F transport / binding proteins & lipoproteins 1.2 BAC74012.1 Signal peptide CDS SAVERM_6302 7565234 7566886 pgi2 putative glucose-6-phosphate isomerase PF00342: Phosphoglucose isomerase 5.18 60635 F main glycolytic pathways 2.1.2 BAC74013.1 Non-secretory protein CDS SAVERM_6303 7569371 7567065 putative ABC transporter permease protein PF02687: Predicted permease 11.3 79698 F transport / binding proteins & lipoproteins 1.2 BAC74014.1 Non-secretory protein CDS SAVERM_6304 7570388 7569642 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.52 26547 F transport / binding proteins & lipoproteins 1.2 BAC74015.1 Non-secretory protein CDS SAVERM_6305 7570900 7570385 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 4.96 19529 F regulation 3.5.2 BAC74016.1 Non-secretory protein CDS SAVERM_6306 7571001 7572329 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.22 47272 F transport / binding proteins & lipoproteins 1.2 BAC74017.1 Non-secretory protein CDS SAVERM_6307 7572458 7574164 treA putative trehalose-6-phosphate hydrolase PF00128: Alpha amylase, catalytic domain 5.69 62951 F specific pathways 2.1.1 BAC74018.1 Non-secretory protein CDS SAVERM_6308 7574227 7575549 aglE putative multiple sugar ABC transporter substrate-binding protein (alpha-glucoside transport system substrate-binding) PF00497: Bacterial extracellular solute-binding proteins, family 3 6.8 46097 F transport / binding proteins & lipoproteins 1.2 BAC74019.1 Signal peptide CDS SAVERM_6309 7575555 7576913 aglF putative multiple sugar ABC transporter permease protein (alpha-glucoside transport system permease protein) PF00528: Binding-protein-dependent transport system inner membrane component 10.36 47825 F transport / binding proteins & lipoproteins 1.2 BAC74020.1 Non-secretory protein CDS SAVERM_6310 7576910 7577749 aglG putative multiple sugar ABC transporter permease protein (alpha-glucoside transport system permease protein) Tat substrate, PF00528: Binding-protein-dependent transport system inner membrane component 9.6 30372 F transport / binding proteins & lipoproteins 1.2 BAC74021.1 Non-secretory protein CDS SAVERM_6311 7578607 7577825 pgl putative 6-phosphogluconolactonase PF01182: Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 5.58 27160 F main glycolytic pathways 2.1.2 BAC74022.1 Non-secretory protein CDS SAVERM_6312 7579725 7578604 opcA2 putative oxppcycle protein 6.53 39868 F miscellaneous 4.7 BAC74023.1 Non-secretory protein CDS SAVERM_6313 7581245 7579722 zwf2 putative glucose-6-phosphate 1-dehydrogenase PF02781: Glucose-6-phosphate dehydrogenase, C-terminal domain 5.21 56736 F main glycolytic pathways 2.1.2 BAC74024.1 Non-secretory protein CDS SAVERM_6314 7582368 7581250 tal2 putative transaldolase PF00923: Transaldolase 4.64 40667 F main glycolytic pathways 2.1.2 BAC74025.1 Non-secretory protein CDS SAVERM_6315 7584490 7582403 tkt2 putative transketolase PF00456: Transketolase, thiamine diphosphate binding domain 5.02 74950 F main glycolytic pathways 2.1.2 BAC74026.1 Non-secretory protein CDS SAVERM_6316 7584999 7585856 ctaB putative protoheme IX farnesyltransferase (complex IV) PF01040: UbiA prenyltransferase family 9.67 31649 F membrane bioenergetics 1.4 BAC74027.1 Non-secretory protein CDS SAVERM_6317 7585955 7586311 hypothetical protein 4.89 12313 F similar to unknown proteins 5 BAC74028.1 Non-secretory protein CDS SAVERM_6318 7586484 7587590 hypothetical protein PF04909: Amidohydrolase 6.84 38448 F similar to unknown proteins 5 BAC74029.1 Non-secretory protein CDS SAVERM_6319 7587626 7588396 hypothetical protein PF01909: Nucleotidyltransferase domain 9.02 28521 F similar to unknown proteins 5 BAC74030.1 Non-secretory protein CDS SAVERM_6320 7589438 7588383 ctaA putative cytochrome c oxidase subunit XV assembly protein (complex IV) PF02628: Cytochrome oxidase assembly protein 9.88 37619 F membrane bioenergetics 1.4 BAC74031.1 Non-secretory protein CDS SAVERM_6321 7590228 7589458 putative ABC transporter permease protein PF01061: ABC-2 type transporter 9.66 26552 F transport / binding proteins & lipoproteins 1.2 BAC74032.1 Non-secretory protein CDS SAVERM_6322 7591157 7590225 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.26 32989 F transport / binding proteins & lipoproteins 1.2 BAC74033.1 Non-secretory protein CDS SAVERM_6323 7591499 7591308 hypothetical protein PF02522: Aminoglycoside 3-N-acetyltransferase 8.24 6355 F similar to unknown proteins 5 BAC74034.1 Non-secretory protein CDS SAVERM_6324 7591661 7592410 putative ArsR-family transcriptional regulator putative IdeR-binding site: TCAGTTTAGGTATGCCTAA(7591570:7591588) 6.79 26552 F regulation 3.5.2 BAC74035.1 Non-secretory protein CDS SAVERM_6325 7592407 7593831 sufB putative FeS assembly protein SufB PF01458: Uncharacterized protein family (UPF0051) 4.62 52774 F similar to unknown proteins 5 BAC74036.1 Non-secretory protein CDS SAVERM_6326 7593919 7595100 sufD putative FeS assembly protein SufD PF01458: Uncharacterized protein family (UPF0051) 4.55 41815 F similar to unknown proteins 5 BAC74037.1 Non-secretory protein CDS SAVERM_6327 7595100 7595420 hcaC1 putative ferredoxin subunit of phenylpropionate dioxygenase PF00355: Rieske [2Fe-2S] domain 4.09 11447 F miscellaneous 4.7 BAC74038.1 Non-secretory protein CDS SAVERM_6328 7595428 7596210 sufC putative iron-regulated ABC transporter ATP-binding protein PF00005: ABC transporter 5.1 28302 F transport / binding proteins & lipoproteins 1.2 BAC74039.1 Non-secretory protein CDS SAVERM_6329 7596207 7597463 egtE putative aminotransferase gene involving ergothioneine biosynthesis, PF00266: Aminotransferase class-V 5.06 45815 F miscellaneous 4.7 BAC74040.1 Non-secretory protein CDS SAVERM_6330 7597480 7597947 putative NifU homolog (SUF system FeS assembly protein), probably involved in Fe-S cluster formation PF01592: NifU-like N terminal domain 4.5 17069 F miscellaneous 4.7 BAC74041.1 Non-secretory protein CDS SAVERM_6331 7597944 7598276 hypothetical protein PF01883: Domain of unknown function DUF59 3.77 12098 F similar to unknown proteins 5 BAC74042.1 Non-secretory protein CDS SAVERM_6332 7599327 7598377 putative alpha-L-arabinofuranosidase PF05270: Alpha-L-arabinofuranosidase B (ABFB) 8.75 33576 F specific pathways 2.1.1 BAC74043.1 Non-secretory protein CDS SAVERM_6333 7599810 7599643 hypothetical protein 5.53 5838 F no similarity 6 BAC74044.1 Non-secretory protein CDS SAVERM_6335 7601163 7600087 putative integral membrane protein PF01061: ABC-2 type transporter 10.45 37775 F miscellaneous 4.7 BAC74045.1 Non-secretory protein CDS SAVERM_6334 7601369 7601689 emrE putative SMR-type multi-drug efflux transporter PF00893: Small Multidrug Resistance protein 8.47 10633 F transport / binding proteins & lipoproteins 1.2 BAC74046.1 Non-secretory protein CDS SAVERM_6336 7601712 7602248 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.32 19243 F regulation 3.5.2 BAC74047.1 Non-secretory protein CDS SAVERM_6337 7602496 7603089 sig50 putative RNA polymerase ECF-subfamily sigma factor PF04545: Sigma-70, region 4 8.86 21399 F RNA initiation 3.5.1 BAC74048.1 Non-secretory protein CDS SAVERM_6338 7603092 7604084 hypothetical protein 9.85 35365 F no similarity 6 BAC74049.1 Non-secretory protein CDS SAVERM_6339 7604205 7605194 dapD putative 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase 5.37 34023 F metabolism of amino acids & related molecules 2.2 BAC74050.1 Non-secretory protein CDS SAVERM_6340 7607082 7607702 sig51 putative RNA polymerase ECF-subfamily sigma factor PF04545: Sigma-70, region 4 8.48 22642 F RNA initiation 3.5.1 BAC74052.1 Non-secretory protein CDS SAVERM_6341 7607087 7606506 putative secreted protein 7.35 21653 F miscellaneous 4.7 BAC74051.1 Non-secretory protein CDS SAVERM_6342 7607699 7608919 hypothetical protein 9.26 44198 F no similarity 6 BAC74053.1 Non-secretory protein CDS SAVERM_6343 7609853 7608906 dapA5 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 4.93 32860 F metabolism of amino acids & related molecules 2.2 BAC74054.1 Non-secretory protein CDS SAVERM_6344 7609979 7610839 hypothetical protein 11.45 30398 F no similarity 6 BAC74055.1 Non-secretory protein CDS SAVERM_6345 7610905 7611315 putative integral membrane protein PF07332: Protein of unknown function (DUF1469) 7.8 13964 F miscellaneous 4.7 BAC74056.1 Non-secretory protein CDS SAVERM_6346 7611312 7612058 hypothetical protein PF12277: Protein of unknown function (DUF3618) 11.49 23609 F similar to unknown proteins 5 BAC74057.1 Non-secretory protein CDS SAVERM_6347 7614102 7612276 putative large secreted protein PF03372: Endonuclease/Exonuclease/phosphatase family 4.56 64040 F miscellaneous 4.7 BAC74058.1 Signal peptide CDS SAVERM_6348 7614461 7615906 hypothetical protein 3.91 50583 F similar to unknown proteins 5 BAC74059.1 Non-secretory protein CDS SAVERM_6349 7616478 7617947 putative secreted protein PF05787: Bacterial protein of unknown function (DUF839) 6.08 52432 F miscellaneous 4.7 BAC74060.1 Signal peptide CDS SAVERM_6350 7618443 7620026 putative ribonucleoprotein-related protein PF05731: TROVE domain 9.97 57663 F miscellaneous 4.7 BAC74061.1 Non-secretory protein CDS SAVERM_6351 7621562 7620108 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 11.76 50352 F transport / binding proteins & lipoproteins 1.2 BAC74062.1 Non-secretory protein CDS SAVERM_6352 7621700 7622305 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.15 21587 F regulation 3.5.2 BAC74063.1 Non-secretory protein CDS SAVERM_6353 7623576 7622368 putative transport associated protein PF02342: Bacterial stress protein 4.76 41894 F transport / binding proteins & lipoproteins 1.2 BAC74064.1 Non-secretory protein CDS SAVERM_6354 7624715 7623726 putative zinc-binding dehydrogenase PF00107: Zinc-binding dehydrogenase 5.18 34641 F miscellaneous 4.7 BAC74065.1 Non-secretory protein CDS SAVERM_6355 7625581 7624712 smoG putative multiple sugar ABC transporter permease protein (sorbitol/mannitol transport system permease protein) PF00528: Binding-protein-dependent transport system inner membrane component 9.83 30649 F transport / binding proteins & lipoproteins 1.2 BAC74066.1 Non-secretory protein CDS SAVERM_6356 7626516 7625578 smoF putative multiple sugar ABC transporter permease protein (sorbitol/mannitol transport system permease protein) PF00528: Binding-protein-dependent transport system inner membrane component 9.72 34393 F transport / binding proteins & lipoproteins 1.2 BAC74067.1 Non-secretory protein CDS SAVERM_6357 7627883 7626513 smoE putative multiple sugar ABC transporter substrate-binding protein (sorbitol/mannitol transport system substrate-binding protein) PF00497: Bacterial extracellular solute-binding proteins, family 3 9.08 49940 F transport / binding proteins & lipoproteins 1.2 BAC74068.1 Signal peptide CDS SAVERM_6358 7628782 7627994 putative DeoR-family transcriptional regulator PF00455: Bacterial regulatory proteins, deoR family 8.51 27891 F regulation 3.5.2 BAC74069.1 Non-secretory protein CDS SAVERM_6359 7629849 7629040 hypothetical protein PF01370: NAD dependent epimerase/dehydratase family 4.75 29591 F similar to unknown proteins 5 BAC74070.1 Non-secretory protein CDS SAVERM_6360 7630125 7631066 putative 5-dehydro-4-deoxyglucarate dehydratase PF00701: Dihydrodipicolinate synthetase family 5.05 33424 F metabolism of amino acids & related molecules 2.2 BAC74071.1 Non-secretory protein CDS SAVERM_6361 7631063 7632295 putative alanine-rich protein 6.57 42503 F miscellaneous 4.7 BAC74072.1 Non-secretory protein CDS SAVERM_6362 7633401 7632199 putative integral membrane efflux protein PF07690: Major Facilitator Superfamily 10.21 40414 F transport / binding proteins & lipoproteins 1.2 BAC74073.1 Non-secretory protein CDS SAVERM_6363 7633567 7634157 hypothetical protein PF11716: Mycothiol maleylpyruvate isomerase N-terminal domain 4.64 20565 F similar to unknown proteins 5 BAC74074.1 Non-secretory protein CDS SAVERM_6364 7634272 7635024 hypothetical protein PF00753: Metallo-beta-lactamase superfamily 6.74 26472 F similar to unknown proteins 5 BAC74075.1 Non-secretory protein CDS SAVERM_6365 7635144 7635800 putative GntR-family transcriptional regulator PF07729: FCD domain 5.68 23740 F regulation 3.5.2 BAC74076.1 Non-secretory protein CDS SAVERM_6366 7635797 7636705 dapA7 putative dihydrodipicolinate synthase PF00701: Dihydrodipicolinate synthetase family 5.62 32272 F metabolism of amino acids & related molecules 2.2 BAC74077.1 Non-secretory protein CDS SAVERM_6367 7636693 7638432 ilvD2 putative dihydroxy-acid dehydratase PF00920: Dehydratase family 6.17 62334 F metabolism of amino acids & related molecules 2.2 BAC74078.1 Non-secretory protein CDS SAVERM_6368 7638581 7639525 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.48 34472 F transport / binding proteins & lipoproteins 1.2 BAC74079.1 Non-secretory protein CDS SAVERM_6369 7639522 7640424 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.67 33069 F transport / binding proteins & lipoproteins 1.2 BAC74080.1 Non-secretory protein CDS SAVERM_6370 7640520 7641704 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 4.7 41567 F miscellaneous 4.7 BAC74081.1 Non-secretory protein CDS SAVERM_6371 7641701 7642567 hypothetical protein 7.84 30848 F similar to unknown proteins 5 BAC74082.1 Non-secretory protein CDS SAVERM_6372 7642564 7643874 xynB3 putative xylan beta-1,4-xylosidase PF04616: Glycosyl hydrolases family 43 8.85 47097 F specific pathways 2.1.1 BAC74083.1 Non-secretory protein CDS SAVERM_6373 7643983 7645320 putative secreted sugar-binding protein PF00497: Bacterial extracellular solute-binding proteins, family 3 5.84 47497 F miscellaneous 4.7 BAC74084.1 Signal peptide CDS SAVERM_6374 7645485 7646285 putative secreted rhamnogalacturonan acetylesterase PF00657: GDSL-like Lipase/Acylhydrolase 6.25 29129 F specific pathways 2.1.1 BAC74085.1 Signal peptide CDS SAVERM_6375 7646360 7647691 putative secreted pectate lyase PF00544: Pectate lyase 5.2 46816 F specific pathways 2.1.1 BAC74086.1 Signal peptide CDS SAVERM_6376 7647694 7648833 putative secreted pectinesterase Tat substrate, PF01095: Pectinesterase 8.43 39997 F specific pathways 2.1.1 BAC74087.1 Signal peptide CDS SAVERM_6377 7648805 7649860 putative secreted pectinesterase Tat substrate, PF01095: Pectinesterase 7.2 37690 F specific pathways 2.1.1 BAC74088.1 Signal peptide CDS SAVERM_6378 7649923 7651035 putative secreted pectate lyase 4.99 37950 F specific pathways 2.1.1 BAC74089.1 Signal peptide CDS SAVERM_6379 7651498 7651127 hypothetical protein 9.39 13169 F no similarity 6 BAC74090.1 Non-secretory protein CDS SAVERM_6380 7651723 7652517 phoB putative secreted acid phosphatase PF03767: HAD superfamily, subfamily IIIB (Acid phosphatase) 8.02 28467 F metabolism of phosphates 2.6 BAC74091.1 Signal peptide CDS SAVERM_6381 7654928 7652721 xynD putative endo-1,4-beta-xylanase, secreted PF04616: Glycosyl hydrolases family 43 6.03 81153 F specific pathways 2.1.1 BAC74092.1 Signal peptide CDS SAVERM_6382 7655170 7656327 putative secreted pectate lyase PF03422: Carbohydrate binding module (family 6) 9.52 39391 F specific pathways 2.1.1 BAC74093.1 Signal peptide CDS SAVERM_6383 7657326 7656496 putative secreted pectate lyase Tat substrate, PF03211: Pectate lyase 9.59 28762 F miscellaneous 4.7 BAC74094.1 Signal peptide CDS SAVERM_6384 7658292 7657426 hypothetical protein 5.98 30253 F similar to unknown proteins 5 BAC74095.1 Non-secretory protein CDS SAVERM_6385 7658855 7658289 sig52 putative RNA polymerase ECF-subfamily sigma factor PF08281: Sigma-70, region 4 9.74 20700 F RNA initiation 3.5.1 BAC74096.1 Non-secretory protein CDS SAVERM_6386 7659113 7660564 pbuG2 putative hypoxanthine/guanine permease PF00860: Permease family 4.97 50219 F transport / binding proteins & lipoproteins 1.2 BAC74097.1 Non-secretory protein CDS SAVERM_6387 7662083 7660632 pbp11 putative penicillin-binding protein, secreted PF00905: Penicillin binding protein transpeptidase domain 5.17 50944 F cell wall 1.1 BAC74098.1 Signal peptide CDS SAVERM_6388 7662978 7662205 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 7.7 28312 F regulation 3.5.2 BAC74099.1 Non-secretory protein CDS SAVERM_6389 7663109 7664638 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.03 52346 F specific pathways 2.1.1 BAC74100.1 Non-secretory protein CDS SAVERM_6390 7664785 7665393 hypothetical protein PF07081: Protein of unknown function (DUF1349) 4.45 21863 F similar to unknown proteins 5 BAC74101.1 Non-secretory protein CDS SAVERM_6391 7666779 7665376 putative drug/proton antiporter PF07690: Major Facilitator Superfamily 10.54 46586 F detoxification 4.2 BAC74102.1 Non-secretory protein CDS SAVERM_6392 7666842 7667849 bdpI putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 9.13 35698 F regulation 3.5.2 BAC74103.1 Non-secretory protein CDS SAVERM_6393 7667912 7668628 frnE putative protein dithiol-disulfide isomerase PF01323: DSBA-like thioredoxin domain 4.37 26066 F protein modification 3.8 BAC74104.1 Non-secretory protein CDS SAVERM_6394 7668699 7669805 hypothetical protein PF00266: Aminotransferase class-V 5.39 38421 F similar to unknown proteins 5 BAC74105.1 Non-secretory protein CDS SAVERM_6395 7671123 7670236 ectD ectoine hydroxylase (Fe(II)/alpha-ketoglutarate dependent hydroxylase) ectoine biosynthesis, PF05721: Phytanoyl-CoA dioxygenase (PhyH) 5.18 32650 F specific pathways 2.1.1 BAC74106.1 Non-secretory protein CDS SAVERM_6396 7671533 7671129 ectC ectoine synthase ectoine biosynthesis, PF06339: Ectoine synthase 4.76 15235 F specific pathways 2.1.1 BAC74107.1 Non-secretory protein CDS SAVERM_6397 7672862 7671591 ectB L-2,4-diaminobutyrate aminotransferase ectoine biosynthesis, PF00202: Aminotransferase class-III 4.87 46447 F specific pathways 2.1.1 BAC74108.1 Non-secretory protein CDS SAVERM_6398 7673431 7672892 ectA L-2,4-diaminobutyrate acetyltransferase ectoine biosynthesis, PF00583: Acetyltransferase (GNAT) family 4.85 19622 F specific pathways 2.1.1 BAC74109.1 Non-secretory protein CDS SAVERM_6399 7674927 7673797 aspC2 putative aspartate aminotransferase PF00266: Aminotransferase class-V 4.74 38616 S metabolism of amino acids & related molecules 2.2 BAC74110.1 Non-secretory protein CDS SAVERM_6400 7675117 7675965 gltI2 putative polar amino acid ABC transporter substrate-binding protein PF00497: Bacterial extracellular solute-binding proteins, family 3 8.99 29830 S transport / binding proteins & lipoproteins 1.2 BAC74111.1 Signal peptide CDS SAVERM_6401 7675962 7676795 gltK2 putative polar amino acid ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 10.44 29954 S transport / binding proteins & lipoproteins 1.2 BAC74112.1 Non-secretory protein CDS SAVERM_6402 7676792 7677595 gltL2 putative polar amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 4.52 29054 S transport / binding proteins & lipoproteins 1.2 BAC74113.1 Non-secretory protein CDS SAVERM_6403 7677606 7678697 hypothetical protein PF01979: Amidohydrolase family 5.9 39249 S similar to unknown proteins 5 BAC74114.1 Non-secretory protein CDS SAVERM_6404 7679774 7678794 cobC putative aminotransferase cobalamin biosynthesis, PF00155: Aminotransferase class I and II 7.28 34736 S metabolism of amino acids & related molecules 2.2 BAC74115.1 Non-secretory protein CDS SAVERM_6405 7680792 7679854 cbiX putative metal binding protein cobalamin biosynthesis (other possible function is involved in expression of nickel-containing superoxide dismutase), PF01903: CbiX 6.59 33798 S metabolism of coenzymes & prosthetic groups 2.5 BAC74116.1 Non-secretory protein CDS SAVERM_6406 7681403 7680789 cobH putative precorrin-8X methylmutase cobalamin biosynthesis, PF02570: Precorrin-8X methylmutase 6.63 21426 S metabolism of coenzymes & prosthetic groups 2.5 BAC74117.1 Non-secretory protein CDS SAVERM_6407 7683001 7681400 cobJ putative precorrin methylase CbiG/H-fusion; cobalamin biosynthesis, PF01890: CbiG 4.67 55021 S metabolism of coenzymes & prosthetic groups 2.5 BAC74118.1 Non-secretory protein CDS SAVERM_6408 7684329 7683079 cobL1 putative precorrin-6Y C5,15-methyltransferase cobalamin biosynthesis, PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 8.26 42377 S metabolism of coenzymes & prosthetic groups 2.5 BAC74119.1 Non-secretory protein CDS SAVERM_6409 7685150 7684326 cobM putative precorrin-4 C11-methyltransferase cobalamin biosynthesis, PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 6.44 29078 S metabolism of coenzymes & prosthetic groups 2.5 BAC74120.1 Non-secretory protein CDS SAVERM_6410 7685255 7685983 putative permease PF02535: ZIP Zinc transporter 6.8 24452 S transport / binding proteins & lipoproteins 1.2 BAC74121.1 Non-secretory protein CDS SAVERM_6411 7686756 7686007 cobI putative precorrin-2 C20-methyltransferase cobalamin biosynthesis, PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 4.85 25690 S metabolism of coenzymes & prosthetic groups 2.5 BAC74122.1 Non-secretory protein CDS SAVERM_6412 7688117 7686753 cobB putative cobyrinic acid a,c-diamide synthase cobalamin biosynthesis, PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 6.35 46935 S metabolism of coenzymes & prosthetic groups 2.5 BAC74123.1 Signal peptide CDS SAVERM_6413 7688710 7688111 cobA putative cob(I)alamin adenolsyltransferase cobalamin biosynthesis, PF02572: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP 7.89 22274 S metabolism of coenzymes & prosthetic groups 2.5 BAC74124.1 Non-secretory protein CDS SAVERM_6414 7690779 7688710 chlI putative magnesium-chelatase subunit cobalamin biosynthesis porphyrin-related, PF01078: Magnesium chelatase, subunit ChlI 5.11 72123 S metabolism of coenzymes & prosthetic groups 2.5 BAC74125.1 Non-secretory protein CDS SAVERM_6415 7694429 7690776 cobN putative cobalamin biosynthesis protein cobalamin biosynthesis, PF02514: CobN/Magnesium Chelatase 4.51 131231 S metabolism of coenzymes & prosthetic groups 2.5 BAC74126.1 Non-secretory protein CDS SAVERM_6416 7695934 7694426 cobQ1 putative cobyric acid synthase cobalamin biosynthesis, PF07685: CobB/CobQ-like glutamine amidotransferase domain 5.53 53458 S metabolism of coenzymes & prosthetic groups 2.5 BAC74127.1 Non-secretory protein CDS SAVERM_6417 7696872 7695931 cobD putative cobalamin biosynthesis protein cobalamin biosynthesis, PF03186: CobD/Cbib protein 11.63 32146 S metabolism of coenzymes & prosthetic groups 2.5 BAC74128.1 Non-secretory protein CDS SAVERM_6418 7697546 7697331 putative secreted protein 4.43 6930 S miscellaneous 4.7 BAC74129.1 Non-secretory protein CDS SAVERM_6419 7698812 7697559 pitH2 putative low-affinity inorganic phosphate transporter PF01384: Phosphate transporter family 10.33 41786 S transport / binding proteins & lipoproteins 1.2 BAC74130.1 Non-secretory protein CDS SAVERM_6420 7699746 7699003 putative lysozyme precursor, secreted PF01183: Glycosyl hydrolases family 25 10.6 26998 S cell wall 1.1 BAC74131.1 Signal peptide CDS SAVERM_6421 7699943 7700668 fucA2 putative fuculose-1-phosphate aldolase PF00596: Class II Aldolase and Adducin N-terminal domain 6.4 26022 S specific pathways 2.1.1 BAC74132.1 Non-secretory protein CDS SAVERM_6422 7700865 7701992 putative secreted protein PF00326: Prolyl oligopeptidase family 10.08 39726 S miscellaneous 4.7 BAC74133.1 Signal peptide CDS SAVERM_6423 7702240 7703607 hypothetical protein 4.95 48601 S similar to unknown proteins 5 BAC74134.1 Non-secretory protein CDS SAVERM_6424 7704081 7703659 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.4 14947 S similar to unknown proteins 5 BAC74135.1 Non-secretory protein CDS SAVERM_6425 7704121 7705302 hypothetical protein 12.34 42736 S similar to unknown proteins 5 BAC74136.1 Non-secretory protein CDS SAVERM_6426 7705394 7706992 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.02 57820 S transport / binding proteins & lipoproteins 1.2 BAC74137.1 Non-secretory protein CDS SAVERM_6427 7707369 7707590 putative transcriptional regulator 11.21 7699 S regulation 3.5.2 BAC74138.1 Non-secretory protein CDS SAVERM_6428 7707734 7708567 echA14 putative enoyl-CoA hydratase/isomerase PF00378: Enoyl-CoA hydratase/isomerase family 4.53 29519 S metabolism of lipids 2.4 BAC74139.1 Non-secretory protein CDS SAVERM_6429 7709304 7708564 hypothetical protein 5.62 25966 S similar to unknown proteins 5 BAC74140.1 Non-secretory protein CDS SAVERM_6430 7709390 7709872 putative stress-like protein PF03780: Protein of unknown function (DUF322) 4.52 16971 S miscellaneous 4.7 BAC74141.1 Non-secretory protein CDS SAVERM_6431 7709906 7710091 putative membrane protein 6.69 6424 S miscellaneous 4.7 BAC74142.1 Non-secretory protein CDS SAVERM_6432 7710095 7710496 hypothetical protein PF03780: Protein of unknown function (DUF322) 11.39 14167 S similar to unknown proteins 5 BAC74143.1 Non-secretory protein CDS SAVERM_6433 7710493 7711179 putative membrane protein 11.7 24879 S miscellaneous 4.7 BAC74144.1 Non-secretory protein CDS SAVERM_6434 7711176 7711763 putative membrane protein 11.77 21369 S miscellaneous 4.7 BAC74145.1 Non-secretory protein CDS SAVERM_6435 7712585 7711830 putative dehydrogenase PF00106: short chain dehydrogenase 4.72 25705 S miscellaneous 4.7 BAC74146.1 Non-secretory protein CDS SAVERM_6436 7714402 7712591 putative glycosyl hydrolase PF00723: Glycosyl hydrolases family 15 4.92 67282 S miscellaneous 4.7 BAC74147.1 Non-secretory protein CDS SAVERM_6437 7715372 7714575 putative membrane protein 8.03 28863 S miscellaneous 4.7 BAC74148.1 Non-secretory protein CDS SAVERM_6438 7715674 7715441 hypothetical protein 6.98 8384 S similar to unknown proteins 5 BAC74149.1 Non-secretory protein CDS SAVERM_6439 7716757 7715780 dnaQ1 putative DNA polymerase III epsilon subunit PF00929: Exonuclease 6.61 35538 S DNA replication 3.1 BAC74150.1 Non-secretory protein CDS SAVERM_6440 7717504 7716812 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 10.5 24735 S regulation 3.5.2 BAC74151.1 Non-secretory protein CDS SAVERM_6441 7717562 7718359 hypothetical protein PF06314: Acetoacetate decarboxylase (ADC) 7.08 28841 S similar to unknown proteins 5 BAC74152.1 Non-secretory protein CDS SAVERM_6442 7718359 7719243 putative dehydrogenase PF00106: short chain dehydrogenase 6.59 32125 S miscellaneous 4.7 BAC74153.1 Non-secretory protein CDS SAVERM_6443 7719251 7720567 putative amidohydrolase PF04909: Amidohydrolase 5.33 49112 S miscellaneous 4.7 BAC74154.1 Non-secretory protein CDS SAVERM_6444 7720564 7721793 putative amidohydrolase PF04909: Amidohydrolase 5.42 44443 S miscellaneous 4.7 BAC74155.1 Non-secretory protein CDS SAVERM_6445 7721818 7722528 putative membrane protein PF01988: Integral membrane protein DUF125 4.78 24206 S miscellaneous 4.7 BAC74156.1 Non-secretory protein CDS SAVERM_6446 7722672 7723541 putative sterol desaturase-related protein PF01598: Sterol desaturase 8.97 33020 S miscellaneous 4.7 BAC74157.1 Non-secretory protein CDS SAVERM_6447 7723538 7724215 putative secreted protein PF07947: YhhN-like protein 9.64 23075 S similar to unknown proteins 5 BAC74158.1 Non-secretory protein CDS SAVERM_6448 7724255 7725298 adhA8 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.12 36516 S specific pathways 2.1.1 BAC74159.1 Non-secretory protein CDS SAVERM_6449 7726354 7725302 putative membrane protein PF05425: Copper resistance protein D 12.18 35623 S miscellaneous 4.7 BAC74160.1 Non-secretory protein CDS SAVERM_6450 7728009 7726498 hypothetical protein PF02515: CoA-transferase family III 8.46 52676 S similar to unknown proteins 5 BAC74161.1 Non-secretory protein CDS SAVERM_6451 7729635 7728112 putative tripeptidyl-peptidase S, secreted Tat substrate, PF00082: Subtilase family 5.4 52000 S protein modification 3.8 BAC74162.1 Signal peptide CDS SAVERM_6452 7731297 7729762 putative tripeptidyl-peptidase S, secreted PF00082: Subtilase family 6.05 52670 S protein modification 3.8 BAC74163.1 Signal peptide CDS SAVERM_6453 7731675 7732031 hypothetical protein PF04341: Protein of unknown function, DUF485 6.53 13155 S similar to unknown proteins 5 BAC74164.1 Non-secretory protein CDS SAVERM_6454 7732028 7733677 putative sodium:solute symporter PF00474: Sodium:solute symporter family 9.9 56994 S transport / binding proteins & lipoproteins 1.2 BAC74165.1 Non-secretory protein CDS SAVERM_6455 7733782 7734813 moaA3 putative molybdenum cofactor biosynthesis protein A PF06463: Molybdenum Cofactor Synthesis C 5.06 37489 S metabolism of coenzymes & prosthetic groups 2.5 BAC74166.1 Non-secretory protein CDS SAVERM_6456 7735083 7734841 hypothetical protein 7.44 9048 S similar to unknown proteins 5 BAC74167.1 Non-secretory protein CDS SAVERM_6457 7735847 7735368 putative membrane protein 9.79 16893 S miscellaneous 4.7 BAC74168.1 Non-secretory protein CDS SAVERM_6458 7736010 7736285 putative transglycosylase associated protein PF04226: Transglycosylase associated protein 10.84 9680 S miscellaneous 4.7 BAC74169.1 Non-secretory protein CDS SAVERM_6459 7737629 7736361 tyrS putative tyrosyl-tRNA synthetase PF00579: tRNA synthetases class I (W and Y) 5.03 46240 S aminoacyl-tRNA-synthetase 3.7.2 BAC74170.1 Non-secretory protein CDS SAVERM_6460 7739068 7737674 hypothetical protein PF01523: Putative modulator of DNA gyrase 4.79 49571 S similar to unknown proteins 5 BAC74171.1 Non-secretory protein CDS SAVERM_6461 7740588 7739065 tldD putative modulator of DNA gyrase PF01523: Putative modulator of DNA gyrase 4.74 54538 S DNA modification & repair 3.2 BAC74172.1 Non-secretory protein CDS SAVERM_6462 7740859 7741578 fabG7 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 6.54 25198 S metabolism of lipids 2.4 BAC74173.1 Non-secretory protein CDS SAVERM_6463 7741584 7742351 fabI1 putative enoyl-ACP reductase similar to inhA, PF00106: short chain dehydrogenase 5.31 27127 S metabolism of lipids 2.4 BAC74174.1 Non-secretory protein CDS SAVERM_6464 7742356 7742883 hypothetical protein 9.34 19511 S no similarity 6 BAC74175.1 Non-secretory protein CDS SAVERM_6465 7743588 7742893 putative GntR-family transcriptional regulator PF07729: FCD domain 5.39 25322 S regulation 3.5.2 BAC74176.1 Non-secretory protein CDS SAVERM_6466 7743701 7745041 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 10.73 44868 S transport / binding proteins & lipoproteins 1.2 BAC74177.1 Non-secretory protein CDS SAVERM_6467 7745073 7745273 hypothetical protein 8.24 6842 S similar to unknown proteins 5 BAC74178.1 Non-secretory protein CDS SAVERM_6468 7745539 7745751 putative secreted protein 7.53 7252 S similar to unknown proteins 5 BAC74179.1 Signal peptide CDS SAVERM_6469 7745840 7746358 hypothetical protein PF00300: Phosphoglycerate mutase family 5.05 18862 S similar to unknown proteins 5 BAC74180.1 Non-secretory protein CDS SAVERM_6470 7747667 7746453 serB2 putative 3-phosphoserine phosphatase PF00702: haloacid dehalogenase-like hydrolase 4.9 42688 S metabolism of amino acids & related molecules 2.2 BAC74181.1 Non-secretory protein CDS SAVERM_6471 7750083 7748068 putative membrane protein 10.48 67186 S transport / binding proteins & lipoproteins 1.2 BAC74182.1 Non-secretory protein CDS SAVERM_6472 7750323 7752854 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.19 91288 S transport / binding proteins & lipoproteins 1.2 BAC74183.1 Non-secretory protein CDS SAVERM_6473 7753695 7752952 putative secreted protein PF01464: Transglycosylase SLT domain 10.43 25714 S similar to unknown proteins 5 BAC74184.1 Signal peptide CDS SAVERM_6474 7755165 7753933 queA putative S-adenosylmethionine:tRNA ribosyltransferase-isomerase PF02547: Queuosine biosynthesis protein 6.69 43939 S RNA modification 3.6 BAC74185.1 Non-secretory protein CDS SAVERM_6475 7755878 7755174 putative dehydrogenase PF00106: short chain dehydrogenase 4.29 23815 S miscellaneous 4.7 BAC74186.1 Non-secretory protein CDS SAVERM_6476 7756067 7757212 putative two-component system sensor kinase PF01590: GAF domain 6.16 40693 S sensors 1.3 BAC74187.1 Non-secretory protein CDS SAVERM_6477 7757205 7757846 putative two-component system response regulator PF00072: Response regulator receiver domain 5.37 22839 S regulation 3.5.2 BAC74188.1 Non-secretory protein CDS SAVERM_6478 7758074 7758319 putative secreted protein PF03777: Small secreted domain (DUF320) 10.8 7629 S miscellaneous 4.7 BAC74189.1 Signal peptide CDS SAVERM_6479 7759364 7758576 putative secreted protein 4.84 27298 S similar to unknown proteins 5 BAC74190.1 Non-secretory protein CDS SAVERM_6480 7759495 7760286 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.74 28862 S transport / binding proteins & lipoproteins 1.2 BAC74191.1 Non-secretory protein CDS SAVERM_6481 7760380 7760811 putative membrane protein PF01957: Nodulation efficiency protein D (NfeD) 5.09 14661 S transport / binding proteins & lipoproteins 1.2 BAC74192.1 Non-secretory protein CDS SAVERM_6482 7760942 7761892 putative secreted protein PF01145: SPFH domain / Band 7 family 4.97 34303 S miscellaneous 4.7 BAC74193.1 Non-secretory protein CDS SAVERM_6483 7762505 7761999 putative endonuclease PF01844: HNH endonuclease 9.48 18852 S DNA modification & repair 3.2 BAC74194.1 Non-secretory protein CDS SAVERM_6484 7763189 7762650 putative phospholipid-binding protein PF01161: Phosphatidylethanolamine-binding protein 4.33 19185 S metabolism of lipids 2.4 BAC74195.1 Non-secretory protein CDS SAVERM_6485 7764035 7763250 putative sporulation-control protein PF07070: SpoOM protein 4.45 28715 S sporulation 1.8 BAC74196.1 Non-secretory protein CDS SAVERM_6486 7764232 7764873 putative 3-methyladenine DNA glycosylase PF02245: Methylpurine-DNA glycosylase (MPG) 8.48 23159 G2 DNA modification & repair 3.2 BAC74197.1 Non-secretory protein CDS SAVERM_6487 7770872 7772263 putative secreted protein 9.57 43405 G2 similar to unknown proteins 5 BAC74198.1 Signal peptide CDS SAVERM_6488 7772308 7773084 hypothetical protein PF07719: Tetratricopeptide repeat 4.01 27630 G2 similar to unknown proteins 5 BAC74199.1 Non-secretory protein CDS SAVERM_6489 7774441 7773149 hypothetical protein PF06245: Protein of unknown function (DUF1015) 5.37 46627 G2 similar to unknown proteins 5 BAC74200.1 Non-secretory protein CDS SAVERM_6490 7774522 7775550 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.37 35107 G2 miscellaneous 4.7 BAC74201.1 Non-secretory protein CDS SAVERM_6491 7775720 7776763 fepD putative ABC transporter iron(III)/siderophore permease protein fhuB, Tat substrate, PF01032: FecCD transport family, iron-siderophore uptake system transmembrane component, putative IdeR-binding site: CGAGGGTAGGCTAACCTAA(7775696:7775714) 10.33 35887 G2 transport / binding proteins & lipoproteins 1.2 BAC74202.1 Non-secretory protein CDS SAVERM_6492 7776760 7777818 fepG putative ABC transporter iron(III)/siderophore permease protein fhuG, PF01032: FecCD transport family, iron-siderophore uptake system transmembrane component 11.31 36369 G2 transport / binding proteins & lipoproteins 1.2 BAC74203.1 Non-secretory protein CDS SAVERM_6493 7777815 7778702 fepC2 putative ABC transporter iron(III)/siderophore transport system ATP-binding protein fhuC, PF00005: ABC transporter, iron-siderophore uptake system transmembrane component 5.41 31704 G2 transport / binding proteins & lipoproteins 1.2 BAC74204.1 Non-secretory protein CDS SAVERM_6494 7779259 7778912 hypothetical protein PF02036: SCP-2 sterol transfer family 4.76 12552 G2 similar to unknown proteins 5 BAC74205.1 Non-secretory protein CDS SAVERM_6495 7779302 7779607 hypothetical protein 4.09 10601 G2 similar to unknown proteins 5 BAC74206.1 Non-secretory protein CDS SAVERM_6496 7779615 7780430 tlyA putative cytotoxin/hemolysin PF01479: S4 domain, PF01728: FtsJ-like methyltransferase 6.81 28311 G2 miscellaneous 4.7 BAC74207.1 Non-secretory protein CDS SAVERM_6497 7780427 7781332 ppnK2 putative inorganic polyphosphate/ATP-NAD kinase PF01513: ATP-NAD kinase 5.62 32140 G2 miscellaneous 4.7 BAC74208.1 Non-secretory protein CDS SAVERM_6498 7782944 7781421 putative membrane protein PF02687: Predicted permease 12.19 52605 G2 miscellaneous 4.7 BAC74209.1 Non-secretory protein CDS SAVERM_6499 7782993 7784729 recN putative DNA recombination and repair protein PF02483: SMC family, C-terminal domain 4.49 60137 G2 DNA recombination 3.3 BAC74210.1 Non-secretory protein CDS SAVERM_6500 7784805 7785704 hypothetical protein 11.71 29505 G2 similar to unknown proteins 5 BAC74211.1 Non-secretory protein CDS SAVERM_6501 7785976 7787148 putative glycosyltransferase PF00534: Glycosyl transferases group 1 9.6 41422 G2 specific pathways 2.1.1 BAC74212.1 Non-secretory protein CDS SAVERM_6502 7788819 7787170 putative regulatory protein PF02954: Bacterial regulatory protein, Fis family 9.01 58134 G2 regulation 3.5.2 BAC74213.1 Non-secretory protein CDS SAVERM_6503 7790722 7788896 putative glycosyl hydrolase PF00723: Glycosyl hydrolases family 15 4.96 68263 G2 miscellaneous 4.7 BAC74214.1 Non-secretory protein CDS SAVERM_6504 7791198 7792847 pyrG putative CTP synthetase PF06418: CTP synthase N-terminus 6.33 60149 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74215.1 Non-secretory protein CDS SAVERM_6505 7792863 7793558 nudF putative ADP-ribose pyrophosphatase PF00293: NUDIX domain 4.43 25673 G2 specific pathways 2.1.1 BAC74216.1 Non-secretory protein CDS SAVERM_6506 7793719 7795800 putative regulatory protein PF07719: Tetratricopeptide repeat 6.13 74340 G2 regulation 3.5.2 BAC74217.1 Non-secretory protein CDS SAVERM_6507 7795945 7797060 ald putative L-alanine dehydrogenase PF01262: Alanine dehydrogenase/PNT, C-terminal domain 5.26 39746 G2 metabolism of amino acids & related molecules 2.2 BAC74218.1 Non-secretory protein CDS SAVERM_6508 7797591 7798631 parA2 putative partitioning or sporulation protein PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 4.65 37689 G2 sporulation 1.8 BAC74219.1 Non-secretory protein CDS SAVERM_6509 7798616 7799200 hypothetical protein 9.24 20512 G2 similar to unknown proteins 5 BAC74220.1 Non-secretory protein CDS SAVERM_6510 7799763 7800554 scpA putative chromosome segregation and condensation protein A PF02616: ScpA/B protein 4.5 29590 G2 DNA packaging & segregation 3.4 BAC74221.1 Non-secretory protein CDS SAVERM_6511 7800551 7801201 scpB putative chromosome segregation and condensation protein B PF04079: Putative transcriptional regulators (Ypuh-like) 4.2 23731 G2 DNA packaging & segregation 3.4 BAC74222.1 Non-secretory protein CDS SAVERM_6512 7801201 7802271 rluB putative pseudouridine synthase PF00849: RNA pseudouridylate synthase 10.07 39394 G2 RNA modification 3.6 BAC74223.1 Non-secretory protein CDS SAVERM_6513 7802441 7803202 putative DNA hydrolase PF00293: NUDIX domain 6.17 27392 G2 miscellaneous 4.7 BAC74224.1 Non-secretory protein CDS SAVERM_6514 7803202 7804224 draG2 putative ADP-ribosylglycohydrolase PF03747: ADP-ribosylglycohydrolase 4.87 36852 G2 specific pathways 2.1.1 BAC74225.1 Non-secretory protein CDS SAVERM_6515 7804228 7804977 hypothetical protein PF10127: Predicted nucleotidyltransferase 6.39 27754 G2 similar to unknown proteins 5 BAC74226.1 Non-secretory protein CDS SAVERM_6516 7805664 7804903 hypothetical protein PF10127: Predicted nucleotidyltransferase 7.11 28483 G2 similar to unknown proteins 5 BAC74227.1 Non-secretory protein CDS SAVERM_6517 7806150 7805686 putative iron-sulfur protein Tat substrate, PF00355: Rieske [2Fe-2S] domain 8.22 15312 G2 miscellaneous 4.7 BAC74228.1 Non-secretory protein CDS SAVERM_6518 7806731 7806147 hypothetical protein 10.51 20751 G2 similar to unknown proteins 5 BAC74229.1 Non-secretory protein CDS SAVERM_6519 7807465 7806770 putative secreted protein 10.49 24189 G2 no similarity 6 BAC74230.1 Non-secretory protein CDS SAVERM_6520 7807676 7808038 aroH1 putative chorismate mutase EC:5.4.99.5, PF07736: Chorismate mutase type I 5.15 12975 G2 metabolism of amino acids & related molecules 2.2 BAC74231.1 Non-secretory protein CDS SAVERM_6521 7808035 7809129 tyrA putative prephenate dehydrogenase PF02153: Prephenate dehydrogenase 5.81 38305 G2 metabolism of amino acids & related molecules 2.2 BAC74232.1 Non-secretory protein CDS SAVERM_6522 7809255 7809950 cmk putative cytidylate kinase PF02224: Cytidylate kinase 4.72 23999 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74233.1 Non-secretory protein CDS SAVERM_6523 7809908 7810624 plsC7 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 11.78 25550 G2 miscellaneous 4.7 BAC74234.1 Non-secretory protein CDS SAVERM_6524 7810703 7812178 engA putative GTP-binding protein PF01926: GTPase of unknown function 5.31 53353 G2 miscellaneous 4.7 BAC74235.1 Non-secretory protein CDS SAVERM_6525 7812638 7812249 hypothetical protein 9.72 13713 G2 similar to unknown proteins 5 BAC74236.1 Non-secretory protein CDS SAVERM_6526 7813636 7812809 hypothetical protein 4.52 28798 G2 similar to unknown proteins 5 BAC74237.1 Non-secretory protein CDS SAVERM_6527 7814121 7814795 putative peptidoglycan-binding protein, secreted PF06737: Transglycosylase-like domain 9.9 22576 G2 transport / binding proteins & lipoproteins 1.2 BAC74238.1 Signal peptide CDS SAVERM_6528 7814934 7815524 putative peptidoglycan-binding protein PF06737: Transglycosylase-like domain 9.65 21372 G2 transport / binding proteins & lipoproteins 1.2 BAC74239.1 Signal peptide CDS SAVERM_6529 7816253 7815603 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10.09 22571 G2 transport / binding proteins & lipoproteins 1.2 BAC74240.1 Non-secretory protein CDS SAVERM_6530 7817059 7816250 putative ABC transporter ATP-binding protein PF00005: ABC transporter 11.41 27427 G2 transport / binding proteins & lipoproteins 1.2 BAC74241.1 Non-secretory protein CDS SAVERM_7582 7819186 7817291 putative ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 11.83 63394 G2 transport / binding proteins & lipoproteins 1.2 BAD67175.1 Non-secretory protein CDS SAVERM_6531 7819668 7819186 putative secreted protein 6.75 16266 G2 no similarity 6 BAC74242.1 Non-secretory protein CDS SAVERM_6532 7819821 7820390 putative secreted protein 8.06 19462 G2 no similarity 6 BAC74243.1 Signal peptide CDS SAVERM_6533 7820359 7821648 putative secreted protein 8.3 45917 G2 similar to unknown proteins 5 BAC74244.1 Signal peptide CDS SAVERM_6534 7821802 7823064 putative glycosyltransferase PF00534: Glycosyl transferases group 1 10.03 45622 G2 specific pathways 2.1.1 BAC74245.1 Non-secretory protein CDS SAVERM_6535 7823061 7823897 hypothetical protein 5.62 29702 G2 similar to unknown proteins 5 BAC74246.1 Non-secretory protein CDS SAVERM_6536 7823967 7825001 putative DeoR-family transcriptional regulator PF08279: HTH domain 9.8 37173 G2 regulation 3.5.2 BAC74247.1 Non-secretory protein CDS SAVERM_6537 7826574 7824883 ctaD2 putative cytochrome c oxidase subunit I (complex IV) PF00115: Cytochrome C and Quinol oxidase polypeptide I 8 62439 G2 membrane bioenergetics 1.4 BAC74248.1 Non-secretory protein CDS SAVERM_6538 7827008 7827223 hypothetical protein PF11720: Peptidase inhibitor I78 family 6.61 7664 G2 similar to unknown proteins 5 BAC74249.1 Non-secretory protein CDS SAVERM_6539 7828362 7827346 putative integral membrane protein PF01569: PAP2 superfamily 11.67 37153 G2 transport / binding proteins & lipoproteins 1.2 BAC74250.1 Non-secretory protein CDS SAVERM_6540 7829767 7828601 putative integral membrane protein PF04188: Protein of unknown function (DUF409) 10.56 40322 G2 transport / binding proteins & lipoproteins 1.2 BAC74251.1 Non-secretory protein CDS SAVERM_6541 7830029 7831636 putative multidrug efflux protein PF07690: Major Facilitator Superfamily 8.14 55182 G2 transport / binding proteins & lipoproteins 1.2 BAC74252.1 Non-secretory protein CDS SAVERM_6542 7831763 7832938 fadE12 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.64 42171 G2 metabolism of lipids 2.4 BAC74253.1 Non-secretory protein CDS SAVERM_6543 7833409 7832972 hypothetical protein PF04472: Protein of unknown function (DUF552) 4.28 15789 G2 similar to unknown proteins 5 BAC74254.1 Non-secretory protein CDS SAVERM_6544 7833762 7834910 putative regulatory protein 5.95 39136 G2 regulation 3.5.2 BAC74255.1 Non-secretory protein CDS SAVERM_6545 7835955 7834999 putative ABC transporter substrate-binding protein Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 8.74 33609 G2 transport / binding proteins & lipoproteins 1.2 BAC74256.1 Signal peptide CDS SAVERM_6546 7836397 7837242 putative polar amino acid ABC transporter ATP-binding protein gltL, PF00528: Binding-protein-dependent transport system inner membrane component 10.49 30763 G2 transport / binding proteins & lipoproteins 1.2 BAC74257.1 Non-secretory protein CDS SAVERM_6547 7837239 7838999 hypothetical protein 6.52 63683 G2 similar to unknown proteins 5 BAC74258.1 Non-secretory protein CDS SAVERM_6548 7838996 7839784 putative polar amino acid ABC transporter ATP-binding protein gltL, PF00005: ABC transporter 7.19 28611 G2 transport / binding proteins & lipoproteins 1.2 BAC74259.1 Non-secretory protein CDS SAVERM_6549 7839800 7840918 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 6.71 39771 G2 miscellaneous 4.7 BAC74260.1 Non-secretory protein CDS SAVERM_6550 7840915 7842300 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 5.88 50187 G2 miscellaneous 4.7 BAC74261.1 Non-secretory protein CDS SAVERM_6551 7842553 7842825 hypothetical protein PF07920: Protein of unknown function (DUF1684) 10.57 9902 G2 similar to unknown proteins 5 BAC74262.1 Non-secretory protein CDS SAVERM_6552 7842932 7844029 sprA putative serine protease precursor PF02983: Alpha-lytic protease prodomain 10.2 37652 G2 protein modification 3.8 BAC74263.1 Non-secretory protein CDS SAVERM_6553 7844448 7845614 sprD1 putative streptogrisin D (secreted serine protease) PF02983: Alpha-lytic protease prodomain 8.86 39887 G2 protein modification 3.8 BAC74264.1 Non-secretory protein CDS SAVERM_6554 7846297 7846827 hypothetical protein 4.21 17522 G2 similar to unknown proteins 5 BAC74265.1 Non-secretory protein CDS SAVERM_6555 7847040 7850525 dnaE2 putative DNA polymerase III alpha subunit PF07733: Bacterial DNA polymerase III alpha subunit 6.93 125108 G2 DNA replication 3.1 BAC74266.1 Non-secretory protein CDS SAVERM_6556 7850522 7851496 hypothetical protein PF00817: impB/mucB/samB family 9.19 35012 G2 similar to unknown proteins 5 BAC74267.1 Non-secretory protein CDS SAVERM_6557 7851911 7851525 hypothetical protein PF00190: Cupin 4.89 13696 G2 similar to unknown proteins 5 BAC74268.1 Non-secretory protein CDS SAVERM_6558 7851982 7852428 putative MarR-family transcriptional regulator PF01047: MarR family 9.4 15774 G2 regulation 3.5.2 BAC74269.1 Non-secretory protein CDS SAVERM_6559 7852591 7853451 lpsA2 putative secreted lipase PF01674: Lipase (class 2) 6.5 30158 G2 miscellaneous 4.7 BAC74270.1 Signal peptide CDS SAVERM_6560 7854570 7853539 cpbD2 putative chitin-binding protein, secreted PF03067: Chitin binding domain 7.63 34238 G2 specific pathways 2.1.1 BAC74271.1 Signal peptide CDS SAVERM_6561 7854729 7855199 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.52 17508 G2 miscellaneous 4.7 BAC74272.1 Non-secretory protein CDS SAVERM_6562 7855414 7855241 hypothetical protein 11.4 6777 G2 similar to unknown proteins 5 BAC74273.1 Non-secretory protein CDS SAVERM_6563 7855489 7856136 hypothetical protein PF01209: ubiE/COQ5 methyltransferase family 5.09 22681 G2 similar to unknown proteins 5 BAC74274.1 Non-secretory protein CDS SAVERM_6564 7856665 7856147 hypothetical protein PF04167: Protein of unknown function (DUF402) 4.54 19112 G2 similar to unknown proteins 5 BAC74275.1 Non-secretory protein CDS SAVERM_6565 7857642 7858028 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 7.52 13343 G2 regulation 3.5.2 BAC74277.1 Non-secretory protein CDS SAVERM_6566 7857656 7856628 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.4 37548 G2 miscellaneous 4.7 BAC74276.1 Non-secretory protein CDS SAVERM_6567 7858829 7858065 hypothetical protein PF01904: Protein of unknown function DUF72 8.61 28793 G2 similar to unknown proteins 5 BAC74278.1 Non-secretory protein CDS SAVERM_6568 7859960 7858866 putative ATPase PF00004: ATPase family associated with various cellular activities (AAA) 4.9 39558 G2 miscellaneous 4.7 BAC74279.1 Non-secretory protein CDS SAVERM_6569 7860303 7861568 xynB4 putative xylan 1,4-beta-xylosidase PF01229: Glycosyl hydrolases family 39 4.94 46721 G2 specific pathways 2.1.1 BAC74280.1 Non-secretory protein CDS SAVERM_6570 7865329 7861637 putative membrane protein PF01554: MatE 9.93 132520 G2 miscellaneous 4.7 BAC74281.1 Non-secretory protein CDS SAVERM_6571 7866263 7865463 putative polysaccharide deacetylase PF01522: Polysaccharide deacetylase 8.95 29480 G2 cell wall 1.1 BAC74282.1 Non-secretory protein CDS SAVERM_6572 7867231 7866260 exoM putative succinoglycan biosynthesis protein PF00535: Glycosyl transferase 9.41 34919 G2 cell wall 1.1 BAC74283.1 Non-secretory protein CDS SAVERM_6573 7868070 7867252 putative glycosyltransferase PF00535: Glycosyl transferase 7.1 29581 G2 specific pathways 2.1.1 BAC74284.1 Non-secretory protein CDS SAVERM_6574 7869540 7868446 hypothetical protein 10.21 40385 G2 similar to unknown proteins 5 BAC74285.1 Non-secretory protein CDS SAVERM_6575 7870036 7869545 hypothetical protein 12.5 16877 G2 no similarity 6 BAC74286.1 Non-secretory protein CDS SAVERM_6576 7871234 7870143 aprA putative alkaline serine protease (secreted peptidase A) PF00082: Subtilase family 9.02 35794 G2 protein modification 3.8 BAC74287.1 Non-secretory protein CDS SAVERM_6577 7871666 7872475 putative secreted hydrolase PF00657: GDSL-like Lipase/Acylhydrolase 8.05 27565 G2 miscellaneous 4.7 BAC74288.1 Signal peptide CDS SAVERM_6578 7874162 7872510 pkn29 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 5.06 56580 G2 protein modification 3.8 BAC74289.1 Non-secretory protein CDS SAVERM_6579 7875914 7874190 putative secreted protein Tat substrate, PF03824: High-affinity nickel-transport protein 10.21 59898 G2 similar to unknown proteins 5 BAC74290.1 Signal peptide CDS SAVERM_6580 7877923 7875911 hypothetical protein PF00515: TPR Domain 6.61 69028 G2 similar to unknown proteins 5 BAC74291.1 Non-secretory protein CDS SAVERM_6581 7879491 7877971 putative secreted protein 4.95 54574 G2 similar to unknown proteins 5 BAC74292.1 Signal peptide CDS SAVERM_6582 7879724 7880272 sig53 putative RNA polymerase ECF-subfamily sigma factor similar to SCO1723, PF04542: Sigma-70 region 2 7.58 20551 G2 RNA initiation 3.5.1 BAC74293.1 Non-secretory protein CDS SAVERM_6583 7880269 7881084 putative membrane protein 10.27 28706 G2 miscellaneous 4.7 BAC74294.1 Non-secretory protein CDS SAVERM_6584 7881200 7881469 hypothetical protein 12.5 9796 G2 similar to unknown proteins 5 BAC74295.1 Non-secretory protein CDS SAVERM_6585 7882844 7881657 hypothetical protein 6.52 42465 G2 similar to unknown proteins 5 BAC74296.1 Non-secretory protein CDS SAVERM_6586 7883642 7882893 putative GntR-family transcriptional regulator PF07702: UTRA domain 5.64 27870 G2 regulation 3.5.2 BAC74297.1 Non-secretory protein CDS SAVERM_6587 7885009 7883693 hmgA putative homogentisate 1,2-dioxygenase PF04209: homogentisate 1,2-dioxygenase 5.68 47823 G2 specific pathways 2.1.1 BAC74298.1 Non-secretory protein CDS SAVERM_6588 7885176 7885841 putative secreted protein 7.77 22472 G2 miscellaneous 4.7 BAC74299.1 Non-secretory protein CDS SAVERM_6589 7885838 7886458 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.41 23112 G2 regulation 3.5.2 BAC74300.1 Non-secretory protein CDS SAVERM_6590 7886648 7888879 putative dehydrogenase PF00384: Molybdopterin oxidoreductase 6.42 78325 G2 miscellaneous 4.7 BAC74301.1 Non-secretory protein CDS SAVERM_6591 7889002 7890408 citH putative divalent metal ions/citrate complex secondary transporter PF03600: Citrate transporter 6.09 49313 G2 transport / binding proteins & lipoproteins 1.2 BAC74302.1 Non-secretory protein CDS SAVERM_6592 7890498 7891658 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 11.78 39021 G2 transport / binding proteins & lipoproteins 1.2 BAC74303.1 Non-secretory protein CDS SAVERM_6593 7891762 7892523 putative secreted protein 6.02 25160 G2 similar to unknown proteins 5 BAC74304.1 Signal peptide CDS SAVERM_6594 7892510 7893241 putative secreted protein PF04203: Sortase family 11.37 26144 G2 similar to unknown proteins 5 BAC74305.1 Non-secretory protein CDS SAVERM_6595 7893453 7894841 putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.63 48049 G2 specific pathways 2.1.1 BAC74306.1 Non-secretory protein CDS SAVERM_6596 7894856 7895935 adhA9 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 5.91 36516 G2 specific pathways 2.1.1 BAC74307.1 Non-secretory protein CDS SAVERM_6597 7896952 7895942 putative secreted protein PF00892: Integral membrane protein DUF6 8.82 33576 G2 similar to unknown proteins 5 BAC74308.1 Non-secretory protein CDS SAVERM_6598 7897859 7897104 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 10.32 26794 G2 regulation 3.5.2 BAC74309.1 Non-secretory protein CDS SAVERM_6599 7898594 7897953 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.36 23187 G2 regulation 3.5.2 BAC74310.1 Non-secretory protein CDS SAVERM_6600 7898672 7899823 fadE3 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.14 40723 G2 metabolism of lipids 2.4 BAC74311.1 Non-secretory protein CDS SAVERM_6601 7899898 7900188 hypothetical protein PF05360: yiaA/B two helix domain 10.63 10584 G2 similar to unknown proteins 5 BAC74312.1 Non-secretory protein CDS SAVERM_6602 7900310 7900939 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.96 22692 G2 regulation 3.5.2 BAC74313.1 Non-secretory protein CDS SAVERM_6603 7901447 7900986 putative MaoC-like dehydratase PF01575: MaoC like domain 4.78 16519 G2 similar to unknown proteins 5 BAC74314.1 Non-secretory protein CDS SAVERM_6604 7901555 7902064 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 8.39 19014 G2 regulation 3.5.2 BAC74315.1 Non-secretory protein CDS SAVERM_6605 7903172 7902105 hypothetical protein PF01588: Putative tRNA binding domain 5.68 38308 G2 similar to unknown proteins 5 BAC74316.1 Non-secretory protein CDS SAVERM_6606 7903707 7904228 hypothetical protein 6.8 19144 G2 no similarity 6 BAC74317.1 Non-secretory protein CDS SAVERM_6607 7904916 7904314 hypothetical protein 8.22 22569 G2 similar to unknown proteins 5 BAC74318.1 Non-secretory protein CDS SAVERM_6608 7905201 7907990 pacB3 putative penicillin acylase, secreted PF01804: Penicillin amidase 5.93 99012 G2 detoxification 4.2 BAC74319.1 Signal peptide CDS SAVERM_6609 7909388 7908027 hypothetical protein PF05990: Protein of unknown function (DUF900) 7.24 48222 G2 similar to unknown proteins 5 BAC74320.1 Non-secretory protein CDS SAVERM_6610 7910833 7909514 putative secreted protein Tat substrate, PF07075: Protein of unknown function (DUF1343) 8.23 47390 G2 similar to unknown proteins 5 BAC74321.1 Signal peptide CDS SAVERM_6611 7910967 7911731 putative dehydrogenase PF00106: short chain dehydrogenase 4.72 26560 G2 miscellaneous 4.7 BAC74322.1 Non-secretory protein CDS SAVERM_6612 7911728 7913395 fadD15 putative acyl-CoA synthetase, long chain-fatty acid:CoA ligase PF00501: AMP-binding enzyme 6.11 59359 G2 metabolism of lipids 2.4 BAC74323.1 Non-secretory protein CDS SAVERM_6613 7913414 7914016 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.73 22535 G2 regulation 3.5.2 BAC74324.1 Non-secretory protein CDS SAVERM_6614 7915326 7914103 fadE17 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 6.38 44944 G2 metabolism of lipids 2.4 BAC74325.1 Non-secretory protein CDS SAVERM_6615 7916355 7915333 putative phosphotransferase PF01636: Phosphotransferase enzyme family 5.09 36920 G2 miscellaneous 4.7 BAC74326.1 Non-secretory protein CDS SAVERM_6616 7917448 7916537 putative polyketide cyclase PF00753: Metallo-beta-lactamase superfamily 6 32292 G2 antibiotic production 4.3 BAC74327.1 Non-secretory protein CDS SAVERM_6617 7917956 7917633 putative membrane protein PF02656: Domain of unknown function DUF 10.04 11058 G2 miscellaneous 4.7 BAC74328.1 Non-secretory protein CDS SAVERM_6618 7918345 7917953 putative membrane protein PF02656: Domain of unknown function DUF 10.39 14419 G2 miscellaneous 4.7 BAC74329.1 Non-secretory protein CDS SAVERM_6619 7919046 7918444 putative NTP pyrophosphohydrolase PF00293: NUDIX domain 4.3 21946 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74330.1 Non-secretory protein CDS SAVERM_6620 7920006 7919083 putative integral membrane protein PF05653: Protein of unknown function (DUF803) 8.76 32009 G2 miscellaneous 4.7 BAC74331.1 Non-secretory protein CDS SAVERM_6621 7920188 7921843 hypothetical protein PF00070: Pyridine nucleotide-disulphide oxidoreductase 9.66 59832 G2 similar to unknown proteins 5 BAC74332.1 Non-secretory protein CDS SAVERM_6622 7922313 7923263 hypothetical protein 6.83 34845 G2 similar to unknown proteins 5 BAC74333.1 Non-secretory protein CDS SAVERM_6623 7923378 7924940 putative amino acid permease PF00324: Amino acid permease 7.18 53342 G2 transport / binding proteins & lipoproteins 1.2 BAC74334.1 Non-secretory protein CDS SAVERM_6624 7925239 7925850 putative oxidoreductase PF00174: Oxidoreductase molybdopterin binding domain 8.2 22222 G2 miscellaneous 4.7 BAC74335.1 Non-secretory protein CDS SAVERM_6625 7925834 7926490 fdnI putative cytochrome b subunit of formate dehydrogenase Tat substrate, PF01292: Cytochrome b561 family 12.05 24047 G2 membrane bioenergetics 1.4 BAC74336.1 Non-secretory protein CDS SAVERM_6626 7927788 7926763 idnD putative L-idonate 5-dehydrogenase PF08240: Alcohol dehydrogenase GroES-like domain 5.39 34829 G2 specific pathways 2.1.1 BAC74337.1 Non-secretory protein CDS SAVERM_6627 7928559 7927801 idnO putative gluconate 5-dehydrogenase PF00106: short chain dehydrogenase 5.36 26681 G2 specific pathways 2.1.1 BAC74338.1 Non-secretory protein CDS SAVERM_6628 7929967 7928570 idnT putative gluconate permease PF02447: GntP family permease 9.39 47647 G2 transport / binding proteins & lipoproteins 1.2 BAC74339.1 Non-secretory protein CDS SAVERM_6629 7930605 7930069 idnK putative gluconokinase PF01202: Shikimate kinase 6.15 18741 G2 specific pathways 2.1.1 BAC74340.1 Non-secretory protein CDS SAVERM_6630 7930737 7931438 idnR putative GntR-family transcriptional regulator PF07729: FCD domain 6.44 25374 G2 regulation 3.5.2 BAC74341.1 Non-secretory protein CDS SAVERM_6631 7931872 7931450 hypothetical protein nrps5 gene cluster, PF02810: SEC-C motif 9.34 15773 G2 similar to unknown proteins 5 BAC74342.1 Non-secretory protein CDS SAVERM_6632 7933320 7931869 putative metallopeptidase nrps5 gene cluster, PF01433: Peptidase family M1 8.87 52717 G2 protein modification 3.8 BAC74343.1 Non-secretory protein CDS SAVERM_6633 7937201 7933326 nrps5 putative non-ribosomal peptide synthetase nrps5 gene cluster 7.76 135793 G2 antibiotic production 4.3 BAC74344.1 Non-secretory protein CDS SAVERM_6634 7937738 7939063 putative peptidase PF01546: Peptidase family M20/M25/M40 4.7 47834 G2 protein modification 3.8 BAC74345.1 Non-secretory protein CDS SAVERM_6635 7939230 7939463 putative secreted protein PF03777: Small secreted domain (DUF320) 8.82 7314 G2 miscellaneous 4.7 BAC74346.1 Signal peptide CDS SAVERM_6636 7939559 7940470 putative secreted protein PF03777: Small secreted domain (DUF320) 6.93 27287 G2 miscellaneous 4.7 BAC74347.1 Signal peptide CDS SAVERM_6637 7940764 7940576 hypothetical protein 11.15 7605 G2 similar to unknown proteins 5 BAC74348.1 Non-secretory protein CDS SAVERM_6638 7940812 7941522 hypothetical protein 3.61 25983 G2 similar to unknown proteins 5 BAC74349.1 Non-secretory protein CDS SAVERM_6639 7943859 7941655 hypothetical protein 4.54 74198 G2 similar to unknown proteins 5 BAC74350.1 Non-secretory protein CDS SAVERM_6640 7944935 7943952 putative oxidoreductase PF00248: Aldo/keto reductase family 4.83 34858 G2 miscellaneous 4.7 BAC74351.1 Non-secretory protein CDS SAVERM_6641 7945089 7946144 putative FMN-dependent monooxygenase PF00296: Luciferase-like monooxygenase 5.12 37763 G2 miscellaneous 4.7 BAC74352.1 Non-secretory protein CDS SAVERM_6642 7946370 7947158 hypothetical protein 8.16 29442 G2 similar to unknown proteins 5 BAC74353.1 Non-secretory protein CDS SAVERM_6643 7948377 7947346 corA3 putative metal-transport protein PF01544: CorA-like Mg2+ transporter protein 5.27 38544 G2 transport / binding proteins & lipoproteins 1.2 BAC74354.1 Non-secretory protein CDS SAVERM_6644 7948404 7949126 putative mutase PF00300: Phosphoglycerate mutase family 6.88 25659 G2 miscellaneous 4.7 BAC74355.1 Non-secretory protein CDS SAVERM_6645 7949237 7949827 hypothetical protein PF11290: Protein of unknown function (DUF3090) 4.33 21366 G2 similar to unknown proteins 5 BAC74356.1 Non-secretory protein CDS SAVERM_6646 7949824 7950609 hypothetical protein PF00454: Phosphatidylinositol 3- and 4-kinase 4.33 28058 G2 similar to unknown proteins 5 BAC74357.1 Non-secretory protein CDS SAVERM_6647 7950762 7951991 mshC putative ATP-dependent l-cysteine: 1D-myo-inositoyl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase mycothiol biosynthesis; cysS2, PF01406: tRNA synthetases class I (C) catalytic domain 4.99 44116 G2 adaptation to atypical conditions 4.1 BAC74358.1 Non-secretory protein CDS SAVERM_6648 7952777 7952094 hypothetical protein 6.89 25043 G2 similar to unknown proteins 5 BAC74359.1 Non-secretory protein CDS SAVERM_6649 7954775 7952817 putative serine protease PF00082: Subtilase family 6.67 69357 G2 protein modification 3.8 BAC74360.1 Non-secretory protein CDS SAVERM_6650 7956005 7955001 parJ putative protein interacts with ParA PF09754: PAC2 family 4.16 36032 G2 similar to unknown proteins 5 BAC74361.1 Non-secretory protein CDS SAVERM_6651 7957041 7956343 putative GntR-family transcriptional regulator PF07729: FCD domain 5.17 25273 G2 regulation 3.5.2 BAC74362.1 Non-secretory protein CDS SAVERM_6652 7958399 7957101 putative N-ethylammeline chlorohydrolase PF01979: Amidohydrolase family 5.67 45411 G2 specific pathways 2.1.1 BAC74363.1 Non-secretory protein CDS SAVERM_6653 7959184 7958396 udp putative uridine phosphorylase PF01048: Phosphorylase family 4.63 26956 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74364.1 Non-secretory protein CDS SAVERM_6654 7960047 7959181 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.61 29308 G2 transport / binding proteins & lipoproteins 1.2 BAC74365.1 Non-secretory protein CDS SAVERM_6655 7961108 7960047 putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.31 35890 G2 transport / binding proteins & lipoproteins 1.2 BAC74366.1 Non-secretory protein CDS SAVERM_6656 7962639 7961110 putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 6.41 53392 G2 transport / binding proteins & lipoproteins 1.2 BAC74367.1 Non-secretory protein CDS SAVERM_6657 7963669 7962620 putative simple sugar ABC transporter substrate-binding protein PF02608: Basic membrane protein 7.46 36314 G2 transport / binding proteins & lipoproteins 1.2 BAC74368.1 Signal peptide CDS SAVERM_6658 7963968 7965008 eif2 putative initiation factor eIF-2B alpha subunit PF01008: Initiation factor 2 subunit family 5.23 36256 G2 initiation 3.7.3 BAC74369.1 Non-secretory protein CDS SAVERM_6659 7965701 7965093 fucA3 putative fuculose-1-phosphate aldolase PF00596: Class II Aldolase and Adducin N-terminal domain 5.53 21157 G2 specific pathways 2.1.1 BAC74370.1 Non-secretory protein CDS SAVERM_6660 7966417 7965698 masA putative enolase-phosphatase E-1 PF00702: haloacid dehalogenase-like hydrolase 4.61 25808 G2 specific pathways 2.1.1 BAC74371.1 Non-secretory protein CDS SAVERM_6661 7967007 7966414 putative oxidase PF03079: ARD/ARD' family 4.47 21609 G2 miscellaneous 4.7 BAC74372.1 Non-secretory protein CDS SAVERM_6662 7967526 7968644 mtnK putative 5-methylthioribose kinase PF01636: Phosphotransferase enzyme family 5.76 40906 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74373.1 Non-secretory protein CDS SAVERM_6663 7970350 7968734 glpD1 putative glycerol-3-phosphate dehydrogenase PF01266: FAD dependent oxidoreductase 7.62 57818 G2 membrane bioenergetics 1.4 BAC74374.1 Non-secretory protein CDS SAVERM_6664 7971897 7970359 glpK1 putative glycerol kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 4.63 55846 G2 specific pathways 2.1.1 BAC74375.1 Non-secretory protein CDS SAVERM_6665 7972799 7972005 glpF1 putative glycerol uptake facilitator protein PF00230: Major intrinsic protein 6.34 26828 G2 transport / binding proteins & lipoproteins 1.2 BAC74376.1 Non-secretory protein CDS SAVERM_6666 7973915 7973151 gylR putative glycerol operon regulatory protein, IclR-family PF01614: Bacterial transcriptional regulator 6.96 27596 G2 regulation 3.5.2 BAC74377.1 Non-secretory protein CDS SAVERM_6667 7974140 7977712 metH putative 5-methyltetrahydrofolate:homocysteine S-methyltransferase PF02965: Vitamin B12 dependent methionine synthase, activation domain 4.62 129516 G2 metabolism of amino acids & related molecules 2.2 BAC74378.1 Signal peptide CDS SAVERM_6668 7977877 7978629 putative hydrolase, secreted PF00702: haloacid dehalogenase-like hydrolase 5.36 26338 G2 miscellaneous 4.7 BAC74379.1 Non-secretory protein CDS SAVERM_6669 7979050 7980654 oppA9 putative peptide ABC transporter substrate-binding protein PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 4.81 57905 G2 transport / binding proteins & lipoproteins 1.2 BAC74380.1 Signal peptide CDS SAVERM_6670 7980740 7982323 oppA10 putative peptide ABC transporter substrate-binding protein PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 4.65 56362 G2 transport / binding proteins & lipoproteins 1.2 BAC74381.1 Non-secretory protein CDS SAVERM_6671 7983084 7982413 putative two-component system response regulator PF00072: Response regulator receiver domain 4.73 24022 G2 regulation 3.5.2 BAC74382.1 Non-secretory protein CDS SAVERM_6672 7983961 7983101 hypothetical protein PF10926: Protein of unknown function (DUF2800) 5.32 32301 G2 similar to unknown proteins 5 BAC74383.1 Non-secretory protein CDS SAVERM_6673 7984950 7986080 putative peptidase PF02163: Peptidase family M50 5.47 40143 G2 protein modification 3.8 BAC74384.1 Non-secretory protein CDS SAVERM_6674 7986121 7987023 putative tRNA methyltransferase PF08704: tRNA methyltransferase complex GCD14 subunit 6.6 32773 G2 similar to unknown proteins 5 BAC74385.1 Non-secretory protein CDS SAVERM_6675 7987213 7987788 putative secreted protein 8.33 19636 G2 similar to unknown proteins 5 BAC74386.1 Signal peptide CDS SAVERM_6676 7988173 7987868 fdxG putative ferredoxin PF00037: 4Fe-4S binding domain 3.69 10855 G2 membrane bioenergetics 1.4 BAC74387.1 Non-secretory protein CDS SAVERM_6677 7988428 7990194 putative AAA-family ATPase PF00004: ATPase family associated with various cellular activities (AAA) 4.59 65179 G2 membrane bioenergetics 1.4 BAC74388.1 Non-secretory protein CDS SAVERM_6678 7990430 7991941 putative proteasome component PF03136: Putative proteasome component 5.65 57016 G2 protein modification 3.8 BAC74389.1 Non-secretory protein CDS SAVERM_6679 7992097 7992315 hypothetical protein PF05639: Protein of unknown function (DUF797) 3.8 8003 G2 similar to unknown proteins 5 BAC74390.1 Non-secretory protein CDS SAVERM_6680 7992334 7992942 putative endonuclease VII PF02945: Recombination endonuclease VII 9.33 22157 G2 DNA modification & repair 3.2 BAC74391.1 Non-secretory protein CDS SAVERM_6681 7992894 7993739 prcB1 putative 20S proteasome beta-subunit PF00227: Proteasome A-type and B-type 4.68 30292 G2 protein modification 3.8 BAC74392.1 Non-secretory protein CDS SAVERM_6682 7993807 7994568 prcA putative 20S proteasome alpha-subunit PF00227: Proteasome A-type and B-type 4.71 27708 G2 protein modification 3.8 BAC74393.1 Non-secretory protein CDS SAVERM_6683 7995641 7994625 putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 5.75 35289 G2 regulation 3.5.2 BAC74394.1 Non-secretory protein CDS SAVERM_6684 7995763 7997022 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 8.6 42579 G2 transport / binding proteins & lipoproteins 1.2 BAC74395.1 Non-secretory protein CDS SAVERM_6685 7997032 7998393 putative proteasome component PF03136: Putative proteasome component 8.68 52172 G2 protein modification 3.8 BAC74396.1 Non-secretory protein CDS SAVERM_6686 7998523 7999527 fkbB putative FK-506 binding protein, peptidyl-prolyl cis-trans isomerase Tat substrate, PF00254: FKBP-type peptidyl-prolyl cis-trans isomerase 9.9 34793 G2 protein folding 3.9 BAC74397.1 Signal peptide CDS SAVERM_6687 7999599 7999973 fkbP putative FK-506 binding protein, peptidyl-prolyl cis-trans isomerase PF00254: FKBP-type peptidyl-prolyl cis-trans isomerase 4.5 13049 G2 protein folding 3.9 BAC74398.1 Non-secretory protein CDS SAVERM_6688 8000193 8001170 hypothetical protein PF13280: WYL domain 5.86 35937 G2 similar to unknown proteins 5 BAC74399.1 Non-secretory protein CDS SAVERM_6689 8001187 8002227 hypothetical protein PF13280: WYL domain 4.54 37834 G2 similar to unknown proteins 5 BAC74400.1 Non-secretory protein CDS SAVERM_6690 8002224 8002604 hypothetical protein 10.4 13088 G2 similar to unknown proteins 5 BAC74401.1 Non-secretory protein CDS SAVERM_6691 8002615 8002809 putative secreted protein 11.66 6837 G2 similar to unknown proteins 5 BAC74402.1 Non-secretory protein CDS SAVERM_6692 8003144 8003428 tatA putative sec-independent protein translocase protein TatA PF02416: mttA/Hcf106 family 10.39 9981 G2 miscellaneous 4.7 BAC74403.1 Non-secretory protein CDS SAVERM_6693 8003476 8004423 tatC putative sec-independent protein translocase protein TatC PF00902: Sec-independent protein translocase protein (TatC) 5.91 34628 G2 miscellaneous 4.7 BAC74404.1 Non-secretory protein CDS SAVERM_6694 8004455 8005345 dgkA putative diacylglycerol kinase PF00781: Diacylglycerol kinase catalytic domain (presumed) 7.56 30526 G2 similar to unknown proteins 5 BAC74405.1 Non-secretory protein CDS SAVERM_6695 8005431 8008244 helY putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 7.24 104198 G2 RNA modification 3.6 BAC74406.1 Non-secretory protein CDS SAVERM_6696 8009433 8008333 putative monooxygenase PF00296: Luciferase-like monooxygenase 6.45 39949 G2 miscellaneous 4.7 BAC74407.1 Non-secretory protein CDS SAVERM_6697 8011277 8009625 putative amidase family protein PF01425: Amidase 5.92 56967 G2 miscellaneous 4.7 BAC74408.1 Non-secretory protein CDS SAVERM_6698 8014809 8011294 uahA putative urea amidolyase PF02786: Carbamoyl-phosphate synthase L chain, ATP binding domain 4.97 124456 G2 metabolism of amino acids & related molecules 2.2 BAC74409.1 Non-secretory protein CDS SAVERM_6699 8015441 8014806 hypothetical protein PF09347: Domain of unknown function (DUF1989) 5.48 22472 G2 similar to unknown proteins 5 BAC74410.1 Non-secretory protein CDS SAVERM_6700 8016262 8015438 hypothetical protein PF09347: Domain of unknown function (DUF1989) 5.65 29240 G2 similar to unknown proteins 5 BAC74411.1 Non-secretory protein CDS SAVERM_6701 8016448 8017071 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.52 22202 G2 regulation 3.5.2 BAC74412.1 Non-secretory protein CDS SAVERM_6702 8017395 8018978 cvnA10 putative sensor-like histidine kinase multi-component regulatory system-10 5.03 57505 G2 sensors 1.3 BAC74413.1 Non-secretory protein CDS SAVERM_6703 8018975 8019382 cvnB10 hypothetical protein multi-component regulatory system-10, PF03259: Roadblock/LC7 domain 6.24 14399 G2 similar to unknown proteins 5 BAC74414.1 Non-secretory protein CDS SAVERM_6704 8019379 8019804 cvnC10 hypothetical protein multi-component regulatory system-10, PF05331: Protein of unknown function (DUF742) 4.9 15049 G2 similar to unknown proteins 5 BAC74415.1 Non-secretory protein CDS SAVERM_6705 8019785 8020405 cvnD10 putative ATP/GTP-binding protein multi-component regulatory system-10 4.92 22678 G2 miscellaneous 4.7 BAC74416.1 Non-secretory protein CDS SAVERM_6706 8020473 8021933 cyp24 putative cytochrome P450 CYP157C2, adjacent to multi-component regulatory system-10 6.17 53354 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74417.1 Non-secretory protein CDS SAVERM_6707 8022969 8022004 putative ribosomal pseudouridine synthase PF00849: RNA pseudouridylate synthase 9.76 35936 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74418.1 Non-secretory protein CDS SAVERM_6708 8023104 8023706 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.5 21610 G2 miscellaneous 4.7 BAC74419.1 Non-secretory protein CDS SAVERM_6709 8025302 8023722 putative amino acid permease PF00324: Amino acid permease 8.42 55237 G2 transport / binding proteins & lipoproteins 1.2 BAC74420.1 Non-secretory protein CDS SAVERM_6710 8025589 8026236 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 5.41 24741 G2 miscellaneous 4.7 BAC74421.1 Non-secretory protein CDS SAVERM_6711 8026486 8027517 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.33 35977 G2 transport / binding proteins & lipoproteins 1.2 BAC74422.1 Non-secretory protein CDS SAVERM_6712 8027514 8028290 putative ABC transporter drug export system permease protein PF01061: ABC-2 type transporter 10.02 27847 G2 transport / binding proteins & lipoproteins 1.2 BAC74423.1 Non-secretory protein CDS SAVERM_6713 8029159 8028311 putative siderophore-interacting protein PF04954: Siderophore-interacting protein, putative IdeR-binding site: CATGCTTAGGCTTACCTAA(8029178:8029196) 4.81 31516 G2 miscellaneous 4.7 BAC74424.1 Non-secretory protein CDS SAVERM_6714 8030151 8029222 putative 5’-3’ exonuclease PF02739: 5'-3' exonuclease, N-terminal resolvase-like domain 4.49 33502 G2 DNA modification & repair 3.2 BAC74425.1 Non-secretory protein CDS SAVERM_6715 8030365 8031444 opuAA putative glycine betaine ABC transport ATP-binding protein PF00005: ABC transporter 5.22 39313 G2 transport / binding proteins & lipoproteins 1.2 BAC74426.1 Non-secretory protein CDS SAVERM_6716 8031437 8034052 opuAB putative glycine betaine ABC transport system permease protein PF04069: Substrate binding domain of ABC-type glycine betaine transport system 9.16 94925 G2 transport / binding proteins & lipoproteins 1.2 BAC74427.1 Non-secretory protein CDS SAVERM_6717 8034155 8034835 hypothetical protein 12.04 23638 G2 no similarity 6 BAC74428.1 Non-secretory protein CDS SAVERM_6718 8035015 8035590 putative regulatory protein PF01381: Helix-turn-helix 7.38 21106 G2 regulation 3.5.2 BAC74429.1 Non-secretory protein CDS SAVERM_6719 8035685 8036482 putative methyltransferase PF01739: CheR methyltransferase, SAM binding domain 4.81 28807 G2 miscellaneous 4.7 BAC74430.1 Non-secretory protein CDS SAVERM_6720 8036490 8037245 hypothetical protein PF01497: Periplasmic binding protein 5.76 27250 G2 similar to unknown proteins 5 BAC74431.1 Non-secretory protein CDS SAVERM_6721 8038371 8037211 putative integral membrane protein PF03595: C4-dicarboxylate transporter/malic acid transport protein 11.1 39808 G2 miscellaneous 4.7 BAC74432.1 Non-secretory protein CDS SAVERM_6722 8038442 8039362 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 11.48 31942 G2 regulation 3.5.2 BAC74433.1 Non-secretory protein CDS SAVERM_6723 8040179 8039394 putative secreted protein PF07722: Peptidase C26 6.8 27037 G2 similar to unknown proteins 5 BAC74434.1 Non-secretory protein CDS SAVERM_6724 8040981 8040205 putative GntR-family transcriptional regulator PF07729: FCD domain 5.1 28032 G2 regulation 3.5.2 BAC74435.1 Non-secretory protein CDS SAVERM_6725 8041036 8042400 glnA4 putative glutamine synthetase PF00120: Glutamine synthetase, catalytic domain 4.88 49853 G2 metabolism of amino acids & related molecules 2.2 BAC74436.1 Non-secretory protein CDS SAVERM_6726 8042397 8043788 aldC putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.48 48674 G2 specific pathways 2.1.1 BAC74437.1 Non-secretory protein CDS SAVERM_6727 8043785 8044576 putative dehydrogenase PF00106: short chain dehydrogenase 4.57 27641 G2 miscellaneous 4.7 BAC74438.1 Non-secretory protein CDS SAVERM_6728 8044652 8045866 putative lipoprotein 6.79 44095 G2 transport / binding proteins & lipoproteins 1.2 BAC74439.1 Non-secretory protein CDS SAVERM_6729 8045901 8046833 putative membrane protein 4.98 31565 G2 miscellaneous 4.7 BAC74440.1 Non-secretory protein CDS SAVERM_6730 8048151 8046949 hypothetical protein PF01168: Alanine racemase, N-terminal domain 7.55 42334 G2 similar to unknown proteins 5 BAC74441.1 Non-secretory protein CDS SAVERM_6731 8049283 8048174 putative secreted protein 11.71 35352 G2 similar to unknown proteins 5 BAC74442.1 Non-secretory protein CDS SAVERM_6732 8049489 8050241 putative secreted protein 8.86 25589 G2 similar to unknown proteins 5 BAC74443.1 Signal peptide CDS SAVERM_6733 8050238 8051458 putative mycosin-1 (secreted serine protease) PF00082: Subtilase family 9.16 42206 G2 protein modification 3.8 BAC74444.1 Signal peptide CDS SAVERM_6734 8052454 8051504 putative secreted protein Tat substrate 4.5 32666 G2 miscellaneous 4.7 BAC74445.1 Signal peptide CDS SAVERM_6735 8052605 8053336 hypothetical protein 4.57 25046 G2 similar to unknown proteins 5 BAC74446.1 Non-secretory protein CDS SAVERM_6736 8053845 8053489 hypothetical protein 4.2 12475 G2 similar to unknown proteins 5 BAC74447.1 Non-secretory protein CDS SAVERM_6737 8054233 8054958 infC putative translation initiation factor IF-3 PF00707: Translation initiation factor IF-3, C-terminal domain 6.54 26779 G2 initiation 3.7.3 BAC74448.1 Non-secretory protein CDS SAVERM_6738 8055065 8055259 rpmI putative ribosomal protein L35 PF01632: Ribosomal protein L35 12.23 7079 G2 ribosomal protein 3.7.1 BAC74449.1 Non-secretory protein CDS SAVERM_6739 8055355 8055738 rplT putative ribosomal protein L20 PF00453: Ribosomal protein L20 11.48 14244 G2 ribosomal protein 3.7.1 BAC74450.1 Non-secretory protein CDS SAVERM_6740 8055796 8056722 tsnR2 putative rRNA methyltransferase PF00588: SpoU rRNA Methylase family 5.07 31977 G2 RNA modification 3.6 BAC74451.1 Non-secretory protein CDS SAVERM_6741 8056816 8057979 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.8 41959 G2 sensors 1.3 BAC74452.1 Non-secretory protein CDS SAVERM_6742 8058161 8059288 pheS putative phenylalanyl-tRNA synthetase alpha subunit PF01409: tRNA synthetases class II core domain (F) 4.51 41183 G2 aminoacyl-tRNA-synthetase 3.7.2 BAC74453.1 Non-secretory protein CDS SAVERM_6743 8059288 8061789 pheT putative phenylalanyl-tRNA synthetase beta subunit PF03483: B3/4 domain 4.92 89255 G2 aminoacyl-tRNA-synthetase 3.7.2 BAC74454.1 Non-secretory protein CDS SAVERM_6744 8062098 8063252 prpB12 putative magnesium or manganese-dependent protein phosphatase PF02673: Bacitracin resistance protein BacA 11.1 41242 G2 protein modification 3.8 BAC74455.1 Non-secretory protein CDS SAVERM_6745 8063589 8064929 putative transcriptional regulator PF06036: Streptomyces protein of unknown function (DUF921) 8.61 47997 G2 regulation 3.5.2 BAC74456.1 Non-secretory protein CDS SAVERM_6746 8065084 8065629 hypothetical protein PF00293: NUDIX domain 4.71 20593 G2 similar to unknown proteins 5 BAC74457.1 Non-secretory protein CDS SAVERM_6747 8065961 8065650 hypothetical protein 6.9 11206 G2 no similarity 6 BAC74458.1 Non-secretory protein CDS SAVERM_6748 8067010 8066129 fadC5 putative 3-hydroxyacyl-CoA dehydrogenase PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 4.64 31553 G2 metabolism of lipids 2.4 BAC74459.1 Non-secretory protein CDS SAVERM_6749 8067170 8068423 putative secreted protein Tat substrate, PF02638: Uncharacterized BCR, COG1649 9.48 46267 G2 miscellaneous 4.7 BAC74460.1 Signal peptide CDS SAVERM_6750 8068625 8068425 hypothetical protein PF08940: Domain of unknown function (DUF1918) 5.96 7168 G2 similar to unknown proteins 5 BAC74461.1 Non-secretory protein CDS SAVERM_6751 8069749 8068730 putative integral membrane protein PF00892: Integral membrane protein DUF6 10.07 34562 G2 miscellaneous 4.7 BAC74462.1 Non-secretory protein CDS SAVERM_6752 8069871 8071181 putative aminotransferase PF00155: Aminotransferase class I and II 8.74 45535 G2 regulation 3.5.2 BAC74463.1 Non-secretory protein CDS SAVERM_6753 8071286 8071726 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.96 15867 G2 miscellaneous 4.7 BAC74464.1 Non-secretory protein CDS SAVERM_6754 8071818 8072402 hypothetical protein PF00300: Phosphoglycerate mutase family 6.52 20974 G2 similar to unknown proteins 5 BAC74465.1 Non-secretory protein CDS SAVERM_6755 8072869 8072399 hypothetical protein 4.98 17135 G2 similar to unknown proteins 5 BAC74466.1 Non-secretory protein CDS SAVERM_6756 8073187 8075319 putative alpha-L-arabinofuranosidase I PF02018: Carbohydrate binding domain 4.68 77279 G2 miscellaneous 4.7 BAC74467.1 Signal peptide CDS SAVERM_6757 8075743 8075306 putative carboxymuconolactone decarboxylase PF02627: Carboxymuconolactone decarboxylase family 4.92 15295 G2 miscellaneous 4.7 BAC74468.1 Non-secretory protein CDS SAVERM_6758 8076159 8075740 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 8.97 15945 G2 regulation 3.5.2 BAC74469.1 Non-secretory protein CDS SAVERM_6759 8076988 8076350 hypothetical protein 6.72 22807 G2 no similarity 6 BAC74470.1 Non-secretory protein CDS SAVERM_6760 8078250 8077051 hypothetical protein 5.18 44887 G2 similar to unknown proteins 5 BAC74471.1 Non-secretory protein CDS SAVERM_6761 8078690 8078247 hypothetical protein 10.43 15706 G2 similar to unknown proteins 5 BAC74472.1 Non-secretory protein CDS SAVERM_6762 8079557 8078754 putative hydroxylase PF05368: NmrA-like family 4.78 29147 G2 miscellaneous 4.7 BAC74473.1 Non-secretory protein CDS SAVERM_6763 8079875 8080903 argC putative N-acetyl-gamma-glutamyl-phosphate reductase PF02774: Semialdehyde dehydrogenase, dimerisation domain 5.54 34780 G2 metabolism of amino acids & related molecules 2.2 BAC74474.1 Non-secretory protein CDS SAVERM_6764 8080900 8082051 argJ putative glutamate N-acetyltransferase/amino-acid N-acetyltransferase PF01960: ArgJ family 4.51 39619 G2 metabolism of amino acids & related molecules 2.2 BAC74475.1 Non-secretory protein CDS SAVERM_6765 8082048 8082962 argB putative N-acetylglutamate 5-phosphotransferase PF00696: Amino acid kinase family 4.57 32286 G2 metabolism of amino acids & related molecules 2.2 BAC74476.1 Non-secretory protein CDS SAVERM_6766 8082959 8084170 argD putative N-acetylornithine aminotransferase PF00202: Aminotransferase class-III 5.07 41670 G2 metabolism of amino acids & related molecules 2.2 BAC74477.1 Non-secretory protein CDS SAVERM_6767 8084178 8084714 argR putative repressor of arg regulon PF01316: Arginine repressor, DNA binding domain 6.24 19284 G2 regulation 3.5.2 BAC74478.1 Non-secretory protein CDS SAVERM_6768 8085578 8084841 apbE2 putative thiamine biosynthesis lipoprotein precursor PF02424: ApbE family 4.59 25446 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74479.1 Non-secretory protein CDS SAVERM_6769 8086422 8085634 putative secreted protein Tat substrate, PF04205: FMN-binding domain 10 25595 G2 similar to unknown proteins 5 BAC74480.1 Signal peptide CDS SAVERM_6770 8087821 8086442 putative oxidoreductase PF00175: Oxidoreductase NAD-binding domain 10.47 50725 G2 miscellaneous 4.7 BAC74481.1 Non-secretory protein CDS SAVERM_6771 8088402 8087905 putative secreted protein Tat substrate, PF04205: FMN-binding domain 10.75 16929 G2 similar to unknown proteins 5 BAC74482.1 Signal peptide CDS SAVERM_6772 8089771 8088410 putative oxidoreductase PF00175: Oxidoreductase NAD-binding domain 10.08 49499 G2 miscellaneous 4.7 BAC74483.1 Non-secretory protein CDS SAVERM_6773 8089920 8090708 putative two-component system response regulator PF00072: Response regulator receiver domain 4.99 29053 G2 regulation 3.5.2 BAC74484.1 Non-secretory protein CDS SAVERM_6774 8090705 8092219 putative two-component system sensor kinase PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.25 53392 G2 sensors 1.3 BAC74485.1 Non-secretory protein CDS SAVERM_6775 8092973 8092272 putative secreted protein 9.4 24784 G2 miscellaneous 4.7 BAC74486.1 Signal peptide CDS SAVERM_6776 8093564 8092977 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 6.39 21592 G2 similar to unknown proteins 5 BAC74487.1 Non-secretory protein CDS SAVERM_6777 8094708 8093803 putative secreted protein 4.22 29879 G2 similar to unknown proteins 5 BAC74488.1 Signal peptide CDS SAVERM_6778 8094879 8096093 argG2 putative argininosuccinate synthase PF00764: Arginosuccinate synthase 4.69 44065 G2 metabolism of amino acids & related molecules 2.2 BAC74489.1 Non-secretory protein CDS SAVERM_6779 8096194 8097627 argH putative argininosuccinate lyase PF00206: Lyase 5.32 51285 G2 metabolism of amino acids & related molecules 2.2 BAC74490.1 Non-secretory protein CDS SAVERM_6780 8097662 8098675 putative oxidoreductase PF00248: Aldo/keto reductase family 4.75 35954 G2 miscellaneous 4.7 BAC74491.1 Non-secretory protein CDS SAVERM_6781 8098734 8099312 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.14 21092 G2 regulation 3.5.2 BAC74492.1 Non-secretory protein CDS SAVERM_6782 8099309 8100826 putative multidrug resistance efflux protein PF07690: Major Facilitator Superfamily 8.75 51391 G2 transport / binding proteins & lipoproteins 1.2 BAC74493.1 Non-secretory protein CDS SAVERM_6783 8101566 8100895 plsC4 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 10.26 24581 G2 metabolism of lipids 2.4 BAC74494.1 Non-secretory protein CDS SAVERM_6784 8101953 8103134 glpQ3 putative glycerophosphoryl diester phosphodiesterase Tat substrate, F03009: Glycerophosphoryl diester phosphodiesterase family 8.82 42916 G2 metabolism of lipids 2.4 BAC74495.1 Non-secretory protein CDS SAVERM_6785 8103254 8103760 sig54 putative RNA polymerase ECF-subfamily sigma factor similar to SCO1564, PF04542: Sigma-70 region 2 8.5 18325 G2 RNA initiation 3.5.1 BAC74496.1 Non-secretory protein CDS SAVERM_6786 8103785 8104303 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.83 18435 G2 miscellaneous 4.7 BAC74497.1 Non-secretory protein CDS SAVERM_6787 8104981 8104529 putative integral membrane protein 8.67 16089 G2 miscellaneous 4.7 BAC74498.1 Non-secretory protein CDS SAVERM_6788 8105321 8104962 putative integral membrane protein PF04238: Protein of unknown function (DUF420) 5.7 12650 G2 miscellaneous 4.7 BAC74499.1 Non-secretory protein CDS SAVERM_6789 8105882 8106982 metN putative ABC transporter ATP-binding protein (D-methionine transport system ATP-binding protein) PF00005: ABC transporter 6.43 39015 G2 transport / binding proteins & lipoproteins 1.2 BAC74500.1 Non-secretory protein CDS SAVERM_6790 8106979 8107758 metI putative ABC transporter permease protein PF00528: Binding-protein-dependent transport system inner membrane component 9.79 27171 G2 transport / binding proteins & lipoproteins 1.2 BAC74501.1 Non-secretory protein CDS SAVERM_6791 8107830 8108657 metQ1 putative ABC transporter substrate-binding protein (D-methionine transport system substrate-binding protein) PF03180: NLPA lipoprotein 8.83 29138 G2 transport / binding proteins & lipoproteins 1.2 BAC74502.1 Signal peptide CDS SAVERM_6792 8108671 8109510 metQ2 putative ABC transporter substrate-binding protein (D-methionine transport system substrate-binding protein) PF03180: NLPA lipoprotein 4.64 29091 G2 transport / binding proteins & lipoproteins 1.2 BAC74503.1 Signal peptide CDS SAVERM_6793 8109643 8110281 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 4.17 23698 G2 miscellaneous 4.7 BAC74504.1 Non-secretory protein CDS SAVERM_6794 8110412 8111623 cobL2 putative precorrin-6Y C5,15-methyltransferase cobalamin biosynthesis, PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 6.44 41806 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74505.1 Non-secretory protein CDS SAVERM_6795 8111969 8115829 cobT2 putative nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase cobalamin biosynthesis, PF02277: Phosphoribosyltransferase 4.16 132662 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74506.1 Non-secretory protein CDS SAVERM_6796 8115977 8117209 cysG putative uroporphyrin-III methyltransferase PF00590: Tetrapyrrole (Corrin/Porphyrin) Methylases 6.52 42796 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74507.1 Non-secretory protein CDS SAVERM_6797 8117274 8118092 putative rRNA methylase PF00588: SpoU rRNA Methylase family 5.06 29509 G2 RNA modification 3.6 BAC74508.1 Non-secretory protein CDS SAVERM_6798 8118108 8118503 putative MutT-like protein PF00293: NUDIX domain 4.49 14890 G2 miscellaneous 4.7 BAC74509.1 Non-secretory protein CDS SAVERM_6799 8119888 8118587 pkn30 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 11.28 46140 G2 protein modification 3.8 BAC74510.1 Non-secretory protein CDS SAVERM_6800 8120530 8120739 putative membrane protein 12.6 7419 G2 miscellaneous 4.7 BAC74511.1 Non-secretory protein CDS SAVERM_6801 8120921 8121856 hypothetical protein PF01636: Phosphotransferase enzyme family 6.43 32336 G2 similar to unknown proteins 5 BAC74512.1 Non-secretory protein CDS SAVERM_6802 8121958 8122224 hypothetical protein 7.27 9405 G2 similar to unknown proteins 5 BAC74513.1 Non-secretory protein CDS SAVERM_6803 8122893 8124014 pabB putative anthranilate synthase PF00425: chorismate binding enzyme 5.94 39664 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74514.1 Non-secretory protein CDS SAVERM_6804 8124011 8124832 putative D-alanine aminotransferase PF01063: Aminotransferase class IV 4.68 28998 G2 protein modification 3.8 BAC74515.1 Non-secretory protein CDS SAVERM_6805 8124859 8125713 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.68 31029 G2 miscellaneous 4.7 BAC74516.1 Non-secretory protein CDS SAVERM_6806 8126350 8125820 hypothetical protein PF01323: DSBA-like thioredoxin domain 4.45 19496 G2 similar to unknown proteins 5 BAC74517.1 Non-secretory protein CDS SAVERM_6807 8126556 8126999 hypothetical protein 11.04 15012 G2 similar to unknown proteins 5 BAC74518.1 Non-secretory protein CDS SAVERM_6808 8127180 8127332 hypothetical protein 4.23 5440 G2 no similarity 6 BAC74519.1 Non-secretory protein CDS SAVERM_6809 8128108 8127548 hypothetical protein PF07336: Protein of unknown function (DUF1470) 6.15 20262 G2 similar to unknown proteins 5 BAC74520.1 Non-secretory protein CDS SAVERM_6810 8128899 8128420 ssgC putative cell division protein (probably reverse function of SsgA) PF04686: Streptomyces sporulation and cell division protein, SsgA 6.6 17444 G2 regulation 3.5.2 BAC74521.1 Non-secretory protein CDS SAVERM_6811 8129024 8129458 putative membrane protein 11.26 15895 G2 miscellaneous 4.7 BAC74522.1 Non-secretory protein CDS SAVERM_6812 8130180 8131466 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 5.01 46815 G2 transport / binding proteins & lipoproteins 1.2 BAC74523.1 Non-secretory protein CDS SAVERM_6813 8131463 8132434 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.33 35994 G2 transport / binding proteins & lipoproteins 1.2 BAC74524.1 Non-secretory protein CDS SAVERM_6814 8132404 8133312 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.9 33219 G2 transport / binding proteins & lipoproteins 1.2 BAC74525.1 Non-secretory protein CDS SAVERM_6815 8133314 8133961 putative secreted protein 12.18 22379 G2 no similarity 6 BAC74526.1 Non-secretory protein CDS SAVERM_6816 8134457 8136928 hypothetical protein 6.4 91882 G2 similar to unknown proteins 5 BAC74527.1 Non-secretory protein CDS SAVERM_6817 8139337 8136947 putative integral membrane protein PF01970: Integral membrane protein DUF112 11.48 80611 G2 miscellaneous 4.7 BAC74528.1 Non-secretory protein CDS SAVERM_6818 8139440 8139898 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 9.9 17412 G2 similar to unknown proteins 5 BAC74529.1 Non-secretory protein CDS SAVERM_6819 8140811 8140086 dnaQ2 putative DNA polymerase III epsilon subunit PF00929: Exonuclease 6.6 26559 G2 DNA replication 3.1 BAC74530.1 Non-secretory protein CDS SAVERM_6820 8140980 8141546 hypothetical protein PF14280: Domain of unknown function (DUF4365) 8.86 20541 G2 similar to unknown proteins 5 BAC74531.1 Non-secretory protein CDS SAVERM_6821 8141543 8142763 hypothetical protein 6.94 43446 G2 similar to unknown proteins 5 BAC74532.1 Non-secretory protein CDS SAVERM_6822 8142864 8144840 thrS putative threonyl-tRNA synthetase PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 5.26 74224 G2 aminoacyl-tRNA-synthetase 3.7.2 BAC74533.1 Non-secretory protein CDS SAVERM_6823 8145199 8145762 hit putative histidine triad (HIT) family protein PF01230: HIT domain 6.22 20304 G2 miscellaneous 4.7 BAC74534.1 Non-secretory protein CDS SAVERM_6824 8147543 8145882 putative membrane protein 9.51 60973 G2 miscellaneous 4.7 BAC74535.1 Non-secretory protein CDS SAVERM_6825 8149970 8147772 fusA2 putative translation elongation factor G PF03764: Elongation factor G, domain IV 5.1 77733 G2 elongation 3.7.4 BAC74536.1 Non-secretory protein CDS SAVERM_6826 8150189 8150923 pgsA2 putative phosphatidylglycerophosphate synthase PF01066: CDP-alcohol phosphatidyltransferase 10.19 25482 G2 miscellaneous 4.7 BAC74537.1 Non-secretory protein CDS SAVERM_6827 8150920 8151846 plsC5 putative 1-acylglycerol-3-phosphate O-acyltransferase PF03279: Bacterial lipid A biosynthesis acyltransferase 7.24 33905 G2 metabolism of lipids 2.4 BAC74538.1 Non-secretory protein CDS SAVERM_6828 8151843 8153003 putative glycosyltransferase PF00534: Glycosyl transferases group 1 5.18 41789 G2 specific pathways 2.1.1 BAC74539.1 Non-secretory protein CDS SAVERM_6829 8153398 8153952 putative secreted protein 7.1 20318 G2 miscellaneous 4.7 BAC74540.1 Non-secretory protein CDS SAVERM_6830 8154087 8155001 pdxS putative pyridoxine biosynthesis protein (lyase) PF01680: SOR/SNZ family 4.99 32220 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74541.1 Non-secretory protein CDS SAVERM_6831 8155015 8155620 pdxT putative pyridoxine biosynthesis protein (glutamine amidotransferase) PF01174: SNO glutamine amidotransferase family 5.3 21434 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74542.1 Non-secretory protein CDS SAVERM_6832 8155698 8156450 hypothetical protein PF01709: Domain of unknown function DUF28 4.36 26632 G2 similar to unknown proteins 5 BAC74543.1 Non-secretory protein CDS SAVERM_6833 8156649 8157179 ruvC putative Holliday junction nuclease PF02075: Crossover junction endodeoxyribonuclease RuvC 10.05 18496 G2 DNA recombination 3.3 BAC74544.1 Non-secretory protein CDS SAVERM_6834 8157176 8157787 ruvA putative Holliday junction DNA helicase subunit B PF01330: RuvA N terminal domain 6.54 20910 G2 DNA recombination 3.3 BAC74545.1 Non-secretory protein CDS SAVERM_6835 8157959 8159029 ruvB putative Holliday junction DNA helicase subunit A PF05491: Holliday junction DNA helicase ruvB C-terminus 4.99 38176 G2 DNA recombination 3.3 BAC74546.1 Non-secretory protein CDS SAVERM_6836 8159193 8159696 yajC putative preprotein translocase YajC subunit PF02699: Preprotein translocase subunit 4.17 17719 G2 protein secretion 1.6 BAC74547.1 Signal peptide CDS SAVERM_6837 8159839 8161593 secD putative preprotein translocase SecD subunit PF02355: Protein export membrane protein 10.24 60508 G2 protein secretion 1.6 BAC74548.1 Non-secretory protein CDS SAVERM_6838 8161595 8162701 secF putative preprotein translocase SecF subunit PF02355: Protein export membrane protein 9.73 39249 G2 protein secretion 1.6 BAC74549.1 Non-secretory protein CDS SAVERM_6839 8162698 8163246 apt putative adenine phosphoribosyltransferase PF00156: Phosphoribosyl transferase domain 4.49 18895 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74550.1 Non-secretory protein CDS SAVERM_6840 8164005 8166542 relA ppGpp synthetase PF04607: Region found in RelA / SpoT proteins 9.81 93742 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74551.1 Non-secretory protein CDS SAVERM_6841 8167906 8166677 hypothetical protein PF03993: Domain of Unknown Function (DUF349) 6.46 46107 G2 similar to unknown proteins 5 BAC74552.1 Non-secretory protein CDS SAVERM_6842 8168875 8168042 ppiB putative peptidyl-prolyl cis-trans isomerase, secreted PF00160: Cyclophilin type peptidyl-prolyl cis-trans isomerase 10.59 29419 G2 protein modification 3.8 BAC74553.1 Non-secretory protein CDS SAVERM_6843 8169042 8169749 putative hydrolase PF00753: Metallo-beta-lactamase superfamily 5.02 24427 G2 miscellaneous 4.7 BAC74554.1 Non-secretory protein CDS SAVERM_6844 8169763 8171025 hisS putative histidyl-tRNA synthetase PF00587: tRNA synthetase class II core domain (G, H, P, S and T) 4.92 45754 G2 aminoacyl-tRNA-synthetase 3.7.2 BAC74555.1 Non-secretory protein CDS SAVERM_6845 8171593 8172231 putative integral membrane protein PF07884: Vitamin K epoxide reductase family 9.09 23758 G2 miscellaneous 4.7 BAC74556.1 Non-secretory protein CDS SAVERM_6846 8172295 8173656 putative ATP/GTP-binding protein PF00004: ATPase family associated with various cellular activities (AAA) 6.52 48710 G2 miscellaneous 4.7 BAC74557.1 Non-secretory protein CDS SAVERM_6847 8173971 8174585 rpsD putative ribosomal protein S4 PF01479: S4 domain 10.68 23552 G2 ribosomal protein 3.7.1 BAC74558.1 Signal peptide CDS SAVERM_6848 8174761 8175216 putative secreted protein PF05962: Bacterial protein of unknown function (DUF886) 11.63 15990 G2 miscellaneous 4.7 BAC74559.1 Non-secretory protein CDS SAVERM_6849 8175224 8175574 putative secreted protein Tat substrate 9.58 12994 G2 miscellaneous 4.7 BAC74560.1 Non-secretory protein CDS SAVERM_6850 8175574 8178246 alaS putative alanyl-tRNA synthetase PF01411: tRNA synthetases class II (A) 4.93 96256 G2 aminoacyl-tRNA-synthetase 3.7.2 BAC74561.1 Non-secretory protein CDS SAVERM_6851 8178256 8178726 putative Holliday junction resolvase PF03652: Uncharacterised protein family (UPF0081) 10.2 16494 G2 similar to unknown proteins 5 BAC74562.1 Non-secretory protein CDS SAVERM_6852 8178852 8180669 pabC2 putative aminodeoxychorismate lyase PF02618: Aminodeoxychorismate lyase, a pyridoxal 5'-phosphate-dependent enzyme that converts 4-aminodeoxychorismate to pyruvate and p-aminobenzoate 5.05 66092 G2 metabolism of amino acids & related molecules 2.2 BAC74563.1 Non-secretory protein CDS SAVERM_6853 8180666 8181502 aroE1 putative shikimate 5-dehydrogenase EC:1.1.1.25, PF08501: Shikimate dehydrogenase substrate binding domain 4.72 29550 G2 metabolism of amino acids & related molecules 2.2 BAC74564.1 Non-secretory protein CDS SAVERM_6854 8181892 8183076 aroC putative chorismate synthase EC:4.2.3.5, PF01264: Chorismate synthase 6.59 41643 G2 metabolism of amino acids & related molecules 2.2 BAC74565.1 Non-secretory protein CDS SAVERM_6855 8183073 8183588 aroK putative shikimate kinase EC:2.7.1.71, PF01202: Shikimate kinase 5.09 18390 G2 metabolism of amino acids & related molecules 2.2 BAC74566.1 Non-secretory protein CDS SAVERM_6856 8183585 8184676 aroB putative 3-dehydroquinate synthase EC:4.2.3.4, PF01761: 3-dehydroquinate synthase 5.28 38408 G2 metabolism of amino acids & related molecules 2.2 BAC74567.1 Non-secretory protein CDS SAVERM_6857 8184843 8185733 hypothetical protein PF07931: Chloramphenicol phosphotransferase-like protein 7.58 30919 G2 similar to unknown proteins 5 BAC74568.1 Non-secretory protein CDS SAVERM_6858 8185869 8186975 putative peptidase PF00557: metallopeptidase family M24 5.09 38938 G2 protein modification 3.8 BAC74569.1 Non-secretory protein CDS SAVERM_6859 8187035 8187601 efp putative elongation factor P PF01132: Elongation factor P (EF-P) 4.88 20621 G2 elongation 3.7.4 BAC74570.1 Non-secretory protein CDS SAVERM_6860 8187604 8188038 nusB putative transcription termination protein PF01029: NusB family 5.03 16475 G2 DNA termination 3.5.4 BAC74571.1 Non-secretory protein CDS SAVERM_6861 8189332 8188808 bldD putative DNA-binding protein PF01381: Helix-turn-helix 7.75 19068 G2 regulation 3.5.2 BAC74572.1 Non-secretory protein CDS SAVERM_6862 8189574 8190152 pyrR putative pyrimidine operon regulatory protein PF00156: Phosphoribosyl transferase domain 6.29 21048 G2 regulation 3.5.2 BAC74573.1 Non-secretory protein CDS SAVERM_6863 8190239 8191216 pyrB putative aspartate carbamoyltransferase PF02729: Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 7.08 35587 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74574.1 Non-secretory protein CDS SAVERM_6864 8191222 8192508 pyrC putative dihydroorotase PF01979: Amidohydrolase family 5.09 45138 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74575.1 Non-secretory protein CDS SAVERM_6865 8192505 8193125 hypothetical protein 7.09 22405 G2 similar to unknown proteins 5 BAC74576.1 Non-secretory protein CDS SAVERM_6866 8193122 8194264 carA putative carbamoyl-phosphate synthase small subunit pyrAA, PF00988: Carbamoyl-phosphate synthase small chain, CPSase domain 6.65 40839 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74577.1 Non-secretory protein CDS SAVERM_6867 8194257 8197565 carB putative carbamoyl-phosphate synthase large subunit pyrAB, PF02786: Carbamoyl-phosphate synthase L chain, ATP binding domain 4.58 117894 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74578.1 Non-secretory protein CDS SAVERM_6868 8197641 8198747 pyrD putative dihydroorotate dehydrogenase PF01180: Dihydroorotate dehydrogenase 10.04 39880 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74579.1 Non-secretory protein CDS SAVERM_6869 8198744 8199586 pyrF putative orotidine 5’-phosphate decarboxylase PF00215: Orotidine 5'-phosphate decarboxylase / HUMPS family 4.78 28932 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74580.1 Non-secretory protein CDS SAVERM_6870 8199842 8200165 putative nucleoid-binding protein PF00416: Ribosomal protein S13/S18 11.15 11539 G2 miscellaneous 4.7 BAC74581.1 Non-secretory protein CDS SAVERM_6871 8200203 8200796 gmk putative guanylate kinase PF00625: Guanylate kinase 4.89 21816 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74582.1 Non-secretory protein CDS SAVERM_6872 8200837 8201109 rpoZ RNA polymerase omega subunit PF01192: RNA polymerase Rpb6 4.38 9735 G2 RNA initiation 3.5.1 BAC74583.1 Non-secretory protein CDS SAVERM_6873 8201233 8202450 dfp putative phosphopantothenoylcysteine decarboxylase coaBC, PF02441: Flavoprotein 6.43 42593 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74584.1 Non-secretory protein CDS SAVERM_6874 8202691 8203899 metK putative S-adenosylmethionine synthetase PF02773: S-adenosylmethionine synthetase, C-terminal domain 4.7 43488 G2 metabolism of amino acids & related molecules 2.2 BAC74585.1 Non-secretory protein CDS SAVERM_6875 8204328 8206490 priA putative primosomal protein PF07754: Domain of unknown function (DUF1610) 9.32 75426 G2 DNA replication 3.1 BAC74586.1 Non-secretory protein CDS SAVERM_6876 8207225 8206683 hypothetical protein PF00440: Bacterial regulatory proteins, tetR family 11.71 19186 G2 similar to unknown proteins 5 BAC74587.1 Non-secretory protein CDS SAVERM_6877 8207585 8208517 fmt putative methionyl-tRNA formyltransferase PF00551: Formyl transferase 6.05 32763 G2 initiation 3.7.3 BAC74588.1 Non-secretory protein CDS SAVERM_6878 8209360 8210790 sun putative RNA-binding Sun protein PF01189: NOL1/NOP2/sun family 6.71 51031 G2 RNA modification 3.6 BAC74589.1 Non-secretory protein CDS SAVERM_6879 8212927 8210771 putative membrane protein similar to actII-3, PF03176: MMPL family 7.47 74551 G2 miscellaneous 4.7 BAC74590.1 Non-secretory protein CDS SAVERM_6880 8213111 8213797 rpe putative ribulose-phosphate 3-epimerase PF00834: Ribulose-phosphate 3 epimerase family 4.44 24307 G2 main glycolytic pathways 2.1.2 BAC74591.1 Non-secretory protein CDS SAVERM_6881 8213876 8214919 putative transcriptional regulator PF04198: Putative sugar-binding domain 4.8 36888 G2 regulation 3.5.2 BAC74592.1 Non-secretory protein CDS SAVERM_6882 8214961 8215368 putative guanyl-specific ribonuclease Sa3 precursor (RNase Sa3) PF00545: ribonuclease 10.25 14917 G2 RNA modification 3.6 BAC74593.1 Signal peptide CDS SAVERM_6883 8215365 8215742 hypothetical protein PF01337: Barstar (barnase inhibitor) 4.21 13218 G2 similar to unknown proteins 5 BAC74594.1 Non-secretory protein CDS SAVERM_6884 8215841 8217292 guaB3 putative inosine-5’-monophosphate dehydrogenase PF00478: IMP dehydrogenase / GMP reductase domain 5.68 51249 G2 metabolism of nucleotides & nucleic acids 2.3 BAC74595.1 Non-secretory protein CDS SAVERM_6885 8217379 8217879 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 5.72 17907 G2 miscellaneous 4.7 BAC74596.1 Non-secretory protein CDS SAVERM_6886 8218131 8219609 putative amino acid permease PF00324: Amino acid permease 9.29 51273 G2 transport / binding proteins & lipoproteins 1.2 BAC74597.1 Non-secretory protein CDS SAVERM_6887 8219620 8220072 putative AsnC-family transcriptional regulator PF01037: AsnC family 5.83 16637 G2 regulation 3.5.2 BAC74598.1 Non-secretory protein CDS SAVERM_6888 8220266 8220069 hypothetical protein PF07702: UTRA domain 12.09 6936 G2 no similarity 6 BAC74599.1 Non-secretory protein CDS SAVERM_6889 8220462 8222939 putative sensor-like histidine kinase incomplete multi-component regulatory system (cvnA) 6.73 90130 G2 sensors 1.3 BAC74600.1 Non-secretory protein CDS SAVERM_6890 8222929 8223468 hypothetical protein incomplete multi-component regulatory system (cvnB), PF03259: Roadblock/LC7 domain 6.42 19293 G2 similar to unknown proteins 5 BAC74601.1 Non-secretory protein CDS SAVERM_6891 8223476 8223853 hypothetical protein incomplete multi-component regulatory system (cvnC), PF05331: Protein of unknown function (DUF742) 4.98 13984 G2 similar to unknown proteins 5 BAC74602.1 Non-secretory protein CDS SAVERM_6892 8224288 8225076 putative hydrolase PF00795: Carbon-nitrogen hydrolase 4.6 27920 G2 miscellaneous 4.7 BAC74603.1 Non-secretory protein CDS SAVERM_6893 8225124 8226821 putative amino oxidase PF01593: Flavin containing amine oxidoreductase 4.69 63234 G2 miscellaneous 4.7 BAC74604.1 Non-secretory protein CDS SAVERM_6894 8227766 8226837 hypothetical protein PF00296: Luciferase-like monooxygenase 5.09 32718 G2 similar to unknown proteins 5 BAC74605.1 Non-secretory protein CDS SAVERM_6895 8228544 8227870 hypothetical protein 4.55 24851 G2 similar to unknown proteins 5 BAC74606.1 Non-secretory protein CDS SAVERM_6896 8228717 8229829 celA5 putative endo-1,4-beta-glucanase, secreted PF01341: Glycosyl hydrolases family 6 6.15 37979 G2 specific pathways 2.1.1 BAC74607.1 Signal peptide CDS SAVERM_6897 8231250 8229811 pyrP putative uracil permease PF00860: Permease family 7.32 49547 G2 transport / binding proteins & lipoproteins 1.2 BAC74608.1 Non-secretory protein CDS SAVERM_6898 8231372 8232637 putative secreted protein PF05426: Alginate lyase 7.08 46034 G2 similar to unknown proteins 5 BAC74609.1 Signal peptide CDS SAVERM_6899 8232735 8233205 hypothetical protein PF03061: Thioesterase superfamily 5.63 17168 G2 similar to unknown proteins 5 BAC74610.1 Non-secretory protein CDS SAVERM_6900 8234376 8233165 putative integral membrane transport protein PF07690: Major Facilitator Superfamily 9.28 40871 G2 transport / binding proteins & lipoproteins 1.2 BAC74611.1 Non-secretory protein CDS SAVERM_6901 8234502 8235689 putative ROK-family transcriptional regulator PF00480: ROK family 5.7 40288 G2 regulation 3.5.2 BAC74612.1 Non-secretory protein CDS SAVERM_6902 8236486 8237094 ribC putative riboflavin synthase alpha subunit PF00677: Lumazine binding domain 4.54 21533 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74613.1 Non-secretory protein CDS SAVERM_6903 8237091 8237735 putative integral membrane protein PF04973: Nicotinamide mononucleotide transporter 9.61 23347 G2 miscellaneous 4.7 BAC74614.1 Non-secretory protein CDS SAVERM_6904 8237732 8239021 ribA1 putative GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase (dhbp synthase) PF00926: 3,4-dihydroxy-2-butanone 4-phosphate synthase 4.98 46388 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74615.1 Non-secretory protein CDS SAVERM_6905 8239041 8239526 ribH putative 6,7-dimethyl-8-ribityllumazine synthase PF00885: 6,7-dimethyl-8-ribityllumazine synthase 4.79 16809 G2 metabolism of coenzymes & prosthetic groups 2.5 BAC74616.1 Non-secretory protein CDS SAVERM_6906 8239561 8239833 hisE putative phosphoribosyl-ATP pyrophosphatase EC:3.6.1.31, PF01503: Phosphoribosyl-ATP pyrophosphohydrolase 4.86 9877 G2 metabolism of amino acids & related molecules 2.2 BAC74617.1 Non-secretory protein CDS SAVERM_6907 8239883 8240740 hisG putative ATP phosphoribosyltransferase EC:2.4.2.17, PF01634: ATP phosphoribosyltransferase 4.97 30694 G2 metabolism of amino acids & related molecules 2.2 BAC74618.1 Non-secretory protein CDS SAVERM_6908 8240755 8241219 putative membrane protein PF10756: Bacterial PH domain 8.55 16526 G2 miscellaneous 4.7 BAC74619.1 Non-secretory protein CDS SAVERM_6909 8241446 8242867 putative integral membrane protein PF01595: Domain of unknown function DUF21, PF03471: Transporter associated domain, PF00571: CBS domain 4.63 49957 T miscellaneous 4.7 BAC74620.1 Non-secretory protein CDS SAVERM_6910 8242864 8243958 putative integral membrane protein PF01595: Domain of unknown function DUF21 4.54 39276 T miscellaneous 4.7 BAC74621.1 Non-secretory protein CDS SAVERM_6911 8245867 8244005 putative ATPase PF00004: ATPase family associated with various cellular activities (AAA) 4.9 68252 T miscellaneous 4.7 BAC74622.1 Non-secretory protein CDS SAVERM_6912 8246952 8246299 hypothetical protein PF00485: Phosphoribulokinase / Uridine kinase family 7.02 23888 T similar to unknown proteins 5 BAC74623.1 Non-secretory protein CDS SAVERM_6913 8247166 8248164 hypothetical protein 6.79 36612 T similar to unknown proteins 5 BAC74624.1 Non-secretory protein CDS SAVERM_6914 8248213 8249763 putative amino acid permease PF00324: Amino acid permease 9.89 55530 T transport / binding proteins & lipoproteins 1.2 BAC74625.1 Non-secretory protein CDS SAVERM_6915 8249962 8251314 putative secreted protein Tat substrate, PF13529: Peptidase_C39 like family 9.08 48336 T similar to unknown proteins 5 BAC74626.1 Signal peptide CDS SAVERM_6916 8251453 8251593 hypothetical protein 9.53 4859 T similar to unknown proteins 5 BAC74627.1 Non-secretory protein CDS SAVERM_6917 8251721 8252380 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 9.2 24114 T regulation 3.5.2 BAC74628.1 Non-secretory protein CDS SAVERM_6918 8253716 8252433 chiC2 putative chitinase C precursor, secreted PF00704: Glycosyl hydrolases family 18 8.77 44736 T specific pathways 2.1.1 BAC74629.1 Signal peptide CDS SAVERM_6919 8254072 8255244 fadE2 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 4.94 41374 T metabolism of lipids 2.4 BAC74630.1 Non-secretory protein CDS SAVERM_6920 8256748 8256320 hypothetical protein 4.25 15638 T similar to unknown proteins 5 BAC74631.1 Non-secretory protein CDS SAVERM_6921 8256960 8257457 putative AsnC-family transcriptional regulator PF01037: AsnC family 5.73 17914 T regulation 3.5.2 BAC74632.1 Non-secretory protein CDS SAVERM_6922 8257505 8259127 hypothetical protein PF07969: Amidohydrolase family 4.91 55947 T similar to unknown proteins 5 BAC74633.1 Non-secretory protein CDS SAVERM_6923 8259737 8260534 putative glycosyltransferase PF00535: Glycosyl transferase 6.06 28869 T specific pathways 2.1.1 BAC74634.1 Non-secretory protein CDS SAVERM_6924 8260622 8261194 putative membrane protein PF04186: FxsA cytoplasmic membrane protein 11.81 20621 T miscellaneous 4.7 BAC74635.1 Non-secretory protein CDS SAVERM_6925 8261746 8261372 rbpA RNA polymerase-binding protein PF13397: Domain of unknown function (DUF4109) 5.34 14123 T similar to unknown proteins 5 BAC74636.1 Non-secretory protein CDS SAVERM_6926 8263360 8262014 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.6 47876 T transport / binding proteins & lipoproteins 1.2 BAC74637.1 Non-secretory protein CDS SAVERM_6927 8264168 8263401 glpQ4 putative glycerophosphoryl diester phosphodiesterase F03009: Glycerophosphoryl diester phosphodiesterase family 7.96 28239 T metabolism of lipids 2.4 BAC74638.1 Non-secretory protein CDS SAVERM_6928 8264931 8266430 putative GntR-family transcriptional regulator similar to PdxR involved in regulation of pyridoxal phosphate 6.4 52934 T regulation 3.5.2 BAC74640.1 Non-secretory protein CDS SAVERM_6929 8264932 8264165 putative membrane protein PF02588: Uncharacterized BCR, YitT family COG1284 12.1 26142 T miscellaneous 4.7 BAC74639.1 Non-secretory protein CDS SAVERM_6930 8268115 8266448 putative membrane protein PF01580: FtsK/SpoIIIE family 6.46 59201 T miscellaneous 4.7 BAC74641.1 Non-secretory protein CDS SAVERM_6931 8268347 8268153 hypothetical protein 10.14 6597 T similar to unknown proteins 5 BAC74642.1 Non-secretory protein CDS SAVERM_6932 8268640 8269044 putative ankyrin-like protein PF00023: Ankyrin repeat 4.53 14124 T miscellaneous 4.7 BAC74643.1 Non-secretory protein CDS SAVERM_6933 8269346 8270764 hypothetical protein 4.79 50795 T similar to unknown proteins 5 BAC74644.1 Non-secretory protein CDS SAVERM_6934 8270944 8272107 putative glycosyltransferase PF00534: Glycosyl transferases group 1 9.73 40338 T specific pathways 2.1.1 BAC74645.1 Non-secretory protein CDS SAVERM_6935 8272104 8273312 putative glycosyltransferase PF00534: Glycosyl transferases group 1 10.57 42966 T specific pathways 2.1.1 BAC74646.1 Non-secretory protein CDS SAVERM_6936 8273309 8274163 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 7.02 30093 T similar to unknown proteins 5 BAC74647.1 Non-secretory protein CDS SAVERM_6937 8275037 8274168 kipA putative antagonist of KipI PF02626: Allophanate hydrolase subunit 2 10.86 29379 T sporulation 1.8 BAC74648.1 Non-secretory protein CDS SAVERM_6938 8275651 8275034 kipI putative inhibitor of KinA PF02682: Allophanate hydrolase subunit 1 6.27 21727 T sporulation 1.8 BAC74649.1 Non-secretory protein CDS SAVERM_6939 8276400 8275648 putative lactam utilization protein PF03746: LamB/YcsF family 5.7 26376 T detoxification 4.2 BAC74650.1 Non-secretory protein CDS SAVERM_6940 8277237 8276413 hypothetical protein PF07286: Protein of unknown function (DUF1445) 6.03 30030 T similar to unknown proteins 5 BAC74651.1 Non-secretory protein CDS SAVERM_6941 8278553 8277234 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.55 45882 T transport / binding proteins & lipoproteins 1.2 BAC74652.1 Non-secretory protein CDS SAVERM_6942 8278809 8279510 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 5.69 26025 T regulation 3.5.2 BAC74653.1 Non-secretory protein CDS SAVERM_6943 8279643 8281160 hypothetical protein 4.63 55057 T similar to unknown proteins 5 BAC74654.1 Non-secretory protein CDS SAVERM_6944 8281255 8282133 hypothetical protein 4.44 31075 T similar to unknown proteins 5 BAC74655.1 Non-secretory protein CDS SAVERM_6945 8282203 8286903 hypothetical protein PF01576: Myosin tail 5.1 168186 T similar to unknown proteins 5 BAC74656.1 Non-secretory protein CDS SAVERM_6946 8288540 8286990 putative choline oxidase PF00732: GMC oxidoreductase 5.25 56447 T miscellaneous 4.7 BAC74657.1 Non-secretory protein CDS SAVERM_6947 8290212 8288644 putative amino acid permease PF00324: Amino acid permease 9.39 55795 T transport / binding proteins & lipoproteins 1.2 BAC74658.1 Non-secretory protein CDS SAVERM_6948 8291832 8290309 gbsA3 putative glycine betaine aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 4.95 54599 T adaptation to atypical conditions 4.1 BAC74659.1 Non-secretory protein CDS SAVERM_6949 8292944 8291796 putative ring-hydroxylating dioxygenase PF00355: Rieske [2Fe-2S] domain 4.99 42890 T miscellaneous 4.7 BAC74660.1 Non-secretory protein CDS SAVERM_6950 8294110 8292956 soxA putative sarcosine oxidase PF01266: FAD dependent oxidoreductase 6.51 42166 T detoxification 4.2 BAC74661.1 Non-secretory protein CDS SAVERM_6951 8296576 8294120 putative sarcosine dehydrogenase PF01571: Glycine cleavage T-protein (aminomethyl transferase) 5.96 89770 T detoxification 4.2 BAC74662.1 Non-secretory protein CDS SAVERM_6952 8297249 8296623 blaB4 putative metallo-beta-lactamase PF00753: Metallo-beta-lactamase superfamily 5.2 22017 T detoxification 4.2 BAC74663.1 Non-secretory protein CDS SAVERM_6953 8298337 8297246 adhA10 putative alcohol dehydrogenase PF00107: Zinc-binding dehydrogenase 4.86 38052 T specific pathways 2.1.1 BAC74664.1 Non-secretory protein CDS SAVERM_6954 8299448 8298618 putative IclR-family transcriptional regulator PF01614: Bacterial transcriptional regulator 7.67 29276 T regulation 3.5.2 BAC74665.1 Non-secretory protein CDS SAVERM_6955 8299712 8300032 hcaC2 putative ferredoxin subunit of phenylpropionate dioxygenase PF00355: Rieske [2Fe-2S] domain 4.39 11403 T miscellaneous 4.7 BAC74666.1 Non-secretory protein CDS SAVERM_6956 8300184 8301425 fprF putative NAD(P)H-ferredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 6.95 42883 T membrane bioenergetics 1.4 BAC74667.1 Non-secretory protein CDS SAVERM_6957 8302188 8301571 putative membrane protein 12.05 22313 T miscellaneous 4.7 BAC74668.1 Non-secretory protein CDS SAVERM_6958 8302609 8305449 cvnA11 putative sensor-like histidine kinase multi-component regulatory system-11, Tat substrate 7.51 103441 T sensors 1.3 BAC74669.1 Signal peptide CDS SAVERM_6959 8305446 8305886 cvnB11 hypothetical protein multi-component regulatory system-11, PF03259: Roadblock/LC7 domain 4.72 14923 T similar to unknown proteins 5 BAC74670.1 Non-secretory protein CDS SAVERM_6960 8305896 8306291 cvnC11 hypothetical protein multi-component regulatory system-11, PF05331: Protein of unknown function (DUF742) 4.55 14203 T similar to unknown proteins 5 BAC74671.1 Non-secretory protein CDS SAVERM_6961 8306316 8309930 putative hydantoinase/oxoprolinase PF02538: Hydantoinase B/oxoprolinase 4.87 128868 T miscellaneous 4.7 BAC74672.1 Non-secretory protein CDS SAVERM_6962 8309911 8310516 cvnD11 putative ATP/GTP-binding protein multi-component regulatory system-11 4.62 22265 T miscellaneous 4.7 BAC74673.1 Non-secretory protein CDS SAVERM_6963 8312169 8310646 glpK2 putative glycerol kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 5.47 55047 T specific pathways 2.1.1 BAC74674.1 Non-secretory protein CDS SAVERM_6964 8312937 8312188 glpF2 putative glycerol uptake facilitator protein PF00230: Major intrinsic protein 6.79 25616 T transport / binding proteins & lipoproteins 1.2 BAC74675.1 Non-secretory protein CDS SAVERM_6965 8314969 8313344 hypothetical protein PF00563: EAL domain 6.02 56064 T similar to unknown proteins 5 BAC74676.1 Non-secretory protein CDS SAVERM_6966 8316286 8315096 hypothetical protein PF00108: Thiolase, N-terminal domain 5.28 41240 T similar to unknown proteins 5 BAC74677.1 Non-secretory protein CDS SAVERM_6967 8316729 8316283 hypothetical protein PF01796: Domain of unknown function DUF35 4.9 16033 T similar to unknown proteins 5 BAC74678.1 Non-secretory protein CDS SAVERM_6968 8316959 8317495 putative MutT-like protein PF00293: NUDIX domain 6.5 19129 T miscellaneous 4.7 BAC74679.1 Non-secretory protein CDS SAVERM_6969 8319901 8317535 putative glycosyl hydrolase PF01055: Glycosyl hydrolases family 31 7.58 85674 T miscellaneous 4.7 BAC74680.1 Non-secretory protein CDS SAVERM_6970 8320115 8322082 acsA2 putative acetoacetyl-CoA synthetase PF00501: AMP-binding enzyme 5.2 72011 T specific pathways 2.1.1 BAC74681.1 Non-secretory protein CDS SAVERM_6971 8323402 8322083 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 8.28 46630 T regulation 3.5.2 BAC74682.1 Non-secretory protein CDS SAVERM_6972 8323448 8324722 putative membrane transport protein PF07690: Major Facilitator Superfamily 10.82 43493 T transport / binding proteins & lipoproteins 1.2 BAC74683.1 Non-secretory protein CDS SAVERM_6973 8324745 8325638 hypothetical protein 4.61 32028 T similar to unknown proteins 5 BAC74684.1 Non-secretory protein CDS SAVERM_6974 8327396 8325726 ptsP putative phosphoenolpyruvate-protein phosphotransferase PF02896: PEP-utilising enzyme, TIM barrel domain 4.38 57425 T transport / binding proteins & lipoproteins 1.2 BAC74685.1 Non-secretory protein CDS SAVERM_6975 8327922 8327473 ptsA putative phosphoenolpyruvate-dependent sugar phosphotransferase PF00358: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 4.19 15238 T transport / binding proteins & lipoproteins 1.2 BAC74686.1 Non-secretory protein CDS SAVERM_6976 8333915 8334523 pgsA3 putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase PF01066: CDP-alcohol phosphatidyltransferase 9.98 22535 D metabolism of lipids 2.4 BAC74687.1 Non-secretory protein CDS SAVERM_6977 8334639 8337134 mpg3 putative mannose-1-phosphate guanyltransferase PF00483: Nucleotidyl transferase 4.72 89753 D main glycolytic pathways 2.1.2 BAC74688.1 Non-secretory protein CDS SAVERM_6978 8337225 8338130 hypothetical protein PF05949: Bacterial protein of unknown function (DUF881) 7.67 31314 D similar to unknown proteins 5 BAC74689.1 Non-secretory protein CDS SAVERM_6979 8338127 8338459 putative membrane protein PF06947: Protein of unknown function (DUF1290) 9.25 11380 D miscellaneous 4.7 BAC74690.1 Non-secretory protein CDS SAVERM_6980 8338456 8339331 hypothetical protein PF05949: Bacterial protein of unknown function (DUF881) 4.84 31437 D similar to unknown proteins 5 BAC74691.1 Non-secretory protein CDS SAVERM_6981 8339393 8340367 hypothetical protein PF00498: FHA domain 6.51 33859 D similar to unknown proteins 5 BAC74692.1 Non-secretory protein CDS SAVERM_6982 8340386 8341141 putative MerR family regulatory protein PF00376: MerR family regulatory protein 5.42 27324 D regulation 3.5.2 BAC74693.1 Non-secretory protein CDS SAVERM_6983 8341228 8341701 hypothetical protein PF02577: Uncharacterised ACR, COG1259 3.88 17074 D similar to unknown proteins 5 BAC74694.1 Non-secretory protein CDS SAVERM_6984 8341986 8342621 hypothetical protein 6.8 22634 D similar to unknown proteins 5 BAC74695.1 Non-secretory protein CDS SAVERM_6985 8342842 8344551 dinB putative DNA polymerase IV, DNA damage inducible protein PF00817: impB/mucB/samB family 5.15 58673 D DNA modification & repair 3.2 BAC74696.1 Non-secretory protein CDS SAVERM_6986 8344895 8344473 hypothetical protein PF05239: PRC-barrel domain 4.46 15405 D similar to unknown proteins 5 BAC74697.1 Non-secretory protein CDS SAVERM_6987 8345154 8348117 gcvP putative glycine dehydrogenase PF02347: Glycine cleavage system P-protein 4.87 105151 D metabolism of amino acids & related molecules 2.2 BAC74698.1 Non-secretory protein CDS SAVERM_6988 8348494 8348288 hypothetical protein 5.42 7376 D similar to unknown proteins 5 BAC74699.1 Non-secretory protein CDS SAVERM_6989 8349466 8348882 hypothetical protein 9.21 20591 D similar to unknown proteins 5 BAC74700.1 Non-secretory protein CDS SAVERM_6990 8349837 8351522 putative secreted protein PF04107: Glutamate-cysteine ligase family 2(GCS2) 6.58 62350 D similar to unknown proteins 5 BAC74701.1 Signal peptide CDS SAVERM_6991 8353501 8351630 hypothetical protein PF00092: von Willebrand factor type A domain 9.34 66316 D similar to unknown proteins 5 BAC74702.1 Non-secretory protein CDS SAVERM_6992 8353578 8354378 hypothetical protein PF02517: CAAX amino terminal protease family 10.12 28251 D similar to unknown proteins 5 BAC74703.1 Non-secretory protein CDS SAVERM_6993 8355186 8354368 phzC putative phenazine biosynthesis protein PF02567: Phenazine biosynthesis-like protein 4.73 29144 D miscellaneous 4.7 BAC74704.1 Non-secretory protein CDS SAVERM_6994 8355594 8356247 putative PadR-like family transcriptional regulator PF03551: Transcriptional regulator PadR-like family 8.9 23009 D regulation 3.5.2 BAC74705.1 Non-secretory protein CDS SAVERM_6995 8356829 8356323 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 7.7 18108 D similar to unknown proteins 5 BAC74706.1 Non-secretory protein CDS SAVERM_6996 8356906 8357658 hypothetical protein PF02861: Clp amino terminal domain 10.6 27113 D similar to unknown proteins 5 BAC74707.1 Non-secretory protein CDS SAVERM_6997 8357775 8358782 putative membrane protein PF00892: Integral membrane protein DUF6 9.04 33900 D miscellaneous 4.7 BAC74708.1 Non-secretory protein CDS SAVERM_6998 8359004 8359996 putative secreted protein PF00892: Integral membrane protein DUF6 10.45 32868 D similar to unknown proteins 5 BAC74709.1 Non-secretory protein CDS SAVERM_6999 8361089 8360388 hypothetical protein 5.93 25017 D similar to unknown proteins 5 BAC74710.1 Non-secretory protein CDS SAVERM_7000 8361113 8362444 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 6.53 46349 D regulation 3.5.2 BAC74711.1 Non-secretory protein CDS SAVERM_7001 8363381 8362446 hypothetical protein PF00892: Integral membrane protein DUF6 11.93 32592 D similar to unknown proteins 5 BAC74712.1 Non-secretory protein CDS SAVERM_7002 8363460 8364359 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 7.07 32127 D regulation 3.5.2 BAC74713.1 Non-secretory protein CDS SAVERM_7003 8364973 8364506 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 6.79 17623 D similar to unknown proteins 5 BAC74714.1 Non-secretory protein CDS SAVERM_7004 8365030 8365752 hypothetical protein PF00857: Isochorismatase family 10.36 25530 D similar to unknown proteins 5 BAC74715.1 Non-secretory protein CDS SAVERM_7005 8366324 8365833 putative iron-sulfur protein Tat substrate, PF00355: Rieske [2Fe-2S] domain 6.23 15598 D miscellaneous 4.7 BAC74716.1 Signal peptide CDS SAVERM_7006 8366488 8367243 hypothetical protein 4.57 27064 D similar to unknown proteins 5 BAC74717.1 Non-secretory protein CDS SAVERM_7007 8367240 8367623 hypothetical protein PF11236: Protein of unknown function (DUF3037) 5.94 13755 D similar to unknown proteins 5 BAC74718.1 Non-secretory protein CDS SAVERM_7008 8367774 8368535 fabG8 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 5.33 25860 D metabolism of lipids 2.4 BAC74719.1 Non-secretory protein CDS SAVERM_7009 8368553 8369314 putative dehydrogenase PF00106: short chain dehydrogenase 5.32 25990 D miscellaneous 4.7 BAC74720.1 Non-secretory protein CDS SAVERM_7010 8369462 8371084 oppA11 putative peptide ABC transporter substrate-binding protein PF00496: Bacterial extracellular solute-binding proteins, family 5 Middle 6.56 59528 D transport / binding proteins & lipoproteins 1.2 BAC74721.1 Non-secretory protein CDS SAVERM_7011 8371165 8371848 ung2 putative uracil-DNA glycosylase PF03167: Uracil DNA glycosylase superfamily 5.97 25284 D DNA modification & repair 3.2 BAC74722.1 Non-secretory protein CDS SAVERM_7012 8371980 8372630 hypothetical protein PF07721: Tetratricopeptide repeat 4.61 22741 D similar to unknown proteins 5 BAC74723.1 Non-secretory protein CDS SAVERM_7013 8373465 8373001 putative lipoprotein 9.82 16011 D transport / binding proteins & lipoproteins 1.2 BAC74724.1 Signal peptide CDS SAVERM_7014 8374100 8373588 hypothetical protein PF04978: Protein of unknown function (DUF664) 4.46 19427 D similar to unknown proteins 5 BAC74725.1 Non-secretory protein CDS SAVERM_7015 8374210 8375115 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 6.86 32837 D miscellaneous 4.7 BAC74726.1 Non-secretory protein CDS SAVERM_7016 8376613 8375039 putative apolipoprotein N-acyltransferase PF00795: Carbon-nitrogen hydrolase 10.28 56411 D metabolism of lipids 2.4 BAC74727.1 Non-secretory protein CDS SAVERM_7017 8377169 8376702 hypothetical protein 4.86 17423 D similar to unknown proteins 5 BAC74728.1 Non-secretory protein CDS SAVERM_7018 8377344 8378360 putative monooxygenase PF00296: Luciferase-like monooxygenase 5.2 36362 D miscellaneous 4.7 BAC74729.1 Non-secretory protein CDS SAVERM_7019 8379291 8378431 putative secreted protein PF03631: Ribonuclease BN-like family 11.14 31190 D similar to unknown proteins 5 BAC74730.1 Non-secretory protein CDS SAVERM_7020 8380042 8379743 hypothetical protein 11.44 10626 D no similarity 6 BAC74731.1 Non-secretory protein CDS SAVERM_7021 8381448 8380573 bacA2 putative undecaprenyl-diphosphatase uppP2, PF02673: Bacitracin resistance protein BacA 9.69 31149 D miscellaneous 4.7 BAC74732.1 Non-secretory protein CDS SAVERM_7022 8381768 8383210 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 5.82 50728 D miscellaneous 4.7 BAC74733.1 Signal peptide CDS SAVERM_7023 8383207 8384142 hypothetical protein 5.75 34603 D similar to unknown proteins 5 BAC74734.1 Non-secretory protein CDS SAVERM_7024 8384136 8384900 hypothetical protein PF07883: Cupin domain 4.94 26803 D no similarity 6 BAC74735.1 Non-secretory protein CDS SAVERM_7025 8385447 8384977 putative transcriptional regulator PF01638: Transcriptional regulator 6.66 17382 D regulation 3.5.2 BAC74736.1 Non-secretory protein CDS SAVERM_7026 8385638 8386807 fadA6 putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase PF00108: Thiolase, N-terminal domain 5.6 40869 D metabolism of lipids 2.4 BAC74737.1 Non-secretory protein CDS SAVERM_7027 8387621 8386812 hypothetical protein PF00597: DedA family 12.33 27522 D similar to unknown proteins 5 BAC74738.1 Non-secretory protein CDS SAVERM_7028 8388106 8389278 tufA2 putative elongation factor EF-Tu PF00009: Elongation factor Tu GTP binding domain 5.15 41403 D elongation 3.7.4 BAC74739.1 Non-secretory protein CDS SAVERM_7029 8389436 8390281 hypothetical protein 5.02 29825 D similar to unknown proteins 5 BAC74740.1 Non-secretory protein CDS SAVERM_7030 8391586 8390243 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10.09 45663 D transport / binding proteins & lipoproteins 1.2 BAC74741.1 Non-secretory protein CDS SAVERM_7031 8392808 8391768 hypothetical protein 4.83 36241 D similar to unknown proteins 5 BAC74742.1 Non-secretory protein CDS SAVERM_7032 8393843 8392875 putative membrane protein 5.02 33781 D miscellaneous 4.7 BAC74743.1 Non-secretory protein CDS SAVERM_7033 8393930 8394367 hypothetical protein 5.14 15089 D similar to unknown proteins 5 BAC74744.1 Non-secretory protein CDS SAVERM_7034 8394994 8394449 putative secreted protein PF05257: CHAP domain 9.88 19585 D similar to unknown proteins 5 BAC74745.1 Signal peptide CDS SAVERM_7035 8396659 8395028 putative sodium:solute symporter PF00474: Sodium:solute symporter family 8.58 56446 D transport / binding proteins & lipoproteins 1.2 BAC74746.1 Non-secretory protein CDS SAVERM_7036 8397066 8396656 hypothetical protein PF04341: Protein of unknown function, DUF485 12.27 15204 D similar to unknown proteins 5 BAC74747.1 Non-secretory protein CDS SAVERM_7037 8397699 8398349 putative integral membrane protein PF00597: DedA family 9.85 22992 D miscellaneous 4.7 BAC74748.1 Non-secretory protein CDS SAVERM_7038 8398889 8398353 putative siderophore binding protein PF00132: Bacterial transferase hexapeptide (three repeats) 5.84 18304 D transport / binding proteins & lipoproteins 1.2 BAC74749.1 Non-secretory protein CDS SAVERM_7039 8399056 8399820 putative sugar acetyltransferase PF00132: Bacterial transferase hexapeptide (three repeats) 6.95 27106 D miscellaneous 4.7 BAC74750.1 Non-secretory protein CDS SAVERM_7040 8400700 8399834 putative membrane protein PF00892: Integral membrane protein DUF6 11.61 28419 D miscellaneous 4.7 BAC74751.1 Non-secretory protein CDS SAVERM_7041 8400761 8401366 putative transcriptional regulatory protein PF01381: Helix-turn-helix 5.92 21632 D regulation 3.5.2 BAC74752.1 Non-secretory protein CDS SAVERM_7042 8401410 8401964 hypothetical protein PF04073: YbaK / prolyl-tRNA synthetases associated domain 5.72 19470 D similar to unknown proteins 5 BAC74753.1 Non-secretory protein CDS SAVERM_7043 8403195 8402020 putative cation efflux system protein PF01545: Cation efflux family 7.25 41330 D membrane bioenergetics 1.4 BAC74754.1 Non-secretory protein CDS SAVERM_7044 8403273 8403650 putative ArsR-family transcriptional regulator PF01022: Bacterial regulatory protein, arsR family 8.58 13534 D regulation 3.5.2 BAC74755.1 Non-secretory protein CDS SAVERM_7045 8404369 8403809 putative reductase PF03358: NADPH-dependent FMN reductase 4.41 19128 D miscellaneous 4.7 BAC74756.1 Signal peptide CDS SAVERM_7046 8404483 8405154 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.65 24217 D regulation 3.5.2 BAC74757.1 Non-secretory protein CDS SAVERM_7047 8405182 8405733 hypothetical protein PF04978: Protein of unknown function (DUF664) 5.08 20229 D similar to unknown proteins 5 BAC74758.1 Non-secretory protein CDS SAVERM_7048 8405794 8406909 putative cation efflux system protein PF01545: Cation efflux family 6.36 39081 D membrane bioenergetics 1.4 BAC74759.1 Non-secretory protein CDS SAVERM_7049 8407501 8407094 hypothetical protein PF02629: CoA binding domain 4.93 14724 D similar to unknown proteins 5 BAC74760.1 Non-secretory protein CDS SAVERM_7050 8407591 8408403 hypothetical protein 5.79 28576 D similar to unknown proteins 5 BAC74761.1 Non-secretory protein CDS SAVERM_7051 8408400 8408948 hypothetical protein PF00300: Phosphoglycerate mutase family 7.78 19353 D similar to unknown proteins 5 BAC74762.1 Non-secretory protein CDS SAVERM_7052 8410972 8408996 putative amino acid transporter PF00324: Amino acid permease 6.72 71272 D similar to unknown proteins 5 BAC74763.1 Non-secretory protein CDS SAVERM_7053 8411271 8411897 hypothetical protein PF01205: Uncharacterized protein family UPF0029 6.02 22176 D similar to unknown proteins 5 BAC74764.1 Non-secretory protein CDS SAVERM_7054 8412224 8413720 putative ATP-dependent RNA helicase PF00270: DEAD/DEAH box helicase 11.34 52999 D RNA modification 3.6 BAC74765.1 Non-secretory protein CDS SAVERM_7055 8413967 8415130 sbcD putative ATP-dependent dsDNA exonuclease PF00149: Calcineurin-like phosphoesterase 5.17 41648 D DNA recombination 3.3 BAC74766.1 Non-secretory protein CDS SAVERM_7056 8415198 8418197 sbcC putative ATP-dependent dsDNA exonuclease PF02463: RecF/RecN/SMC N terminal domain 6.07 108017 D DNA recombination 3.3 BAC74767.1 Non-secretory protein CDS SAVERM_7057 8418662 8418216 putative AsnC-family transcriptional regulator PF01037: AsnC family 7.67 16192 D regulation 3.5.2 BAC74768.1 Non-secretory protein CDS SAVERM_7058 8418709 8419395 hypothetical protein PF00581: Rhodanese-like domain 7.11 23987 D similar to unknown proteins 5 BAC74769.1 Non-secretory protein CDS SAVERM_7059 8419484 8419708 hypothetical protein 3.35 7408 D similar to unknown proteins 5 BAC74770.1 Non-secretory protein CDS SAVERM_7060 8421530 8419839 hypothetical protein PF05960: Bacterial protein of unknown function (DUF885) 4.6 62375 D similar to unknown proteins 5 BAC74771.1 Non-secretory protein CDS SAVERM_7061 8422057 8421593 putative AsnC-family transcriptional regulator PF01037: AsnC family 9.94 17191 D regulation 3.5.2 BAC74772.1 Non-secretory protein CDS SAVERM_7062 8422223 8423464 mgl putative methionine gamma lyase PF01053: Cys/Met metabolism PLP-dependent enzyme 6.19 43026 D metabolism of amino acids & related molecules 2.2 BAC74773.1 Non-secretory protein CDS SAVERM_7063 8425096 8423663 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6.35 50685 D similar to unknown proteins 5 BAC74774.1 Non-secretory protein CDS SAVERM_7064 8427034 8425448 phoD2 putative alkaline phosphatase, secreted Tat substrate, PF00245: Alkaline phosphatase 7.12 60208 D protein modification 3.8 BAC74775.1 Signal peptide CDS SAVERM_7065 8428776 8427289 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 9.71 51849 D regulation 3.5.2 BAC74776.1 Non-secretory protein CDS SAVERM_7066 8428851 8430017 putative integral membrane protein PF00892: Integral membrane protein DUF6 8.77 39451 D miscellaneous 4.7 BAC74777.1 Non-secretory protein CDS SAVERM_7067 8430656 8429733 putative hydrolase PF00561: alpha/beta hydrolase fold 10.59 32450 D miscellaneous 4.7 BAC74778.1 Non-secretory protein CDS SAVERM_7068 8430823 8431707 sig55 putative RNA polymerase ECF-subfamily sigma factor similar to SCO1263, PF04542: Sigma-70 region 2 5.56 32366 D RNA initiation 3.5.1 BAC74779.1 Non-secretory protein CDS SAVERM_7069 8431958 8432719 putative GntR-family transcriptional regulator PF00392: Bacterial regulatory proteins, gntR family 5.92 27274 D regulation 3.5.2 BAC74780.1 Non-secretory protein CDS SAVERM_7070 8434103 8432946 putative ROK-family transcriptional regulator PF00480: ROK family 6.69 40577 D regulation 3.5.2 BAC74781.1 Non-secretory protein CDS SAVERM_7071 8434865 8434203 putative two-component system response regulator PF00072: Response regulator receiver domain 4.99 23387 D regulation 3.5.2 BAC74782.1 Non-secretory protein CDS SAVERM_7072 8436058 8434880 putative two-component system sensor kinase PF07730: Histidine kinase 9.61 42124 D sensors 1.3 BAC74783.1 Non-secretory protein CDS SAVERM_7073 8436167 8437093 putative ABC transporter ATP-binding protein PF00005: ABC transporter 7.94 33229 D transport / binding proteins & lipoproteins 1.2 BAC74784.1 Non-secretory protein CDS SAVERM_7074 8437097 8437819 putative ABC transporter permease protein PF01061: ABC-2 type transporter 6.52 24496 D transport / binding proteins & lipoproteins 1.2 BAC74785.1 Non-secretory protein CDS SAVERM_7075 8437877 8438317 hypothetical protein 4.14 16207 D similar to unknown proteins 5 BAC74786.1 Non-secretory protein CDS SAVERM_7076 8438783 8438343 mug putative G/U mismatch-specific DNA glycosylase PF03167: Uracil DNA glycosylase superfamily 11.26 16088 D DNA modification & repair 3.2 BAC74787.1 Non-secretory protein CDS SAVERM_7077 8440327 8438888 purB putative adenylosuccinate lyase PF00206: Lyase 5.7 52017 D metabolism of nucleotides & nucleic acids 2.3 BAC74788.1 Non-secretory protein CDS SAVERM_7078 8440737 8440387 hypothetical protein 6.67 13012 D no similarity 6 BAC74789.1 Non-secretory protein CDS SAVERM_7079 8441541 8440759 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 7.13 28635 D similar to unknown proteins 5 BAC74790.1 Non-secretory protein CDS SAVERM_7080 8442852 8441839 putative integral membrane protein PF01595: Domain of unknown function DUF21 6.32 36556 D miscellaneous 4.7 BAC74791.1 Non-secretory protein CDS SAVERM_7081 8444195 8442849 putative integral membrane protein PF01595: Domain of unknown function DUF21 4.89 47439 D miscellaneous 4.7 BAC74792.1 Signal peptide CDS SAVERM_7082 8444769 8444344 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 9.27 15828 D miscellaneous 4.7 BAC74793.1 Non-secretory protein CDS SAVERM_7083 8445781 8444891 putative Rif11 homolog PF00296: Luciferase-like monooxygenase 5.25 32151 D miscellaneous 4.7 BAC74794.1 Non-secretory protein CDS SAVERM_7084 8448396 8445829 putative ABC transporter permease protein PF02687: Predicted permease 9.98 88650 D transport / binding proteins & lipoproteins 1.2 BAC74795.1 Signal peptide CDS SAVERM_7085 8449292 8448408 putative ABC transporter ATP-binding protein PF00005: ABC transporter 4.66 31029 D transport / binding proteins & lipoproteins 1.2 BAC74796.1 Non-secretory protein CDS SAVERM_7086 8449521 8449760 hypothetical protein PF05534: HicB family 4.91 9012 D similar to unknown proteins 5 BAC74797.1 Non-secretory protein CDS SAVERM_7087 8449765 8450139 hypothetical protein 5.13 13470 D similar to unknown proteins 5 BAC74798.1 Non-secretory protein CDS SAVERM_7088 8450842 8450156 hypothetical protein PF01209: ubiE/COQ5 methyltransferase family 10.23 24212 D similar to unknown proteins 5 BAC74799.1 Non-secretory protein CDS SAVERM_7089 8451641 8450955 lpsA1 putative secreted lipase Tat substrate, PF01674: Lipase (class 2) 4.5 24450 D metabolism of lipids 2.4 BAC74800.1 Signal peptide CDS SAVERM_7090 8451756 8453981 lpsR putative lpsA1 transcriptional activator PF00196: Bacterial regulatory proteins, luxR family 10.36 77989 D regulation 3.5.2 BAC74801.1 Non-secretory protein CDS SAVERM_7091 8454701 8453985 bioD putative dethiobiotin synthetase PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain 4.75 23768 D metabolism of coenzymes & prosthetic groups 2.5 BAC74802.1 Non-secretory protein CDS SAVERM_7092 8456016 8454703 bioA putative adenosylmethionine-8-amino-7-oxononanoate aminotransferase PF00202: Aminotransferase class-III 5.57 47280 D metabolism of coenzymes & prosthetic groups 2.5 BAC74803.1 Non-secretory protein CDS SAVERM_7093 8457151 8455985 bioB putative biotin synthase PF06968: Biotin and Thiamin Synthesis associated domain 4.84 41213 D metabolism of coenzymes & prosthetic groups 2.5 BAC74804.1 Non-secretory protein CDS SAVERM_7094 8457312 8458469 bioF putative 8-amino-7-oxononanoate synthase PF00155: Aminotransferase class I and II 6.79 39842 D metabolism of coenzymes & prosthetic groups 2.5 BAC74805.1 Non-secretory protein CDS SAVERM_7095 8458670 8458491 hypothetical protein PF04149: Domain of unknown function (DUF397) 4.67 5888 D no similarity 6 BAC74806.1 Non-secretory protein CDS SAVERM_7096 8459587 8458736 putative DNA-binding protein PF01381: Helix-turn-helix 7.1 31334 D regulation 3.5.2 BAC74807.1 Non-secretory protein CDS SAVERM_7097 8459835 8460293 putative regulatory protein PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.99 16355 D similar to unknown proteins 5 BAC74808.1 Non-secretory protein CDS SAVERM_7098 8461106 8460552 hypothetical protein 11.63 19648 D similar to unknown proteins 5 BAC74809.1 Non-secretory protein CDS SAVERM_7099 8461628 8461155 putative NLP/P60-family secreted protein (PgpA peptidase) Seems to have no N-terminal signal sequence, PF00877: NlpC/P60 family 11.24 16492 D miscellaneous 4.7 BAC74810.1 Signal peptide CDS SAVERM_7100 8462472 8462164 hypothetical protein 9.14 11110 D similar to unknown proteins 5 BAC74811.1 Non-secretory protein CDS SAVERM_7101 8463115 8462480 clpP3 putative ATP-dependent Clp protease proteolytic subunit 2 PF00574: Clp protease 5.29 22576 D adaptation to atypical conditions 4.1 BAC74812.1 Non-secretory protein CDS SAVERM_7102 8463350 8463625 hypothetical protein PF02604: Phd_YefM 6.53 9819 D similar to unknown proteins 5 BAC74813.1 Non-secretory protein CDS SAVERM_7103 8464059 8464340 hypothetical protein 12.68 9737 D no similarity 6 BAC74814.1 Non-secretory protein CDS SAVERM_7104 8464532 8464834 ureA putative urease gamma subunit PF00547: Urease gamma subunit 6.23 11092 D metabolism of amino acids & related molecules 2.2 BAC74815.1 Non-secretory protein CDS SAVERM_7105 8464852 8465163 ureB putative urease beta subunit PF00699: Urease beta subunit 5.08 10746 D metabolism of amino acids & related molecules 2.2 BAC74816.1 Non-secretory protein CDS SAVERM_7106 8465156 8466877 ureC1 putative urease alpha subunit PF01979: Amidohydrolase family 5.43 60539 D metabolism of amino acids & related molecules 2.2 BAC74817.1 Non-secretory protein CDS SAVERM_7107 8466877 8467551 ureF putative urease accessroy protein PF01730: UreF 7.15 22821 D metabolism of amino acids & related molecules 2.2 BAC74818.1 Non-secretory protein CDS SAVERM_7108 8467570 8468253 ureG putative urease accessory protein PF02492: CobW/HypB/UreG, nucleotide-binding domain 4.57 23785 D metabolism of amino acids & related molecules 2.2 BAC74819.1 Non-secretory protein CDS SAVERM_7109 8468250 8469008 ureD putative urease accessory protein PF01774: UreD urease accessory protein 6.81 25763 D metabolism of amino acids & related molecules 2.2 BAC74820.1 Non-secretory protein CDS SAVERM_7110 8469147 8470742 putative tripeptidylaminopeptidase, secreted Tat substrate, PF08386: TAP-like protein 8.8 57363 D protein modification 3.8 BAC74821.1 Signal peptide CDS SAVERM_7111 8471538 8470813 plsC6 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 10.21 26465 D metabolism of lipids 2.4 BAC74822.1 Non-secretory protein CDS SAVERM_7112 8472865 8471639 rocD2 putative ornithine aminotransferase PF00202: Aminotransferase class-III 5.16 43036 D metabolism of amino acids & related molecules 2.2 BAC74823.1 Non-secretory protein CDS SAVERM_7113 8473731 8472862 hypothetical protein PF02274: Amidinotransferase 6.91 32182 D similar to unknown proteins 5 BAC74824.1 Non-secretory protein CDS SAVERM_7114 8474311 8473808 putative AsnC-family transcriptional regulator PF01037: AsnC family 6.68 18150 D regulation 3.5.2 BAC74825.1 Non-secretory protein CDS SAVERM_7115 8474389 8475144 putative regulatory protein PF04397: LytTr DNA-binding domain 6.38 27970 D regulation 3.5.2 BAC74826.1 Non-secretory protein CDS SAVERM_7116 8475158 8475517 putative membrane protein 11.33 13851 D miscellaneous 4.7 BAC74827.1 Non-secretory protein CDS SAVERM_7117 8475522 8477249 putative transmembrane transport protein PF00474: Sodium:solute symporter family 10.12 58881 D transport / binding proteins & lipoproteins 1.2 BAC74828.1 Non-secretory protein CDS SAVERM_7118 8477246 8478451 lytS putative two-component system sensor kinase PF07730: Histidine kinase 6.33 43581 D sensors 1.3 BAC74829.1 Non-secretory protein CDS SAVERM_7119 8479382 8478645 hypothetical protein 7.44 25514 D no similarity 6 BAC74830.1 Non-secretory protein CDS SAVERM_7120 8480910 8478832 pkn31 putative serine/threonine protein kinase PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase 11.9 72296 D protein modification 3.8 BAC74831.1 Non-secretory protein CDS SAVERM_7121 8482384 8480924 putative secreted protein PF04554: Extensin-like region 8.14 49551 D similar to unknown proteins 5 BAC74832.1 Non-secretory protein CDS SAVERM_7122 8483448 8482495 hypothetical protein PF09678: Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG) 8.64 35081 D similar to unknown proteins 5 BAC74833.1 Non-secretory protein CDS SAVERM_7123 8484576 8483551 pfkA3 6-phosphofructokinase PF00365: Phosphofructokinase 6.1 36425 D main glycolytic pathways 2.1.2 BAC74834.1 Non-secretory protein CDS SAVERM_7124 8485494 8484766 cobQ2 putative glutamine amidotransferase PF07685: CobB/CobQ-like glutamine amidotransferase domain 5.34 26159 D miscellaneous 4.7 BAC74835.1 Non-secretory protein CDS SAVERM_7125 8486755 8485517 putative ligase PF01225: Mur ligase family, catalytic domain 7.08 43738 D miscellaneous 4.7 BAC74836.1 Non-secretory protein CDS SAVERM_7126 8486898 8487458 def2 putative polypeptide deformylase PF01327: Polypeptide deformylase 6.41 20511 D metabolism of amino acids & related molecules 2.2 BAC74837.1 Non-secretory protein CDS SAVERM_7127 8488284 8487586 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.68 25319 D regulation 3.5.2 BAC74838.1 Non-secretory protein CDS SAVERM_7128 8488405 8489634 fadE6 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.1 44319 D metabolism of lipids 2.4 BAC74839.1 Non-secretory protein CDS SAVERM_7129 8490198 8489671 hypothetical protein PF00190: Cupin 6.74 19424 D similar to unknown proteins 5 BAC74840.1 Non-secretory protein CDS SAVERM_7130 8491421 8490207 cyp25 cytochrome P450 hydroxylase CYP158A3, adjacent to rpp 6.2 44278 D metabolism of coenzymes & prosthetic groups 2.5 BAC74841.1 Non-secretory protein CDS SAVERM_7131 8492484 8491426 rppA type III polyketide synthase PhlD homolog, PF02797: Chalcone and stilbene synthases, C-terminal domain 5.22 38310 D antibiotic production 4.3 BAC74842.1 Non-secretory protein CDS SAVERM_7132 8492643 8493359 hypothetical protein PF03070: TENA/THI-4/PQQC family 4.34 25823 D similar to unknown proteins 5 BAC74843.1 Non-secretory protein CDS SAVERM_7133 8493614 8493375 hypothetical protein 4.47 8341 D similar to unknown proteins 5 BAC74844.1 Non-secretory protein CDS SAVERM_7134 8495034 8493640 gabD2 putative succinate-semialdehyde dehydrogenase, NADP-dependent PF00171: Aldehyde dehydrogenase family 4.81 50150 D metabolism of amino acids & related molecules 2.2 BAC74845.1 Non-secretory protein CDS SAVERM_7135 8495572 8495108 putative MutT-like protein PF00293: NUDIX domain 4.63 16882 D miscellaneous 4.7 BAC74846.1 Non-secretory protein CDS SAVERM_7136 8497107 8495569 ligB putative DNA ligase PF01068: ATP dependent DNA ligase domain 6.7 54366 D DNA replication 3.1 BAC74847.1 Non-secretory protein CDS SAVERM_7137 8498126 8497137 putative reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 4.82 34734 D miscellaneous 4.7 BAC74848.1 Non-secretory protein CDS SAVERM_7138 8498183 8498803 putative regulatory protein PF01381: Helix-turn-helix 6.64 22882 D regulation 3.5.2 BAC74849.1 Non-secretory protein CDS SAVERM_7139 8498823 8499866 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 7.64 36299 D miscellaneous 4.7 BAC74850.1 Non-secretory protein CDS SAVERM_7140 8499863 8501044 fadE16 putative acyl-CoA dehydrogenase PF02770: Acyl-CoA dehydrogenase, middle domain 4.98 43622 D metabolism of lipids 2.4 BAC74851.1 Non-secretory protein CDS SAVERM_7141 8501023 8502153 fadE21 putative acyl-CoA dehydrogenase PF00441: Acyl-CoA dehydrogenase, C-terminal domain 5.14 39074 D metabolism of lipids 2.4 BAC74852.1 Non-secretory protein CDS SAVERM_7142 8502328 8503188 putative secreted protein Tat substrate 9.53 31541 D miscellaneous 4.7 BAC74853.1 Signal peptide CDS SAVERM_7143 8503291 8503485 putative secreted protein 8.26 6684 D similar to unknown proteins 5 BAC74854.1 Non-secretory protein CDS SAVERM_7144 8504754 8503525 putative secreted protein 7.22 41438 D miscellaneous 4.7 BAC74855.1 Signal peptide CDS SAVERM_7145 8505198 8504830 hypothetical protein PF05610: Protein of unknown function (DUF779) 4.58 13319 D similar to unknown proteins 5 BAC74856.1 Non-secretory protein CDS SAVERM_7146 8506025 8505258 putative GntR-family transcriptional regulator PF07702: UTRA domain 9.3 27884 D regulation 3.5.2 BAC74857.1 Non-secretory protein CDS SAVERM_7147 8507988 8506099 iolD2 myo-inositol catabolism protein IolD (hydratase) myo-inositol metabolism, PF00205: Thiamine pyrophosphate enzyme, central domain 5.48 67139 D specific pathways 2.1.1 BAC74858.1 Non-secretory protein CDS SAVERM_7148 8508901 8507996 iolB2 myo-inositol catabolism protein IolB (isomerase) myo-inositol metabolism, PF06845: Myo-inositol catabolism protein IolB 5.48 32056 D specific pathways 2.1.1 BAC74859.1 Non-secretory protein CDS SAVERM_7149 8509809 8508931 hypothetical protein PF01791: DeoC/LacD family aldolase 4.96 30942 D similar to unknown proteins 5 BAC74860.1 Non-secretory protein CDS SAVERM_7150 8510791 8509835 iolC2 putative 5-dehydro-2-deoxygluconokinase myo-inositol metabolism, PF00294: pfkB family carbohydrate kinase 4.52 34185 D specific pathways 2.1.1 BAC74861.1 Non-secretory protein CDS SAVERM_7151 8511099 8512118 iolTA myo-inositol ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 9.52 35200 D transport / binding proteins & lipoproteins 1.2 BAC74862.1 Signal peptide CDS SAVERM_7152 8512124 8513197 iolTB myo-inositol ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.83 37419 D transport / binding proteins & lipoproteins 1.2 BAC74863.1 Non-secretory protein CDS SAVERM_7153 8513207 8514118 iolTC myo-inositol ABC transporter ATP-binding protein PF00005: ABC transporter 5.75 32272 D transport / binding proteins & lipoproteins 1.2 BAC74864.1 Non-secretory protein CDS SAVERM_7154 8514120 8515022 iolE2 scyllo-inosose dehydratase myo-inositol metabolism, PF06960: Myo-inositol catabolism protein N-terminus 4.71 33262 D specific pathways 2.1.1 BAC74865.1 Non-secretory protein CDS SAVERM_7155 8516435 8515251 putative oxidoreductase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 6.12 42133 D miscellaneous 4.7 BAC74866.1 Non-secretory protein CDS SAVERM_7156 8516580 8517596 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 7.44 36287 D regulation 3.5.2 BAC74867.1 Non-secretory protein CDS SAVERM_7157 8517907 8518266 hypothetical protein PF01740: STAS domain 5.16 13274 D similar to unknown proteins 5 BAC74868.1 Non-secretory protein CDS SAVERM_7158 8518263 8519195 prsR putative regulator of sigma factor PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.37 33066 D RNA initiation 3.5.1 BAC74869.1 Non-secretory protein CDS SAVERM_7159 8520771 8519323 gabD3 putative succinate-semialdehyde dehydrogenase, NADP-dependent PF00171: Aldehyde dehydrogenase family 4.79 51091 D metabolism of amino acids & related molecules 2.2 BAC74870.1 Non-secretory protein CDS SAVERM_7160 8522489 8521230 putative aminotransferase PF00202: Aminotransferase class-III 5.59 43984 D miscellaneous 4.7 BAC74871.1 Non-secretory protein CDS SAVERM_7161 8522760 8524415 putative regulatory protein nrps4 gene cluster, PF02954: Bacterial regulatory protein, Fis family 7.08 61036 D regulation 3.5.2 BAC74872.1 Non-secretory protein CDS SAVERM_7162 8525567 8524485 cysK3 putative cysteine synthase nrps4 gene cluster 6.29 39586 D metabolism of amino acids & related molecules 2.2 BAC74873.1 Non-secretory protein CDS SAVERM_7163 8526826 8525756 arcB4 putative ornithine cyclodeaminase nrps4 gene cluster, PF02423: Ornithine cyclodeaminase/mu-crystallin family 6.07 38254 D metabolism of amino acids & related molecules 2.2 BAC74874.1 Non-secretory protein CDS SAVERM_7164 8527794 8526823 putative SyrP-like protein nrps4 gene cluster 4.59 35504 D antibiotic production 4.3 BAC74875.1 Non-secretory protein CDS SAVERM_7165 8530697 8527980 nrps4 putative non-ribosomal peptide synthetase nrps4 gene cluster 9.12 99394 D antibiotic production 4.3 BAC74876.1 Non-secretory protein CDS SAVERM_7166 8531505 8533463 putative amidase, secreted PF01510: N-acetylmuramoyl-L-alanine amidase 6.37 70715 D miscellaneous 4.7 BAC74877.1 Signal peptide CDS SAVERM_7167 8534830 8534240 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.13 20699 D regulation 3.5.2 BAC74878.1 Non-secretory protein CDS SAVERM_7168 8534873 8535412 hypothetical protein PF01361: Tautomerase enzyme 5.26 19293 D no similarity 6 BAC74879.1 Non-secretory protein CDS SAVERM_7169 8535405 8536415 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 4.85 35836 D miscellaneous 4.7 BAC74880.1 Non-secretory protein CDS SAVERM_7170 8536960 8537487 putative secreted protein 10.5 18715 D similar to unknown proteins 5 BAC74881.1 Signal peptide CDS SAVERM_7171 8538272 8537697 putative secreted protein 4.33 20370 D no similarity 6 BAC74882.1 Signal peptide CDS SAVERM_7172 8540762 8538378 prpJ7 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.19 85099 D protein modification 3.8 BAC74883.1 Non-secretory protein CDS SAVERM_7173 8541622 8541942 hypothetical protein 10.06 11193 D no similarity 6 BAC74884.1 Non-secretory protein CDS SAVERM_7174 8542083 8542616 putative secreted protein 4.24 19510 D similar to unknown proteins 5 BAC74885.1 Signal peptide CDS SAVERM_7175 8542870 8542664 hypothetical protein 11.96 7357 D similar to unknown proteins 5 BAC74886.1 Non-secretory protein CDS SAVERM_7176 8543524 8543264 hypothetical protein 10.98 9307 D no similarity 6 BAC74887.1 Non-secretory protein CDS SAVERM_7177 8545357 8543834 thcA putative aldehyde dehydrogenase PF00171: Aldehyde dehydrogenase family 5.13 55486 D specific pathways 2.1.1 BAC74888.1 Non-secretory protein CDS SAVERM_7178 8546770 8545481 putative transcriptional regulator PF00486: Transcriptional regulatory protein, C terminal 7.16 45650 D regulation 3.5.2 BAC74889.1 Non-secretory protein CDS SAVERM_7179 8547479 8546880 ampD2 putative N-acetylmuramoyl-L-alanine amidase, secreted Tat substrate, PF01510: N-acetylmuramoyl-L-alanine amidase 6.51 22188 D phage-related functions 4.4 BAC74890.1 Signal peptide CDS SAVERM_7180 8549299 8548061 xylR xylose operon regulator PF00480: ROK family 6.1 42500 D regulation 3.5.2 BAC74891.1 Non-secretory protein CDS SAVERM_7181 8550782 8549337 xylB1 xylulose kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 4.92 49960 D specific pathways 2.1.1 BAC74892.1 Non-secretory protein CDS SAVERM_7182 8550993 8552159 xylA xylose isomerase PF01261: Xylose isomerase-like TIM barrel 4.86 42833 D specific pathways 2.1.1 BAC74893.1 Non-secretory protein CDS SAVERM_7183 8552704 8553312 hypothetical protein PF04886: PT repeat 7.29 20748 D similar to unknown proteins 5 BAC74894.1 Non-secretory protein CDS SAVERM_7184 8558155 8553602 pks4 putative modular polyketide synthase pks4 gene cluster 4.92 164169 D antibiotic production 4.3 BAC74895.1 Non-secretory protein CDS SAVERM_7185 8560301 8559018 putative UDP-glucose:sterol glucosyltransferase pks4 gene cluster, PF03033: Glycosyltransferase family 28 N-terminal domain 4.82 46051 D specific pathways 2.1.1 BAC74896.1 Non-secretory protein CDS SAVERM_7186 8561604 8560411 cyp26 cytochrome P450 hydroxylase CYP105R1, pks4 gene cluster 5.9 44066 D metabolism of coenzymes & prosthetic groups 2.5 BAC74897.1 Non-secretory protein CDS SAVERM_7187 8561754 8563319 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 9.62 53599 D transport / binding proteins & lipoproteins 1.2 BAC74898.1 Non-secretory protein CDS SAVERM_7188 8564472 8563465 iolG2 myo-inositol 2-dehydrogenase PF01408: Oxidoreductase family, NAD-binding Rossmann fold 4.97 35009 D specific pathways 2.1.1 BAC74899.1 Non-secretory protein CDS SAVERM_7189 8565325 8564504 putative dehydrogenase PF00106: short chain dehydrogenase 5.58 28333 D miscellaneous 4.7 BAC74900.1 Non-secretory protein CDS SAVERM_7190 8566514 8565339 putative Fe(II)/alpha-ketoglutarate dependent hydroxylase PF05721: Phytanoyl-CoA dioxygenase (PhyH) 5.22 42404 D specific pathways 2.1.1 BAC74901.1 Non-secretory protein CDS SAVERM_7191 8566612 8567661 putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 8.72 38011 D regulation 3.5.2 BAC74902.1 Non-secretory protein CDS SAVERM_7192 8567815 8568180 hypothetical protein 3.95 12763 D similar to unknown proteins 5 BAC74903.1 Non-secretory protein CDS SAVERM_7193 8569554 8568544 ppx3 putative exopolyphosphatase PF02541: Ppx/GppA phosphatase family 11.14 36213 D miscellaneous 4.7 BAC74904.1 Non-secretory protein CDS SAVERM_7194 8569752 8570417 putative methyltransferase PF01170: Putative RNA methylase family UPF0020 10.46 23430 D miscellaneous 4.7 BAC74905.1 Non-secretory protein CDS SAVERM_7195 8570401 8570610 hypothetical protein PF09360: Iron-binding zinc finger CDGSH type 9.61 7882 D similar to unknown proteins 5 BAC74906.1 Non-secretory protein CDS SAVERM_7196 8570607 8571629 hypothetical protein 4.85 37769 D similar to unknown proteins 5 BAC74907.1 Non-secretory protein CDS SAVERM_7197 8571613 8572494 rdh putative ribitol dehydrogenase PF00106: short chain dehydrogenase 4.55 31337 D specific pathways 2.1.1 BAC74908.1 Non-secretory protein CDS SAVERM_7198 8573436 8572537 putative hydrolase PF00561: alpha/beta hydrolase fold 6.72 32012 D miscellaneous 4.7 BAC74909.1 Non-secretory protein CDS SAVERM_7199 8573497 8573883 putative transcriptional regulator PF01638: Transcriptional regulator 11.03 14484 D regulation 3.5.2 BAC74910.1 Non-secretory protein CDS SAVERM_7200 8574316 8575161 glpF3 putative glycerol uptake facilitator protein PF00230: Major intrinsic protein 9.26 29417 D transport / binding proteins & lipoproteins 1.2 BAC74911.1 Non-secretory protein CDS SAVERM_7201 8575186 8576703 glpK3 putative glycerol kinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 4.73 55290 D specific pathways 2.1.1 BAC74912.1 Non-secretory protein CDS SAVERM_7202 8577666 8577139 hypothetical protein 5.92 19105 D similar to unknown proteins 5 BAC74913.1 Non-secretory protein CDS SAVERM_7203 8577945 8579495 hypothetical protein PF00266: Aminotransferase class-V 6.93 54416 D similar to unknown proteins 5 BAC74914.1 Non-secretory protein CDS SAVERM_7204 8579581 8581101 putative secreted protein 9.56 52817 D similar to unknown proteins 5 BAC74915.1 Signal peptide CDS SAVERM_7205 8582018 8581221 thiD putative phosphomethylpyrimidine kinase PF02110: Hydroxyethylthiazole kinase family 6.42 27134 D metabolism of coenzymes & prosthetic groups 2.5 BAC74916.1 Non-secretory protein CDS SAVERM_7206 8583430 8582015 putative cytosine/uracil/thiamine/allantoin permease PF02133: Permease for cytosine/purines, uracil, thiamine, allantoin 8.1 49222 D transport / binding proteins & lipoproteins 1.2 BAC74917.1 Non-secretory protein CDS SAVERM_7207 8584947 8583610 putative secreted protein Tat substrate, PF03372: Endonuclease/Exonuclease/phosphatase family 4.96 46679 D similar to unknown proteins 5 BAC74918.1 Signal peptide CDS SAVERM_7208 8585756 8586712 gltK3 putative polar amino acid ABC transporter substrate-binding protein PF00528: Binding-protein-dependent transport system inner membrane component 10.31 34816 D transport / binding proteins & lipoproteins 1.2 BAC74919.1 Non-secretory protein CDS SAVERM_7209 8586709 8587494 gltL3 putative polar amino acid ABC transporter ATP-binding protein PF00005: ABC transporter 8.04 28424 D transport / binding proteins & lipoproteins 1.2 BAC74920.1 Non-secretory protein CDS SAVERM_7210 8587567 8588592 gltI3 putative polar amino acid ABC transporter substrate-binding protein PF00497: Bacterial extracellular solute-binding proteins, family 3 9.68 35752 D transport / binding proteins & lipoproteins 1.2 BAC74921.1 Signal peptide CDS SAVERM_7211 8588620 8589378 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 8.13 26835 D miscellaneous 4.7 BAC74922.1 Non-secretory protein CDS SAVERM_7212 8589594 8590856 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 6.16 45667 D miscellaneous 4.7 BAC74923.1 Non-secretory protein CDS SAVERM_7213 8590876 8592252 putative FMNH2-utilizing oxygenase PF00296: Luciferase-like monooxygenase 5.13 50525 D miscellaneous 4.7 BAC74924.1 Non-secretory protein CDS SAVERM_7214 8594708 8592489 icdA isocitrate dehydrogenase PF03971: Monomeric isocitrate dehydrogenase 4.65 79489 D TCA cycle 2.1.3 BAC74925.1 Non-secretory protein CDS SAVERM_7215 8596465 8595290 putative integral membrane protein PF00924: Mechanosensitive ion channel 9.75 41769 D miscellaneous 4.7 BAC74926.1 Non-secretory protein CDS SAVERM_7216 8597558 8596791 echA15 putative enoyl-CoA hydratase/isomerase family protein PF00378: Enoyl-CoA hydratase/isomerase family 5.82 26807 D metabolism of lipids 2.4 BAC74927.1 Non-secretory protein CDS SAVERM_7217 8598521 8597655 putative membrane protein PF03706: Uncharacterised protein family (UPF0104) 12.17 29154 D miscellaneous 4.7 BAC74928.1 Non-secretory protein CDS SAVERM_7218 8598813 8600720 putative ABC transporter ATP-binding protein PF00005: ABC transporter 9.64 67842 D transport / binding proteins & lipoproteins 1.2 BAC74929.1 Non-secretory protein CDS SAVERM_7219 8601038 8603263 pbp12 putative penicillin-binding protein PF00912: Transglycosylase 10.11 79996 D cell wall 1.1 BAC74930.1 Non-secretory protein CDS SAVERM_7220 8603412 8604638 putative secreted protein 5.5 45689 D similar to unknown proteins 5 BAC74931.1 Signal peptide CDS SAVERM_7221 8604802 8605935 putative secreted protein Tat substrate 9.9 40618 D similar to unknown proteins 5 BAC74932.1 Signal peptide CDS SAVERM_7222 8606063 8607682 hypothetical protein PF09660: Protein of unknown function (CHP02677) 5.32 58695 D similar to unknown proteins 5 BAC74933.1 Non-secretory protein CDS SAVERM_7223 8607682 8609019 hypothetical protein PF09661: Protein of unknown function (CHP02678) 5.5 48150 D similar to unknown proteins 5 BAC74934.1 Non-secretory protein CDS SAVERM_7224 8609016 8613215 hypothetical protein PF01576: Myosin tail 6.11 153518 D similar to unknown proteins 5 BAC74935.1 Non-secretory protein CDS SAVERM_7225 8613212 8614549 hypothetical protein PF09664: Protein of unknown function (CHP02679) 6.66 48121 D similar to unknown proteins 5 BAC74936.1 Non-secretory protein CDS SAVERM_7226 8615825 8614617 putative dehydrogenase PF00106: short chain dehydrogenase 6.71 41837 D miscellaneous 4.7 BAC74937.1 Non-secretory protein CDS SAVERM_7227 8616415 8616951 hypothetical protein 7.79 19236 D no similarity 6 BAC74938.1 Non-secretory protein CDS SAVERM_7228 8619310 8616956 putative secreted protein PF05976: Bacterial membrane protein of unknown function (DUF893) 10.42 82944 D similar to unknown proteins 5 BAC74939.1 Signal peptide CDS SAVERM_7229 8620614 8619439 putative glutathione-independent formaldehyde dehydrogenase PF00107: Zinc-binding dehydrogenase 5.14 42003 D specific pathways 2.1.1 BAC74940.1 Non-secretory protein CDS SAVERM_7230 8622373 8620952 hypothetical protein 8.36 50948 D similar to unknown proteins 5 BAC74941.1 Non-secretory protein CDS SAVERM_7231 8623439 8622783 pfpI2 putative intracellular protease/amidase PF01965: DJ-1/PfpI family 5.64 23344 D adaptation to atypical conditions 4.1 BAC74942.1 Non-secretory protein CDS SAVERM_7232 8624419 8623814 hypothetical protein PF09123: Domain of unknown function (DUF1931) 6.29 22575 D similar to unknown proteins 5 BAC74943.1 Non-secretory protein CDS SAVERM_7233 8625548 8624703 putative oxidoreductase PF00248: Aldo/keto reductase family 4.32 30469 D miscellaneous 4.7 BAC74944.1 Non-secretory protein CDS SAVERM_7234 8626844 8625651 putative multidrug efflux protein PF07690: Major Facilitator Superfamily 9.54 40404 D transport / binding proteins & lipoproteins 1.2 BAC74945.1 Non-secretory protein CDS SAVERM_7235 8627105 8627995 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 6.85 31287 D regulation 3.5.2 BAC74946.1 Non-secretory protein CDS SAVERM_7236 8629918 8628137 hypothetical protein PF05651: Putative sugar diacid recognition 7.41 65682 D similar to unknown proteins 5 BAC74947.1 Non-secretory protein CDS SAVERM_7237 8630200 8632101 dnaK2 putative heat shock protein Hsp70 PF00012: Hsp70 protein 4.44 67574 D protein folding 3.9 BAC74948.1 Non-secretory protein CDS SAVERM_7238 8632110 8632721 grpE2 putative GrpE homologue PF01025: GrpE 4.64 21885 D adaptation to atypical conditions 4.1 BAC74949.1 Non-secretory protein CDS SAVERM_7239 8632728 8633681 dnaJ2 putative heat shock protein DnaJ PF01556: DnaJ C terminal region 6.55 34180 D adaptation to atypical conditions 4.1 BAC74950.1 Non-secretory protein CDS SAVERM_7240 8633678 8634085 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 11.59 14304 D regulation 3.5.2 BAC74951.1 Non-secretory protein CDS SAVERM_7241 8634076 8636715 clpB2 putative ATP-dependent Clp protease PF07724: ATPase family associated with various cellular activities (AAA) 5 98274 D protein folding 3.9 BAC74952.1 Non-secretory protein CDS SAVERM_7242 8636703 8637158 trxA2 putative thioredoxin PF00085: Thioredoxin 7.05 16367 D membrane bioenergetics 1.4 BAC74953.1 Non-secretory protein CDS SAVERM_7243 8637391 8639241 trxB2 putative thioredoxin reductase PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.98 66023 D membrane bioenergetics 1.4 BAC74954.1 Non-secretory protein CDS SAVERM_7244 8639255 8639617 hypothetical protein PF00011: Hsp20/alpha crystallin family 9.28 12504 D similar to unknown proteins 5 BAC74955.1 Non-secretory protein CDS SAVERM_7245 8640232 8640651 panD putative L-aspartate 1-decarboxylase PF02261: Aspartate decarboxylase 5.5 14704 D metabolism of coenzymes & prosthetic groups 2.5 BAC74956.1 Non-secretory protein CDS SAVERM_7246 8640688 8641032 hypothetical protein 5.17 12376 D similar to unknown proteins 5 BAC74957.1 Non-secretory protein CDS SAVERM_7247 8641002 8641742 hypothetical protein PF01177: Asp/Glu/Hydantoin racemase 6.15 24625 D similar to unknown proteins 5 BAC74958.1 Non-secretory protein CDS SAVERM_7248 8641813 8642034 hypothetical protein 3.86 7204 D similar to unknown proteins 5 BAC74959.1 Non-secretory protein CDS SAVERM_7249 8643586 8642147 gnd3 putative 6-phosphogluconate dehydrogenase PF00393: 6-phosphogluconate dehydrogenase, C-terminal domain 4.81 51697 D main glycolytic pathways 2.1.2 BAC74960.1 Non-secretory protein CDS SAVERM_7250 8643887 8645080 putative zoocin A (secreted peptidase) PF01551: Peptidase family M23 10.04 41506 D protein modification 3.8 BAC74961.1 Signal peptide CDS SAVERM_7251 8646197 8645070 putative secreted protein PF05653: Protein of unknown function (DUF803) 7.7 37926 D similar to unknown proteins 5 BAC74962.1 Signal peptide CDS SAVERM_7252 8646408 8647133 fhuF1 putative ferric iron reductase PF06276: Ferric iron reductase protein FhuF 7.84 26189 D similar to unknown proteins 5 BAC74963.1 Non-secretory protein CDS SAVERM_7253 8647207 8648358 glgA putative glycosyltransferase PF00534: Glycosyl transferases group 1 5.82 41562 D specific pathways 2.1.1 BAC74964.1 Non-secretory protein CDS SAVERM_7254 8648395 8649615 glgC putative glucose-1-phosphate adenylyltransferase PF00483: Nucleotidyl transferase 6.35 43477 D specific pathways 2.1.1 BAC74965.1 Non-secretory protein CDS SAVERM_7255 8649736 8652069 putative glycosyl hydrolase, secreted PF07971: Glycosyl hydrolase family 92 5.75 84841 D miscellaneous 4.7 BAC74966.1 Signal peptide CDS SAVERM_7256 8652210 8653553 tgs putative triacylglycerol synthase PF03007: Uncharacterised protein family (UPF0089) 10.46 47420 D metabolism of lipids 2.4 BAC74967.1 Non-secretory protein CDS SAVERM_7257 8653701 8655185 putative dehydrogenase PF00106: short chain dehydrogenase 5.25 52986 D miscellaneous 4.7 BAC74968.1 Non-secretory protein CDS SAVERM_7258 8655203 8655514 hypothetical protein 6.96 11196 D similar to unknown proteins 5 BAC74969.1 Non-secretory protein CDS SAVERM_7259 8656373 8655567 fabG9 putative 3-oxoacyl-ACP reductase PF00106: short chain dehydrogenase 5.85 28037 D metabolism of lipids 2.4 BAC74970.1 Non-secretory protein CDS SAVERM_7260 8656947 8656399 hypothetical protein PF01966: HD domain 5.3 19059 D similar to unknown proteins 5 BAC74971.1 Non-secretory protein CDS SAVERM_7261 8657747 8658229 putative acetyltransferase PF00583: Acetyltransferase (GNAT) family 6.51 17443 D miscellaneous 4.7 BAC74972.1 Non-secretory protein CDS SAVERM_7262 8660257 8658263 putative secreted protein 6.6 71239 D no similarity 6 BAC74973.1 Signal peptide CDS SAVERM_7263 8660501 8661892 araN putative L-arabinose ABC transporter substrate-binding protein Tat substrate, multiple sugar ABC transporter solute-binding protein 6.12 48827 D transport / binding proteins & lipoproteins 1.2 BAC74974.1 Non-secretory protein CDS SAVERM_7264 8661889 8662830 araP putative L-arabinose ABC transport permease protein multiple sugar ABC transporter permease proteinPF00528: Binding-protein-dependent transport system inner membrane component 9.75 33830 D transport / binding proteins & lipoproteins 1.2 BAC74975.1 Non-secretory protein CDS SAVERM_7265 8662827 8663702 araQ putative L-arabinose ABC transport permease protein multiple sugar ABC transporter permease protein 9.78 31648 D transport / binding proteins & lipoproteins 1.2 BAC74976.1 Non-secretory protein CDS SAVERM_7266 8663699 8665531 hypothetical protein PF02065: Melibiase 5.26 65568 D similar to unknown proteins 5 BAC74977.1 Non-secretory protein CDS SAVERM_7267 8665528 8666526 malR2 putative MalR repressor protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 4.99 35616 D regulation 3.5.2 BAC74978.1 Non-secretory protein CDS SAVERM_7268 8666657 8668534 putative exo-alpha-galactosidase 6.65 67184 D no similarity 6 BAC74979.1 Signal peptide CDS SAVERM_7269 8669926 8668562 amdA1 putative amidase PF01425: Amidase 9.62 47439 D miscellaneous 4.7 BAC74980.1 Non-secretory protein CDS SAVERM_7270 8671202 8670159 putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 5.94 36972 D regulation 3.5.2 BAC74981.1 Non-secretory protein CDS SAVERM_7271 8671422 8672714 putative multiple sugar ABC transporter substrate-binding protein malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 9.29 46289 D transport / binding proteins & lipoproteins 1.2 BAC74982.1 Signal peptide CDS SAVERM_7272 8672721 8673614 putative multiple sugar ABC transporter permease protein malF, PF00528: Binding-protein-dependent transport system inner membrane component 9.98 32019 D transport / binding proteins & lipoproteins 1.2 BAC74983.1 Non-secretory protein CDS SAVERM_7273 8673611 8674516 putative multiple sugar ABC transporter permease protein malG, PF00528: Binding-protein-dependent transport system inner membrane component 9.59 32948 D transport / binding proteins & lipoproteins 1.2 BAC74984.1 Non-secretory protein CDS SAVERM_7274 8674569 8675801 hypothetical protein 5.92 44855 D similar to unknown proteins 5 BAC74985.1 Non-secretory protein CDS SAVERM_7275 8675831 8676259 putative secreted protein Tat substrate 9.44 14794 D similar to unknown proteins 5 BAC74986.1 Signal peptide CDS SAVERM_7276 8676290 8677834 endoH putative endo-beta-N-acetylglucosaminidase, secreted PF03644: Glycosyl hydrolase family 85 6.52 54903 D cell wall 1.1 BAC74987.1 Non-secretory protein CDS SAVERM_7277 8677864 8680878 ama2 putative alpha-mannosidase PF01074: Glycosyl hydrolases family 38 N-terminal domain 5.48 111116 D specific pathways 2.1.1 BAC74988.1 Non-secretory protein CDS SAVERM_7278 8681619 8680918 putative GntR-family transcriptional regulator PF07729: FCD domain 5.62 25331 D regulation 3.5.2 BAC74989.1 Non-secretory protein CDS SAVERM_7279 8681784 8682830 rbsA3 putative sugar ABC transporter substrate-binding protein PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 8.78 36684 D transport / binding proteins & lipoproteins 1.2 BAC74990.1 Signal peptide CDS SAVERM_7280 8682827 8684392 putative sugar ABC transporter ATP-binding protein PF00005: ABC transporter 5.65 55872 D transport / binding proteins & lipoproteins 1.2 BAC74991.1 Non-secretory protein CDS SAVERM_7281 8684451 8685410 putative sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 10.87 32821 D transport / binding proteins & lipoproteins 1.2 BAC74992.1 Non-secretory protein CDS SAVERM_7282 8685461 8686801 menC putative mandelate racemase PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain 5.3 48362 D specific pathways 2.1.1 BAC74993.1 Non-secretory protein CDS SAVERM_7283 8686798 8687553 putative dehydrogenase PF00106: short chain dehydrogenase 4.86 25375 D miscellaneous 4.7 BAC74994.1 Non-secretory protein CDS SAVERM_7284 8687550 8688536 putative oxidoreductase PF00248: Aldo/keto reductase family 5.09 34851 D miscellaneous 4.7 BAC74995.1 Non-secretory protein CDS SAVERM_7285 8688533 8688847 hypothetical protein PF05336: Protein of unknown function (DUF718) 4.71 11609 D no similarity 6 BAC74996.1 Non-secretory protein CDS SAVERM_7286 8688832 8689683 hypothetical protein PF04909: Amidohydrolase 4.52 30262 D similar to unknown proteins 5 BAC74997.1 Non-secretory protein CDS SAVERM_7287 8691193 8689766 putative integral membrane protein PF06762: Protein of unknown function (DUF1222) 9.54 54291 D miscellaneous 4.7 BAC74998.1 Non-secretory protein CDS SAVERM_7288 8691505 8693577 prpM4 putative magnesium or manganese-dependent protein phosphatase PF00785: PAC motif 4.93 76013 D protein modification 3.8 BAC74999.1 Non-secretory protein CDS SAVERM_7289 8693625 8694485 mutM2 putative formamidopyrimidine-DNA glycosylase PF06831: Formamidopyrimidine-DNA glycosylase H2TH domain 8.35 31293 D DNA modification & repair 3.2 BAC75000.1 Non-secretory protein CDS SAVERM_7290 8695179 8694529 putative membrane protein PF07584: Protein of unknown function (DUF1550) 8.13 23426 D miscellaneous 4.7 BAC75001.1 Non-secretory protein CDS SAVERM_7291 8695843 8695328 hypothetical protein 3.89 18406 D similar to unknown proteins 5 BAC75002.1 Non-secretory protein CDS SAVERM_7292 8696544 8695996 sig56 putative RNA polymerase ECF-subfamily sigma factor similar to SCO0942, PF04545: Sigma-70, region 4 9.65 20252 D RNA initiation 3.5.1 BAC75003.1 Non-secretory protein CDS SAVERM_7293 8696830 8697978 putative lipoprotein, secreted PF09587: Bacterial capsule synthesis protein PGA_cap 6.13 40009 D transport / binding proteins & lipoproteins 1.2 BAC75004.1 Signal peptide CDS SAVERM_7294 8699383 8697965 putative amino acid transporter protein PF00324: Amino acid permease 8.9 50396 D transport / binding proteins & lipoproteins 1.2 BAC75005.1 Non-secretory protein CDS SAVERM_7295 8700007 8699546 hypothetical protein PF00582: Universal stress protein family 5.91 16312 D similar to unknown proteins 5 BAC75006.1 Non-secretory protein CDS SAVERM_7296 8700179 8703460 lysS2 putative lysyl-tRNA synthetase PF00152: tRNA synthetases class II (D, K and N) 7.01 119035 D aminoacyl-tRNA-synthetase 3.7.2 BAC75007.1 Non-secretory protein CDS SAVERM_7297 8703619 8704467 putative oligosaccharide deacetylase, secreted Tat substrate, PF01522: Polysaccharide deacetylase 9.59 30921 D cell wall 1.1 BAC75008.1 Signal peptide CDS SAVERM_7298 8705207 8704497 putative membrane protein PF04203: Sortase family 8.99 25141 D miscellaneous 4.7 BAC75009.1 Non-secretory protein CDS SAVERM_7299 8705496 8706716 putative glycine-rich protein 12.07 37735 D miscellaneous 4.7 BAC75010.1 Signal peptide CDS SAVERM_7300 8707642 8706878 putative integral membrane protein 4.82 27937 D miscellaneous 4.7 BAC75011.1 Signal peptide CDS SAVERM_7301 8708279 8707659 putative proline-rich protein 10.97 21157 D miscellaneous 4.7 BAC75012.1 Signal peptide CDS SAVERM_7302 8708539 8709492 putative lipoprotein PF03640: Secreted repeat of unknown function 8.33 32287 D transport / binding proteins & lipoproteins 1.2 BAC75013.1 Signal peptide CDS SAVERM_7303 8709840 8710652 hypothetical protein PF04672: Protein of unknown function (DUF574) 4.59 29501 D similar to unknown proteins 5 BAC75014.1 Non-secretory protein CDS SAVERM_7304 8710649 8712802 hypothetical protein PF00563: EAL domain, PF00990: GGDEF domain, PF00785: PAC motif 4.78 78065 D similar to unknown proteins 5 BAC75015.1 Non-secretory protein CDS SAVERM_7305 8713321 8714100 putative dehydrogenase PF00106: short chain dehydrogenase 4.41 26067 D miscellaneous 4.7 BAC75016.1 Non-secretory protein CDS SAVERM_7306 8715093 8714200 putative LysR-family transcriptional regulator PF03466: LysR substrate binding domain 8.76 32468 D regulation 3.5.2 BAC75017.1 Non-secretory protein CDS SAVERM_7307 8715169 8715876 sdhC2 putative succinate dehydrogenase cytochrome b-556 subunit (complex II) PF01127: Succinate dehydrogenase cytochrome b subunit 11.28 25992 D TCA cycle 2.1.3 BAC75018.1 Non-secretory protein CDS SAVERM_7308 8715880 8717829 sdhA3 putative succinate dehydrogenase flavoprotein subunit (complex II) PF00890: FAD binding domain 6.03 72334 D TCA cycle 2.1.3 BAC75019.1 Non-secretory protein CDS SAVERM_7309 8717826 8718575 sdhB3 putative succinate dehydrogenase iron-sulfur protein (complex II) PF00037: 4Fe-4S binding domain 4.45 26777 D TCA cycle 2.1.3 BAC75020.1 Non-secretory protein CDS SAVERM_7310 8718965 8719735 hypothetical protein 6.51 27942 D similar to unknown proteins 5 BAC75021.1 Non-secretory protein CDS SAVERM_7311 8719984 8720883 plsC7 putative 1-acylglycerol-3-phosphate O-acyltransferase PF01553: Acyltransferase 12.27 30934 D metabolism of lipids 2.4 BAC75022.1 Non-secretory protein CDS SAVERM_7312 8723946 8721019 hypothetical protein PF01094: Receptor family ligand binding region 9.29 106606 D no similarity 6 BAC75023.1 Non-secretory protein CDS SAVERM_7313 8724575 8725219 hypothetical protein PF11139: Protein of unknown function (DUF2910) 11.37 22924 D similar to unknown proteins 5 BAC75024.1 Non-secretory protein CDS SAVERM_7314 8725402 8726760 putative secreted protein Tat substrate, PF00657: GDSL-like Lipase/Acylhydrolase 10.55 47861 D similar to unknown proteins 5 BAC75025.1 Signal peptide CDS SAVERM_7315 8727028 8726798 hypothetical protein 7.52 7846 D no similarity 6 BAC75026.1 Non-secretory protein CDS SAVERM_7316 8727753 8727109 putative methyltransferase PF07021: Methionine biosynthesis protein MetW 6.51 22860 D miscellaneous 4.7 BAC75027.1 Non-secretory protein CDS SAVERM_7317 8727769 8728572 hypothetical protein 9.74 29658 D no similarity 6 BAC75028.1 Signal peptide CDS SAVERM_7318 8729601 8728594 putative monooxygenase PF00296: Luciferase-like monooxygenase 7.1 36106 D miscellaneous 4.7 BAC75029.1 Non-secretory protein CDS SAVERM_7319 8730427 8729675 fhuF2 putative ferric iron reductase PF06276: Ferric iron reductase protein FhuF, putative IdeR-binding site: GTAGGTAAGCCTTACCTTA(8730601:8730619) 7.5 27022 D miscellaneous 4.7 BAC75030.1 Non-secretory protein CDS SAVERM_7320 8730975 8732147 avsA putative siderophore synthetase component similar to PvsA, PF07478: D-ala D-ala ligase C-terminus 5.09 42850 D miscellaneous 4.7 BAC75031.1 Non-secretory protein CDS SAVERM_7321 8732144 8733907 avsB putative siderophore synthetase component similar to PvsB, PF04183: IucA / IucC family 7.41 62834 D miscellaneous 4.7 BAC75032.1 Non-secretory protein CDS SAVERM_7322 8734011 8735816 avsC putative siderophore synthetase component similar to PvsD, PF04183: IucA / IucC family 6.71 65077 D miscellaneous 4.7 BAC75033.1 Non-secretory protein CDS SAVERM_7323 8735813 8737039 avsD putative diaminopimelate decarboxylase similar to PvsE, PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain 6.55 43504 D metabolism of amino acids & related molecules 2.2 BAC75034.1 Non-secretory protein CDS SAVERM_7324 8737081 8739531 prpL3 putative magnesium or manganese-dependent protein phosphatase PF07228: Stage II sporulation protein E (SpoIIE) 5.1 86321 D protein modification 3.8 BAC75035.1 Non-secretory protein CDS SAVERM_7325 8740081 8739584 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 10.51 18559 D similar to unknown proteins 5 BAC75036.1 Non-secretory protein CDS SAVERM_7326 8740090 8740746 putative MerR-family transcriptional regulator PF00376: MerR family regulatory protein 5.36 23608 D regulation 3.5.2 BAC75037.1 Non-secretory protein CDS SAVERM_7327 8740960 8741457 hypothetical protein PF08235: LNS2 (Lipin/Ned1/Smp2) 7.2 18604 D similar to unknown proteins 5 BAC75038.1 Non-secretory protein CDS SAVERM_7328 8741746 8741489 hypothetical protein PF07311: Protein of unknown function (DUF1458) 5.04 9591 D similar to unknown proteins 5 BAC75039.1 Non-secretory protein CDS SAVERM_7329 8741916 8743166 dasA3 putative multiple sugar ABC transporter substrate-binding protein malE, Tat substrate, PF00497: Bacterial extracellular solute-binding proteins, family 3 7.5 44795 D transport / binding proteins & lipoproteins 1.2 BAC75040.1 Signal peptide CDS SAVERM_7330 8745301 8743193 prpM5 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 6.3 74900 D protein modification 3.8 BAC75041.1 Non-secretory protein CDS SAVERM_7331 8745511 8748213 putative LuxR-family transcriptional regulator PF00196: Bacterial regulatory proteins, luxR family 6.49 96513 D regulation 3.5.2 BAC75042.1 Non-secretory protein CDS SAVERM_7332 8748224 8750050 putative transmembrane transport protein PF07690: Major Facilitator Superfamily 9.06 62872 D transport / binding proteins & lipoproteins 1.2 BAC75043.1 Non-secretory protein CDS SAVERM_7333 8750152 8750583 putative integral membrane protein 10.83 14671 D transport / binding proteins & lipoproteins 1.2 BAC75044.1 Non-secretory protein CDS SAVERM_7334 8750726 8750923 hypothetical protein 5.54 7416 D similar to unknown proteins 5 BAC75045.1 Non-secretory protein CDS SAVERM_7335 8751157 8751822 putative integral membrane protein PF03729: Short repeat of unknown function (DUF308) 9.3 22950 D miscellaneous 4.7 BAC75046.1 Non-secretory protein CDS SAVERM_7336 8751955 8752452 putative integral membrane protein PF09323: Domain of unknown function (DUF1980) 6.9 18105 D miscellaneous 4.7 BAC75047.1 Non-secretory protein CDS SAVERM_7337 8752486 8752932 putative integral membrane protein 6.06 16247 D miscellaneous 4.7 BAC75048.1 Non-secretory protein CDS SAVERM_7338 8754068 8753067 egtD putative histidine methyltransferase biosynthetic gene cluster for ergothioneine, PF10017: Histidine-specific methyltransferase, SAM-dependent 4.62 35886 D similar to unknown proteins 5 BAC75049.1 Non-secretory protein CDS SAVERM_7339 8754892 8754065 egtC putative glutamine amidotransferase biosynthetic gene cluster for ergothioneine, PF13522: Glutamine amidotransferase 4.89 29541 D similar to unknown proteins 5 BAC75050.1 Non-secretory protein CDS SAVERM_7340 8756214 8754892 egtB putative formylglycine-generating sulfatase biosynthetic gene cluster for ergothioneine, PF03781: Formylglycine-generating sulfatase enzyme 5.21 49189 D similar to unknown proteins 5 BAC75051.1 Non-secretory protein CDS SAVERM_7341 8757485 8756211 egtA putative glutamate-cysteine ligase biosynthetic gene cluster for ergothioneine, PF04107: Glutamate-cysteine ligase family 2(GCS2) 5.57 46123 D miscellaneous 4.7 BAC75052.1 Non-secretory protein CDS SAVERM_7342 8757636 8758619 hypothetical protein PF10021: Uncharacterized protein conserved in bacteria (DUF2263) 9.81 34871 D similar to unknown proteins 5 BAC75053.1 Non-secretory protein CDS SAVERM_7343 8759059 8758604 hypothetical protein PF02452: PemK-like protein 7.08 17183 D similar to unknown proteins 5 BAC75054.1 Non-secretory protein CDS SAVERM_7344 8760630 8759149 putative membrane protein PF01145: SPFH domain / Band 7 family 6.01 51892 D miscellaneous 4.7 BAC75055.1 Non-secretory protein CDS SAVERM_7345 8762506 8760992 amdA2 putative amidase PF01425: Amidase 8.67 53019 D miscellaneous 4.7 BAC75056.1 Non-secretory protein CDS SAVERM_7346 8762699 8763733 putative LacI-family transcriptional regulator PF00356: Bacterial regulatory proteins, lacI family 8.06 37024 D regulation 3.5.2 BAC75057.1 Non-secretory protein CDS SAVERM_7347 8764308 8763919 trxA3 putative thioredoxin PF00085: Thioredoxin 3.91 14115 D membrane bioenergetics 1.4 BAC75058.1 Non-secretory protein CDS SAVERM_7348 8764437 8765870 lpdB putative dihydrolipoamide dehydrogenase similar to dihydrolipoamide dehydrogenase, PF00070: Pyridine nucleotide-disulphide oxidoreductase 5.02 49991 D TCA cycle 2.1.3 BAC75059.1 Non-secretory protein CDS SAVERM_7349 8766861 8766187 def3 putative polypeptide deformylase PF01327: Polypeptide deformylase 4.83 23892 D metabolism of amino acids & related molecules 2.2 BAC75060.1 Non-secretory protein CDS SAVERM_7350 8767057 8768469 putative integral membrane protein PF03929: Uncharacterized iron-regulated membrane protein (DUF337) 9.51 50119 D miscellaneous 4.7 BAC75061.1 Non-secretory protein CDS SAVERM_7351 8768501 8768914 hypothetical protein PF03965: Penicillinase repressor 5.27 14890 D similar to unknown proteins 5 BAC75062.1 Non-secretory protein CDS SAVERM_7352 8769545 8769198 hypothetical protein 4.65 13134 D similar to unknown proteins 5 BAC75063.1 Non-secretory protein CDS SAVERM_7353 8770087 8769623 hypothetical protein 4.74 15949 D similar to unknown proteins 5 BAC75064.1 Non-secretory protein CDS SAVERM_7354 8770611 8770084 putative MarR-family transcriptional regulator PF01047: MarR family 7.18 18967 D regulation 3.5.2 BAC75065.1 Non-secretory protein CDS SAVERM_7355 8770756 8771721 putative pirin-like protein PF02678: Pirin 5.37 34921 D regulation 3.5.2 BAC75066.1 Non-secretory protein CDS SAVERM_7356 8773655 8772756 putative monophenol monooxygenase truncated 9.2 33528 D miscellaneous 4.7 BAC75067.1 Non-secretory protein CDS SAVERM_7357 8775772 8774009 putative ABC transporter ATP-binding protein PF00005: ABC transporter 6.9 61099 D transport / binding proteins & lipoproteins 1.2 BAC75068.1 Non-secretory protein CDS SAVERM_7358 8776962 8775769 putative glycosyltransferase, secreted PF04101: Glycosyltransferase family 28 C-terminal domain 4.97 40868 D specific pathways 2.1.1 BAC75069.1 Non-secretory protein CDS SAVERM_7359 8777766 8776963 putative hydrolase pks1 gene cluster, PF00561: alpha/beta hydrolase fold 5.17 28794 D miscellaneous 4.7 BAC75070.1 Non-secretory protein CDS SAVERM_7360 8778044 8777769 pks1-1 putative acyl carrier protein pks1 gene cluster, PF00550: Phosphopantetheine attachment site 3.61 9912 D metabolism of lipids 2.4 BAC75071.1 Non-secretory protein CDS SAVERM_7361 8782666 8778095 pks1-2 putative modular polyketide synthase pks1 gene cluster 6.84 161653 D antibiotic production 4.3 BAC75072.1 Non-secretory protein CDS SAVERM_7362 8789766 8782669 pks1-3 putative modular polyketide synthase pks1 gene cluster 4.83 243712 D antibiotic production 4.3 BAC75073.1 Non-secretory protein CDS SAVERM_7363 8791988 8790510 putative carboxylesterase PF00135: Carboxylesterase 4.75 52620 D antibiotic production 4.3 BAC75074.1 Non-secretory protein CDS SAVERM_7364 8792940 8792326 hypothetical protein 9.97 22578 D similar to unknown proteins 5 BAC75075.1 Non-secretory protein CDS SAVERM_7365 8793195 8795051 hypX putative [NiFe] hydrogenase maturation similar to HoxX protein, PF00551: Formyl transferase 7.17 66735 D regulation 3.5.2 BAC75076.1 Non-secretory protein CDS SAVERM_7366 8795100 8796188 hydA putative cytochrome C3-like [NiFe] hydrogenase small subunit PF01058: NADH ubiquinone oxidoreductase, 20 Kd subunit 4.64 38521 D membrane bioenergetics 1.4 BAC75077.1 Non-secretory protein CDS SAVERM_7367 8796269 8798053 hydB putative cytochrome C3-like [NiFe] hydrogenase large subunit PF00374: Nickel-dependent hydrogenase 6.39 66872 D membrane bioenergetics 1.4 BAC75078.1 Non-secretory protein CDS SAVERM_7368 8798050 8798640 hypothetical protein similar to Ralstonia eutropha gi:38637731 4.52 19867 D no similarity 6 BAC75079.1 Non-secretory protein CDS SAVERM_7369 8798637 8799305 hypothetical protein similar to Ralstonia eutropha gi:38637732 6.88 24498 D no similarity 6 BAC75080.1 Non-secretory protein CDS SAVERM_7370 8799302 8799994 hypothetical protein similar to Ralstonia eutropha gi:38637733 5.41 25506 D no similarity 6 BAC75081.1 Non-secretory protein CDS SAVERM_7371 8799991 8801427 hypothetical protein similar to Ralstonia eutropha gi:38637734 4.52 52148 D no similarity 6 BAC75082.1 Non-secretory protein CDS SAVERM_7372 8801424 8801975 hupD putative [NiFe] hydrogenase-specific C-terminal protease similar to Ralstonia eutropha gi:38637735, PF01750: Hydrogenase maturation protease 4.23 18982 D similar to unknown proteins 5 BAC75083.1 Non-secretory protein CDS SAVERM_7373 8802301 8802696 hypA putative [NiFe] hydrogenase expression/formation protein PF01155: Hydrogenase expression/synthesis hypA family 4.42 14054 D miscellaneous 4.7 BAC75084.1 Non-secretory protein CDS SAVERM_7374 8802700 8803527 hypB putative [NiFe] hydrogenase expression/formation protein PF02492: CobW/HypB/UreG, nucleotide-binding domain 6.66 29036 D miscellaneous 4.7 BAC75085.1 Non-secretory protein CDS SAVERM_7375 8803563 8805929 hypF putative [NiFe] hydrogenase maturation protein PF01300: yrdC domain 7.27 83459 D miscellaneous 4.7 BAC75086.1 Non-secretory protein CDS SAVERM_7376 8805990 8806310 hypC putative [NiFe] hydrogenase expression/formation protein PF01455: HupF/HypC family 3.93 11564 D miscellaneous 4.7 BAC75087.1 Non-secretory protein CDS SAVERM_7377 8806307 8807431 hypD putative [NiFe] hydrogenase expression/formation protein PF01924: Hydrogenase formation hypA family 5.29 41356 D miscellaneous 4.7 BAC75088.1 Non-secretory protein CDS SAVERM_7378 8807424 8808500 hypE putative [NiFe] hydrogenase expression/formation protein PF02769: AIR synthase related protein, C-terminal domain 4.56 36174 D miscellaneous 4.7 BAC75089.1 Non-secretory protein CDS SAVERM_7379 8808949 8808563 hypothetical protein 9.04 13863 D no similarity 6 BAC75090.1 Non-secretory protein CDS SAVERM_7380 8809685 8809365 hypothetical protein 10.64 11576 D similar to unknown proteins 5 BAC75091.1 Non-secretory protein CDS SAVERM_7381 8809992 8810519 hypothetical protein 3.55 18918 D similar to unknown proteins 5 BAC75092.1 Non-secretory protein CDS SAVERM_7382 8810525 8811163 putative oxidoreductase iron-sulfur binding subunit PF01799: [2Fe-2S] binding domain 5.1 22259 D miscellaneous 4.7 BAC75093.1 Non-secretory protein CDS SAVERM_7383 8811160 8812152 putative oxidoreductase molybdopterin binding subunit PF00941: FAD binding domain in molybdopterin dehydrogenase 8.04 34938 D miscellaneous 4.7 BAC75094.1 Non-secretory protein CDS SAVERM_7384 8812222 8814342 putative oxidoreductase PF02738: Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain 6.25 73886 D miscellaneous 4.7 BAC75095.1 Non-secretory protein CDS SAVERM_7385 8814519 8814695 hypothetical protein 8.82 6384 D similar to unknown proteins 5 BAC75096.1 Non-secretory protein CDS SAVERM_7386 8815009 8814779 hypothetical protein 4.9 8208 D no similarity 6 BAC75097.1 Non-secretory protein CDS SAVERM_7387 8815160 8815735 terD5 putative tellurium resistance protein PF02342: Bacterial stress protein 4.38 20047 D detoxification 4.2 BAC75098.1 Non-secretory protein CDS SAVERM_7388 8815808 8816485 hypothetical protein 11.48 25273 D no similarity 6 BAC75099.1 Non-secretory protein CDS SAVERM_7389 8817780 8816539 kefB putative sodium/proton antiporter PF00999: Sodium/hydrogen exchanger family 6.69 42191 D transport / binding proteins & lipoproteins 1.2 BAC75100.1 Non-secretory protein CDS SAVERM_7390 8818210 8817785 hypothetical protein PF02080: TrkA-C domain 7.07 15013 D similar to unknown proteins 5 BAC75101.1 Non-secretory protein CDS SAVERM_7391 8818383 8819549 putative two-component system sensor kinase PF07730: Histidine kinase 11.39 41427 D sensors 1.3 BAC75102.1 Non-secretory protein CDS SAVERM_7392 8819549 8820220 putative two-component system response regulator PF00072: Response regulator receiver domain 5.77 24764 D regulation 3.5.2 BAC75103.1 Non-secretory protein CDS SAVERM_7393 8821054 8820563 putative regulatory protein 6.78 18222 D regulation 3.5.2 BAC75104.1 Non-secretory protein CDS SAVERM_7394 8821348 8821674 hypothetical protein 10.93 11636 D similar to unknown proteins 5 BAC75105.1 Non-secretory protein CDS SAVERM_7395 8821773 8823770 amyA5 putative alpha-amylase PF00128: Alpha amylase, catalytic domain 6.55 74068 D specific pathways 2.1.1 BAC75106.1 Non-secretory protein CDS SAVERM_7396 8823767 8825518 treS2 putative trehalose synthase PF00128: Alpha amylase, catalytic domain 4.54 66906 D specific pathways 2.1.1 BAC75107.1 Non-secretory protein CDS SAVERM_7397 8825547 8826941 putative pep2 protein PF01636: Phosphotransferase enzyme family 8 51467 D miscellaneous 4.7 BAC75108.1 Non-secretory protein CDS SAVERM_7398 8826938 8827363 putative glycogen branching enzyme frameshift 8.13 14792 D miscellaneous 4.7 BAC75109.1 Non-secretory protein CDS SAVERM_7399 8827360 8829138 putative 1,4-alpha-glucan branching enzyme frameshift 5.11 66805 D miscellaneous 4.7 BAC75110.1 Non-secretory protein CDS SAVERM_7400 8829444 8830238 sig57 putative RNA polymerase sigma factor similar to SCO7341:sigG, RNA polymerase alternative sigma factor, PF04542: Sigma-70 region 2 5.24 29541 D RNA initiation 3.5.1 BAC75111.1 Non-secretory protein CDS SAVERM_7401 8830816 8830427 hypothetical protein PF03861: ANTAR domain 4.32 13768 D similar to unknown proteins 5 BAC75112.1 Non-secretory protein CDS SAVERM_7402 8830948 8831559 putative cyclase/dehydrase PF03364: Streptomyces cyclase/dehydrase 4.49 22757 D miscellaneous 4.7 BAC75113.1 Non-secretory protein CDS SAVERM_7403 8831556 8832605 putative FMN-dependent monooxygenase PF00296: Luciferase-like monooxygenase 5.31 37531 D miscellaneous 4.7 BAC75114.1 Non-secretory protein CDS SAVERM_7404 8834011 8832701 putative transmembrane transport protein PF02687: Predicted permease 10.93 44801 D transport / binding proteins & lipoproteins 1.2 BAC75115.1 Non-secretory protein CDS SAVERM_7405 8834800 8834015 putative ABC transporter ATP-binding protein PF00005: ABC transporter 10.56 27737 D transport / binding proteins & lipoproteins 1.2 BAC75116.1 Non-secretory protein CDS SAVERM_7406 8834887 8835639 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 9.69 26425 D transport / binding proteins & lipoproteins 1.2 BAC75117.1 Non-secretory protein CDS SAVERM_7407 8835636 8836307 putative ABC transporter permease PF00528: Binding-protein-dependent transport system inner membrane component 10.42 23236 D transport / binding proteins & lipoproteins 1.2 BAC75118.1 Non-secretory protein CDS SAVERM_7408 8836304 8837239 putative ABC transporter substrate-binding protein PF04069: Substrate binding domain of ABC-type glycine betaine transport system 5.7 33274 D transport / binding proteins & lipoproteins 1.2 BAC75119.1 Non-secretory protein CDS SAVERM_7409 8838436 8837282 putative ABC transporter ATP-binding protein PF00005: ABC transporter 5.18 41372 D transport / binding proteins & lipoproteins 1.2 BAC75120.1 Non-secretory protein CDS SAVERM_7410 8839164 8838469 hypothetical protein PF02589: Uncharacterized ACR, YkgG family COG1556 5.33 24681 D similar to unknown proteins 5 BAC75121.1 Non-secretory protein CDS SAVERM_7411 8840603 8839128 putative iron-sulfur protein PF00037: 4Fe-4S binding domain 8.06 53510 D miscellaneous 4.7 BAC75122.1 Non-secretory protein CDS SAVERM_7412 8841355 8840600 putative fumarate reductase-related protein PF02754: Cysteine-rich domain 5.84 27081 D miscellaneous 4.7 BAC75123.1 Non-secretory protein CDS SAVERM_7413 8842871 8841426 rhaB putative rhamnulokinase PF00370: FGGY family of carbohydrate kinases, N-terminal domain 5.06 51030 D specific pathways 2.1.1 BAC75124.1 Non-secretory protein CDS SAVERM_7414 8844907 8842868 srlD putative sorbitol-6-phosphate 2-dehydrogenase PF00106: short chain dehydrogenase 5.58 71406 D specific pathways 2.1.1 BAC75125.1 Non-secretory protein CDS SAVERM_7415 8846224 8845064 putative sugar isomerase PF01261: Xylose isomerase-like TIM barrel 4.68 42624 D miscellaneous 4.7 BAC75126.1 Non-secretory protein CDS SAVERM_7416 8846486 8848003 rhaT putative simple sugar ABC transporter ATP-binding protein PF00005: ABC transporter 6.35 54197 D transport / binding proteins & lipoproteins 1.2 BAC75127.1 Non-secretory protein CDS SAVERM_7417 8848059 8849099 rhaP putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 9.72 35219 D transport / binding proteins & lipoproteins 1.2 BAC75128.1 Non-secretory protein CDS SAVERM_7418 8849092 8850090 rhaQ putative simple sugar ABC transporter permease protein PF02653: Branched-chain amino acid transport system / permease component 8.71 34263 D transport / binding proteins & lipoproteins 1.2 BAC75129.1 Non-secretory protein CDS SAVERM_7419 8850119 8851201 rhaS putative simple sugar ABC transporter substrate-binding protein PF08157: NUC129 domain 8.53 37771 D miscellaneous 4.7 BAC75130.1 Signal peptide CDS SAVERM_7420 8851228 8851539 hypothetical protein PF05336: Protein of unknown function (DUF718) 4.34 11614 D similar to unknown proteins 5 BAC75131.1 Non-secretory protein CDS SAVERM_7421 8851550 8852962 putative secreted protein Tat substrate 7.01 50365 D similar to unknown proteins 5 BAC75132.1 Signal peptide CDS SAVERM_7422 8853042 8854067 putative LacI-family transcriptional regulator PF00532: Periplasmic binding proteins and sugar binding domain of the LacI family 6.06 35718 D regulation 3.5.2 BAC75133.1 Non-secretory protein CDS SAVERM_7423 8854146 8855498 putative prolyl aminopeptidase PF00561: alpha/beta hydrolase fold 5.79 50008 D protein modification 3.8 BAC75134.1 Non-secretory protein CDS SAVERM_7424 8855573 8856541 sig58 putative RNA polymerase ECF-subfamily sigma factor PF04542: Sigma-70 region 2 5.09 34515 D RNA initiation 3.5.1 BAC75135.1 Non-secretory protein CDS SAVERM_7425 8856821 8857651 hypothetical protein PF00805: Pentapeptide repeats (8 copies) 7.68 29822 D similar to unknown proteins 5 BAC75136.1 Non-secretory protein CDS SAVERM_7426 8859127 8857613 cyp27 cytochrome P450 hydroxylase CYP102B2 10.67 55723 D metabolism of coenzymes & prosthetic groups 2.5 BAC75137.1 Non-secretory protein CDS SAVERM_7427 8859236 8859844 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.15 22632 D regulation 3.5.2 BAC75138.1 Non-secretory protein CDS SAVERM_7428 8859930 8860658 hypothetical protein putative IdeR-binding site: TTAGGCAAGCCTTACCTAA(8859901:8859919) 6.51 25938 D similar to unknown proteins 5 BAC75139.1 Non-secretory protein CDS SAVERM_7429 8861852 8860626 putative secreted protein Tat substrate 7.47 41848 D similar to unknown proteins 5 BAC75140.1 Non-secretory protein CDS SAVERM_7430 8863036 8861978 putative integral membrane protein 6.97 37832 D miscellaneous 4.7 BAC75141.1 Non-secretory protein CDS SAVERM_7431 8864338 8863085 putative integral membrane protein PF06081: Bacterial protein of unknown function (DUF939) 10.15 46144 D miscellaneous 4.7 BAC75142.1 Non-secretory protein CDS SAVERM_7432 8865010 8864603 hypothetical protein 11.01 13626 D no similarity 6 BAC75143.1 Non-secretory protein CDS SAVERM_7433 8865143 8866588 hypothetical protein PF05139: Erythromycin esterase 9.19 53872 D similar to unknown proteins 5 BAC75144.1 Non-secretory protein CDS SAVERM_7434 8867105 8866617 hypothetical protein PF07299: Fibronectin-binding protein (FBP) 7.85 17929 D similar to unknown proteins 5 BAC75145.1 Non-secretory protein CDS SAVERM_7435 8867482 8867219 hypothetical protein 11.85 9068 D similar to unknown proteins 5 BAC75146.1 Non-secretory protein CDS SAVERM_7436 8867539 8868828 putative ROK-family transcriptional regulator PF00480: ROK family 5.23 45476 D regulation 3.5.2 BAC75147.1 Non-secretory protein CDS SAVERM_7437 8868940 8869275 hypothetical protein 4.07 11718 D similar to unknown proteins 5 BAC75148.1 Non-secretory protein CDS SAVERM_7438 8870539 8869571 putative dehydrogenase PF00106: short chain dehydrogenase 4.87 34172 D miscellaneous 4.7 BAC75149.1 Non-secretory protein CDS SAVERM_7439 8871520 8870855 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.73 23515 D miscellaneous 4.7 BAC75150.1 Non-secretory protein CDS SAVERM_7440 8872604 8871561 putative DNA polymerase beta chain PF02231: PHP domain N-terminal region 5 37872 D DNA replication 3.1 BAC75151.1 Non-secretory protein CDS SAVERM_7441 8872829 8873065 hypothetical protein 5 8581 D similar to unknown proteins 5 BAC75152.1 Non-secretory protein CDS SAVERM_7442 8874486 8873224 lamA2 putative secreted endo-1,3-beta-glucanase Tat substrate, PF00652: Ricin-type beta-trefoil lectin domain 5.16 43817 D specific pathways 2.1.1 BAC75153.1 Signal peptide CDS SAVERM_7443 8875205 8874615 putative integral membrane protein PF04892: VanZ like family 12.24 21241 D miscellaneous 4.7 BAC75154.1 Non-secretory protein CDS SAVERM_7444 8875490 8876074 mrpF putative membrane protein PF04066: Multiple resistance and pH regulation protein F (MrpF / PhaF) 12.03 19460 D miscellaneous 4.7 BAC75155.1 Non-secretory protein CDS SAVERM_7445 8876067 8876342 putative membrane protein 12.31 9483 D miscellaneous 4.7 BAC75156.1 Non-secretory protein CDS SAVERM_7446 8876339 8877079 mrpB putative cation antiporter PF04039: Domain related to MnhB subunit of Na+/H+ antiporter 8.46 25676 D specific pathways 2.1.1 BAC75157.1 Signal peptide CDS SAVERM_7447 8877195 8877545 mrpC putative cation antiporter dehydrogenase PF00420: NADH-ubiquinone/plastoquinone oxidore 7.34 12295 D specific pathways 2.1.1 BAC75158.1 Non-secretory protein CDS SAVERM_7448 8877545 8879302 mrpD putative cation antiporter NADH-dehydrogenase PF00361: NADH-Ubiquinone/plastoquinone (complex I), various chains 7.45 60186 D specific pathways 2.1.1 BAC75159.1 Non-secretory protein CDS SAVERM_7449 8880004 8879321 putative secreted protein 8.82 24446 D similar to unknown proteins 5 BAC75160.1 Non-secretory protein CDS SAVERM_7450 8880600 8880199 hypothetical protein PF00009: Elongation factor Tu GTP binding domain 6.98 14041 D similar to unknown proteins 5 BAC75161.1 Non-secretory protein CDS SAVERM_7451 8880691 8881644 prsA2 putative ribose-phosphate pyrophosphokinase PF00156: Phosphoribosyl transferase domain 6.95 33906 D metabolism of nucleotides & nucleic acids 2.3 BAC75162.1 Non-secretory protein CDS SAVERM_7452 8882198 8881791 putative anti-sigma factor antagonist PF01740: STAS domain 9.58 14729 D regulation 3.5.2 BAC75163.1 Non-secretory protein CDS SAVERM_7453 8883784 8882837 putative dehydrogenase PF00107: Zinc-binding dehydrogenase 6.44 33272 D miscellaneous 4.7 BAC75164.1 Non-secretory protein CDS SAVERM_7454 8883856 8884803 bdpH putative AraC-family transcriptional regulator PF01965: DJ-1/PfpI family, PF00165: Bacterial regulatory helix-turn-helix proteins, AraC family 8.04 33910 D regulation 3.5.2 BAC75165.1 Non-secretory protein CDS SAVERM_7455 8885655 8884951 putative esterase PF00561: alpha/beta hydrolase fold 4.46 25264 D miscellaneous 4.7 BAC75166.1 Non-secretory protein CDS SAVERM_7456 8885753 8886658 putative secreted protein 5.93 32617 D no similarity 6 BAC75167.1 Signal peptide CDS SAVERM_7457 8887237 8886674 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 7.27 19918 D regulation 3.5.2 BAC75168.1 Non-secretory protein CDS SAVERM_7458 8887605 8887243 hypothetical protein PF06993: Protein of unknown function (DUF1304) 8.5 12673 D similar to unknown proteins 5 BAC75169.1 Non-secretory protein CDS SAVERM_7459 8887817 8889352 putative membrane-associated oxidoreductase 8.08 54774 D miscellaneous 4.7 BAC75170.1 Non-secretory protein CDS SAVERM_7460 8889484 8889948 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 4.64 16874 D no similarity 6 BAC75171.1 Non-secretory protein CDS SAVERM_7461 8890031 8890423 hypothetical protein PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.81 14203 D similar to unknown proteins 5 BAC75172.1 Non-secretory protein CDS SAVERM_7462 8890759 8890451 putative membrane protein 10.61 10993 D miscellaneous 4.7 BAC75173.1 Non-secretory protein CDS SAVERM_7463 8891812 8890796 putative glutathione S-transferase PF00043: Glutathione S-transferase, C-terminal domain 6.51 37843 D similar to unknown proteins 5 BAC75174.1 Non-secretory protein CDS SAVERM_7464 8891921 8892991 putative transport protein PF01545: Cation efflux family 4.8 36988 D transport / binding proteins & lipoproteins 1.2 BAC75175.1 Non-secretory protein CDS SAVERM_7465 8893599 8893156 hypothetical protein PF04075: Domain of unknown function (DUF385) 4.84 16267 D similar to unknown proteins 5 BAC75176.1 Non-secretory protein CDS SAVERM_7466 8894396 8893764 hypothetical protein PF01810: LysE type translocator 12.28 21024 D similar to unknown proteins 5 BAC75177.1 Non-secretory protein CDS SAVERM_7467 8895115 8894606 hypothetical protein PF00657: GDSL-like Lipase/Acylhydrolase 4.66 17887 D similar to unknown proteins 5 BAC75178.1 Non-secretory protein CDS SAVERM_7468 8895148 8895834 hypothetical protein 12.08 24442 D no similarity 6 BAC75179.1 Non-secretory protein CDS SAVERM_7469 8895895 8897103 cyp28 cytochrome P450 hydroxylase CYP105D7, fdxH is located at downstream 5 44112 D metabolism of coenzymes & prosthetic groups 2.5 BAC75180.1 Non-secretory protein CDS SAVERM_7470 8897117 8897401 fdxH putative ferredoxin PF06902: Protein of unknown function (DUF1271) 4.05 9645 D membrane bioenergetics 1.4 BAC75181.1 Non-secretory protein CDS SAVERM_7471 8898303 8897749 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 6.68 20339 D regulation 3.5.2 BAC75182.1 Non-secretory protein CDS SAVERM_7472 8898430 8898891 hypothetical protein PF07080: Protein of unknown function (DUF1348) 6.8 18001 D similar to unknown proteins 5 BAC75183.1 Non-secretory protein CDS SAVERM_7473 8898901 8899431 hypothetical protein PF02441: Flavoprotein, possible flavoprotein involved in panthothenate metabolism 5.25 18763 D similar to unknown proteins 5 BAC75184.1 Non-secretory protein CDS SAVERM_7474 8900506 8899700 hypothetical protein PF03537: TM1410 hypothetical-related protein 9.11 28941 D similar to unknown proteins 5 BAC75185.1 Non-secretory protein CDS SAVERM_7475 8900898 8901785 putative hydrolase PF00561: alpha/beta hydrolase fold 5.79 31926 D miscellaneous 4.7 BAC75186.1 Non-secretory protein CDS SAVERM_7476 8902269 8905136 putative hydrolase PF00652: QXW lectin repeat 6.74 98198 D miscellaneous 4.7 BAC75187.1 Non-secretory protein CDS SAVERM_7477 8906488 8905145 arsB putative membrane efflux protein PF02040: Arsenical pump membrane protein 9.17 46750 D transport / binding proteins & lipoproteins 1.2 BAC75188.1 Non-secretory protein CDS SAVERM_7478 8908948 8906510 prpL4 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.78 87544 D protein modification 3.8 BAC75189.1 Non-secretory protein CDS SAVERM_7479 8909193 8912285 bga8 putative beta-galactosidase, secreted Tat substrate, PF02837: Glycosyl hydrolases family 2, sugar binding domain 6.65 110674 D specific pathways 2.1.1 BAC75190.1 Signal peptide CDS SAVERM_7480 8913182 8915059 putative hydrolase PF00652: QXW lectin repeat 7.7 65282 D miscellaneous 4.7 BAC75191.1 Non-secretory protein CDS SAVERM_7481 8916126 8915149 hprA putative glycerate dehydrogenase PF02826: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 5.79 34008 D miscellaneous 4.7 BAC75192.1 Non-secretory protein CDS SAVERM_7482 8917292 8916123 lldA putative L-lactate 2-monooxygenase PF01070: FMN-dependent dehydrogenase 5.81 41721 D membrane bioenergetics 1.4 BAC75193.1 Non-secretory protein CDS SAVERM_7483 8918064 8917603 hypothetical protein PF01243: Pyridoxamine 5'-phosphate oxidase 10.18 17406 D similar to unknown proteins 5 BAC75194.1 Non-secretory protein CDS SAVERM_7484 8919001 8918174 putative N5,N10-methylenetetrahydromethanopterin reductase-related protein PF00296: Luciferase-like monooxygenase 4.98 30299 D specific pathways 2.1.1 BAC75195.1 Non-secretory protein CDS SAVERM_7485 8919628 8919152 hypothetical protein 5.39 17750 D similar to unknown proteins 5 BAC75196.1 Non-secretory protein CDS SAVERM_7486 8920060 8920494 sti2 putative subtilisin inhibitor, secreted PF00720: Subtilisin inhibitor-like 7.24 14715 D protein modification 3.8 BAC75197.1 Signal peptide CDS SAVERM_7487 8920860 8920630 hypothetical protein 5.02 8414 D similar to unknown proteins 5 BAC75198.1 Non-secretory protein CDS SAVERM_7488 8921026 8921610 hypothetical protein PF00583: Acetyltransferase (GNAT) family 6.89 20809 D similar to unknown proteins 5 BAC75199.1 Non-secretory protein CDS SAVERM_7489 8921717 8923294 hypothetical protein PF01569: PAP2 superfamily 11.46 55271 D similar to unknown proteins 5 BAC75200.1 Non-secretory protein CDS SAVERM_7490 8924804 8923302 putative transmembrane efflux protein PF07690: Major Facilitator Superfamily 10 51694 D transport / binding proteins & lipoproteins 1.2 BAC75201.1 Non-secretory protein CDS SAVERM_7491 8924911 8925477 hypothetical protein PF03364: Streptomyces cyclase/dehydrase 5.08 20461 D similar to unknown proteins 5 BAC75202.1 Non-secretory protein CDS SAVERM_7492 8928298 8925482 putative ABC transporter ATP-binding protein PF00005: ABC transporter 8.44 100728 D transport / binding proteins & lipoproteins 1.2 BAC75203.1 Non-secretory protein CDS SAVERM_7493 8930549 8928300 putative colicin V-like processing peptidase PF03412: Peptidase C39 family 9.88 80377 D transport / binding proteins & lipoproteins 1.2 BAC75204.1 Non-secretory protein CDS SAVERM_7494 8931340 8930534 putative membrane protein PF00364: Biotin-requiring enzyme 9.34 28100 D transport / binding proteins & lipoproteins 1.2 BAC75205.1 Non-secretory protein CDS SAVERM_7495 8931675 8931460 hypothetical protein 3.12 6691 D similar to unknown proteins 5 BAC75206.1 Non-secretory protein CDS SAVERM_7496 8932577 8932137 hypothetical protein PF03061: Thioesterase superfamily 5.64 15487 D similar to unknown proteins 5 BAC75207.1 Non-secretory protein CDS SAVERM_7497 8932746 8934104 sprD2 putative streptogrisin D (secreted serine protease) PF02983: Alpha-lytic protease prodomain 3.9 44500 D protein modification 3.8 BAC75208.1 Signal peptide CDS SAVERM_7498 8936329 8934191 prpJ8 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 5.69 75274 D protein modification 3.8 BAC75209.1 Non-secretory protein CDS SAVERM_7499 8936797 8937468 amfR putative two-component system response regulator AmfR homolog protein, PF00196: Bacterial regulatory proteins, luxR family 8.99 23840 D regulation 3.5.2 BAC75210.1 Non-secretory protein CDS SAVERM_7500 8939205 8937310 amfA putative ABC transporter ATP-binding protein, AmfA AmfA/RamB homolog protein, PF00005: ABC transporter 8.03 65189 D transport / binding proteins & lipoproteins 1.2 BAC75211.1 Non-secretory protein CDS SAVERM_7501 8940989 8939202 amfB putative ABC transporter ATP-binding membrane translocator, AmfB AmfB/RamA homolog protein, PF00005: ABC transporter 11.32 61333 D transport / binding proteins & lipoproteins 1.2 BAC75212.1 Non-secretory protein CDS SAVERM_7502 8941196 8941080 amfS AmfS protein (lantibiotic) AmfS/RamS homolog protein 3.74 3781 D miscellaneous 4.7 BAC75213.1 Non-secretory protein CDS SAVERM_7503 8943908 8941260 amfT putative membrane translocator AmfT homolog protein, PF05147: Lanthionine synthetase C-like protein 5.46 95748 D transport / binding proteins & lipoproteins 1.2 BAC75214.1 Non-secretory protein CDS SAVERM_7504 8944160 8946703 prpC7 putative magnesium or manganese-dependent protein phosphatase PF01590: GAF domain 4.77 89775 D protein modification 3.8 BAC75215.1 Non-secretory protein CDS SAVERM_7505 8946807 8947310 hypothetical protein PF00149: Calcineurin-like phosphoesterase 8.27 18559 D similar to unknown proteins 5 BAC75216.1 Non-secretory protein CDS SAVERM_7506 8948462 8947356 pucA putative xanthine dehydrogenase PF02625: XdhC and CoxI family 5.71 38504 D metabolism of nucleotides & nucleic acids 2.3 BAC75217.1 Non-secretory protein CDS SAVERM_7507 8948716 8950707 tetM putative tetracycline resistance protein PF00009: Elongation factor Tu GTP binding domain 6.19 71113 D detoxification 4.2 BAC75218.1 Non-secretory protein CDS SAVERM_7508 8950741 8952684 putative endoglycosylceramidase, secreted PF00150: Cellulase (glycosyl hydrolase family 5) 5.72 69144 D miscellaneous 4.7 BAC75219.1 Signal peptide CDS SAVERM_7509 8953972 8952722 pkn32 putative serine/threonine protein kinase PF01011: PQQ enzyme repeat 5.62 44996 D protein modification 3.8 BAC75220.1 Signal peptide CDS SAVERM_7510 8954182 8954841 putative TetR-family transcriptional regulator PF00440: Bacterial regulatory proteins, tetR family 5.79 24066 D regulation 3.5.2 BAC75221.1 Non-secretory protein CDS SAVERM_7511 8955165 8954887 putative IS630 family ISPso5-like transposase IS630 family (8957414..8954891) Inverted repeat sequence (10/10 bp). Target sequence (CTAG) 8.67 11208 D transposon & IS 4.5 BAC75222.1 Non-secretory protein CDS SAVERM_7512 8956307 8955207 putative IS110 family ISLxx2-like transposase IS110 family (8956396..8955165) Inverted repeat sequence (10/17 bp); inserts between SAV7511 and SAV7513 10.94 40141 D transposon & IS 4.5 BAC75223.1 Non-secretory protein CDS SAVERM_7513 8957319 8956405 putative IS630 family ISPsy1-like transposase IS630 family (8957414..8954891) Inverted repeat sequence (10/10 bp). Target sequence (CTAG) 7.92 33357 D transposon & IS 4.5 BAC75224.1 Non-secretory protein CDS SAVERM_7514 8958111 8957401 putative WhiB-family transcriptional regulator PF02467: Transcription factor WhiB 11.29 26526 D regulation 3.5.2 BAC75225.1 Non-secretory protein CDS SAVERM_7515 8959000 8958230 hypothetical protein PF00990: GGDEF domain 11.5 27094 D similar to unknown proteins 5 BAC75226.1 Non-secretory protein CDS SAVERM_7516 8959792 8959331 spdB3 putative mobile element transfer protein SpdB 9.8 16014 D plasmid transfer 4.7.2 BAC75227.1 Non-secretory protein CDS SAVERM_7517 8960063 8960584 hypothetical protein 4.24 18912 D similar to unknown proteins 5 BAC75228.1 Non-secretory protein CDS SAVERM_7518 8961402 8960857 hypothetical protein 4.56 19070 D similar to unknown proteins 5 BAC75229.1 Non-secretory protein CDS SAVERM_7519 8961976 8961788 hypothetical protein 9.45 6158 D similar to unknown proteins 5 BAC75230.1 Non-secretory protein CDS SAVERM_7520 8964507 8962072 traA2 putative major plasmid transfer protein PF01580: FtsK/SpoIIIE family 5.12 85972 D plasmid transfer 4.7.2 BAC75231.1 Non-secretory protein CDS SAVERM_7521 8965014 8964610 traB2 putative plasmid transfer protein 7.06 13795 D plasmid transfer 4.7.2 BAC75232.1 Non-secretory protein CDS SAVERM_7522 8967180 8965030 hypothetical protein 11.61 71837 D similar to unknown proteins 5 BAC75233.1 Non-secretory protein CDS SAVERM_7523 8967472 8967251 hypothetical protein 10.11 8390 D no similarity 6 BAC75234.1 Non-secretory protein CDS SAVERM_7524 8967978 8967472 hypothetical protein PF00823: PPE family 11.18 18286 D no similarity 6 BAC75235.1 Non-secretory protein CDS SAVERM_7525 8969798 8968125 hypothetical protein PF06519: TolA protein 9.17 60859 D similar to unknown proteins 5 BAC75236.1 Non-secretory protein CDS SAVERM_7526 8970757 8969957 hypothetical protein 6 29901 D similar to unknown proteins 5 BAC75237.1 Non-secretory protein CDS SAVERM_7527 8971074 8970898 hypothetical protein 9.31 6975 D similar to unknown proteins 5 BAC75238.1 Non-secretory protein CDS SAVERM_7528 8971946 8971212 hypothetical protein 11.86 26824 D similar to unknown proteins 5 BAC75239.1 Non-secretory protein CDS SAVERM_7529 8972464 8971904 hypothetical protein 10.95 20730 D similar to unknown proteins 5 BAC75240.1 Non-secretory protein CDS SAVERM_7530 8972843 8973172 hypothetical protein PF03992: Antibiotic biosynthesis monooxygenase 4.5 12386 D similar to unknown proteins 5 BAC75241.1 Non-secretory protein CDS SAVERM_7531 8973169 8974422 putative transcriptional regulator PF01381: Helix-turn-helix 5.35 44982 D regulation 3.5.2 BAC75242.1 Non-secretory protein CDS SAVERM_7532 8974593 8975660 putative P-loop ATPase 7.34 39514 D miscellaneous 4.7 BAC75243.1 Non-secretory protein CDS SAVERM_7533 8975657 8976229 putative phosphotransferase PF07931: Chloramphenicol phosphotransferase-like protein 5.02 20471 D miscellaneous 4.7 BAC75244.1 Non-secretory protein CDS SAVERM_7534 8977073 8976231 hypothetical protein PF09130: Domain of unknown function (DUF1932) 4.84 29098 D similar to unknown proteins 5 BAC75245.1 Non-secretory protein CDS SAVERM_7535 8977725 8977078 putative hydrolase PF00702: haloacid dehalogenase-like hydrolase 4.93 23229 D miscellaneous 4.7 BAC75246.1 Non-secretory protein CDS SAVERM_7536 8978205 8981042 hypothetical protein PF00486: Transcriptional regulatory protein, C terminal 8.5 100288 D similar to unknown proteins 5 BAC75247.1 Non-secretory protein CDS SAVERM_7587 8983984 8983673 cas2 putative CRISPR-associated protein Cas2 (type I CRISPR) D miscellaneous Non-secretory protein CDS SAVERM_7537 8985005 8984010 cas1 putative CRISPR-associated protein Cas1 (type I CRISPR) PF01867: CRISPR associated protein Cas1 7.57 35743 D miscellaneous 4.7 BAC75248.1 Non-secretory protein CDS SAVERM_7538 8985670 8985002 cse3 putative CRISPR-associated protein Cse3 (type I CRISPR) PF08798: CRISPR associated protein 10.19 24182 D miscellaneous 4.7 BAC75249.1 Non-secretory protein CDS SAVERM_7539 8986503 8985667 cas5e putative CRISPR-associated protein Cas5e (type I CRISPR) PF09708: CRISPR-associated protein (Cas_Cas5) 7.93 30377 D miscellaneous 4.7 BAC75250.1 Non-secretory protein CDS SAVERM_7540 8987678 8986500 cse4 putative CRISPR-associated protein Cse4 (type I CRISPR) PF09344: CT1975-like protein 6.19 42377 D miscellaneous 4.7 BAC75251.1 Non-secretory protein CDS SAVERM_7541 8988430 8987744 cse2 putative CRISPR-associated protein Cse2 (type I CRISPR) PF09485: CRISPR-associated protein Cse2 (CRISPR_cse2) 7.74 25495 D similar to unknown proteins 5 BAC75252.1 Non-secretory protein CDS SAVERM_7542 8990044 8988473 cse1 putative CRISPR-associated protein Cse1 (type I CRISPR) PF09481: CRISPR-associated protein Cse1 (CRISPR_cse1) 7.14 57660 D similar to unknown proteins 5 BAC75253.1 Non-secretory protein CDS SAVERM_7543 8993226 8990281 cas3 putative CRISPR-associated helicase Cas3 family protein protein (type I CRISPR) PF00270: DEAD/DEAH box helicase 6.82 104814 D DNA modification & repair 3.2 BAC75254.1 Non-secretory protein CDS SAVERM_7545 8997081 8998715 putative ISL3 family ISFsp1-like transposase ISL3 family (8997013..8998743). Inverted repeat sequence (30/30 bp). Target sequence (TGAAATGT); same as SAV263 and SAV7548 9.83 60169 D transposon & IS 4.5 BAC75256.1 Non-secretory protein CDS SAVERM_7546 8999614 8998805 putative IS21 family ISMt3-like transposase IS21 family (9000920..8998764). Inverted repeat sequence (16/20 bp). Target sequence (CG). Translation will be controlled by frameshift with SAV7547 9.11 29507 D transposon & IS 4.5 BAC75257.1 Non-secretory protein CDS SAVERM_7547 9000852 8999611 putative IS21 family ISMt3-like transposase IS21 family (9000920..8998764). Inverted repeat sequence (16/20 bp). Target sequence (CG) 8.87 45695 D transposon & IS 4.5 BAC75258.1 Non-secretory protein CDS SAVERM_7548 9002603 9000969 putative ISL3 family ISFsp1-like transposase ISL3 family (9002671..9000941) Inverted repeat sequence (30/30 bp) Target sequence (TGAAAAGT); same as SAV263 and SAV7545 9.83 60169 D transposon & IS 4.5 BAC75259.1 Non-secretory protein CDS SAVERM_7550 9003392 9003574 hypothetical protein 11.85 6411 D no similarity 6 BAC75262.1 Non-secretory protein CDS SAVERM_7551 9003410 9003252 hypothetical protein 9.78 5895 D no similarity 6 BAC75261.1 Non-secretory protein CDS SAVERM_7552 9003581 9004177 hypothetical protein 10.88 21643 D no similarity 6 BAC75263.1 Non-secretory protein CDS SAVERM_7553 9004239 9004721 putative IS5 family IS1647-like transposase IS5 family (9004202..9005064) Inverted repeat sequence (19/19 bp). Target sequence (CTAAG). 10.64 17537 D transposon & IS 4.5 BAC75264.1 Non-secretory protein CDS SAVERM_7554 9004613 9005056 putative IS5 family IS1647-like transposase IS5 family (9004202..9005064) Inverted repeat sequence (19/19 bp). Target sequence (CTAAG); Translation will be controlled by frameshift with SAV7553. Extremely similar to SAV4215. 11.71 16858 D transposon & IS 4.5 BAC75265.1 Non-secretory protein CDS SAVERM_7555 9005159 9005944 hypothetical protein 4.31 28611 D no similarity 6 BAC75266.1 Non-secretory protein CDS SAVERM_7556 9006758 9006357 putative IS5 family ISBcen20-like transposase IS5 family (9007184..9006176) Inverted repeat sequence (9/12 bp). 10.31 15145 D transposon & IS 4.5 BAC75267.1 Non-secretory protein CDS SAVERM_7557 9006906 9007151 hypothetical protein IS5 family (9007184..9006176) Inverted repeat sequence (9/12 bp). 9.83 8568 D no similarity 6 BAC75268.1 Non-secretory protein CDS SAVERM_7558 9007287 9008051 putative IS5 family IS493-like transposase IS5 family (9007161..9008416) Inverted repeat sequence (19/25 bp). Target sequence (TGAC) 11.45 27937 D transposon & IS 4.5 BAC75269.1 Non-secretory protein CDS SAVERM_7559 9008121 9008366 hypothetical protein PF10049: Protein of unknown function (DUF2283) 4.14 9028 D no similarity 6 BAC75270.1 Non-secretory protein CDS SAVERM_7560 9008480 9008818 hypothetical protein 5.91 12394 D no similarity 6 BAC75271.1 Non-secretory protein CDS SAVERM_7561 9012304 9009323 putative secreted protein Tat substrate, PF05729: NACHT domain 6.62 109129 D similar to unknown proteins 5 BAC75272.1 Non-secretory protein CDS SAVERM_7562 9012708 9012343 hypothetical protein 9.62 13769 D no similarity 6 BAC75273.1 Non-secretory protein CDS SAVERM_7563 9013628 9012969 hypothetical protein PF00652: Ricin-type beta-trefoil lectin domain 9.05 23556 D similar to unknown proteins 5 BAC75274.1 Non-secretory protein CDS SAVERM_7564 9013686 9014216 hypothetical protein 11.09 19910 D no similarity 6 BAC75275.1 Non-secretory protein CDS SAVERM_7565 9014829 9014686 hypothetical protein 11.73 5216 D similar to unknown proteins 5 BAC75276.1 Non-secretory protein CDS SAVERM_7566 9015510 9015100 hypothetical protein 7.92 14564 D similar to unknown proteins 5 BAC75277.1 Non-secretory protein CDS SAVERM_7567 9015719 9017959 tapA1 putative telomere-associated protein PF01381: Helix-turn-helix 6.37 80207 D DNA packaging & segregation 3.4 BAC75278.1 Non-secretory protein CDS SAVERM_7568 9017972 9018529 tpgA1 putative terminal protein TpgA1 PF01381: Helix-turn-helix 10.34 20907 D DNA packaging & segregation 3.4 BAC75279.1 Non-secretory protein CDS SAVERM_7569 9020411 9019854 putative IS630 family ISSod10-like transposase IS630 family (9021009..9019857) Inverted repeat sequence (23/25 bp). Target sequence (TA); Translation will be controlled by frameshift with SAV7570. same as SAV744. 11.59 21298 D transposon & IS 4.5 BAC75280.1 Non-secretory protein CDS SAVERM_7570 9020947 9020408 putative IS630 family IS885-like transposase IS630 family (9021009..9019857) Inverted repeat sequence (23/25 bp). Target sequence (TA). 11.6 20598 D transposon & IS 4.5 BAC75281.1 Non-secretory protein CDS SAVERM_7571 9023699 9021192 ttrA2 putative helicase PF03457: Helicase associated domain 6.73 91978 D DNA modification & repair 3.2 BAC75282.1 Non-secretory protein CDS SAVERM_7572 9023991 9024185 hypothetical protein 6.49 7079 D no similarity 6 BAC75283.1 Non-secretory protein CDS SAVERM_7573 9024130 9024540 hypothetical protein 12.46 15135 D no similarity 6 BAC75284.1 Non-secretory protein DNA LTR-L 1 231 tirL left terminal inverted repeat incompleted inverted repeat (perfect inverted repeat 1..49) W DNA attB_phiK38-1 1934479 1934518 attB-phiK38-1 attachment site for actinophage attP-phiK38-1 attB/attP crossover seq.: CCTGGGAGCG(1934496..1934505), attB-L: GGTCAAGGAGTGGACGG(1934479..1934495), attB-R: GTACACCCTGTGG(1934506..1934518) C DNA attB_R4 3491441 3491490 attB_R4 attachment site for actinophage attP-R4 attB/attP crossover seq.: TTC(3491465..3491467), attB-L: TCGATGGTGAACGGGATCCGCCG(3491468..3491490), attB-R: CCGAAGGTGTCCTTGTACGGCACG(3491441..3491464) K DNA attB_phiBT1 4234051 4234102 attB-phiBT1 attachment site for actinophage attP-phiBT1 attB/attP crossover seq.: AGTGATCCA(1934496..1934505), attB-L: GTCCTTCCACAGGTTCTTGACGAA(4234051..4234074), attB-R: GATGACCCAGCTCCACACC(4234084..4234102) E DNA oriC 5288271 5288843 oriC replication origin containing 19 dna-box dna-box seq.: [TC][TC][A/G/C]TCCACA H DNA attB_phiC31 5372746 5372706 attB-phiC31 attachment site for actinophage attP-phiC31 attB/attP crossover seq.: CAA(5372725..5372727), attB-L: AGGGCACCCCCTGGCACCCG(5372727..5372746), attB-R: AGTACGCGCCGGGCGAGCC(5372706..5372724) H DNA attB_TG1 5518946 5518901 attB-TG1 attachment site for actinophage attP-TG1 attB/attP crossover seq.: AA(5518923..5518924), attB-L: GGTCTTGCCCGCGGAGCTGATC (5518946..5518925), attB-R: GACCTTCCACCCCGTGAAGGAG(5518922..5518901) L DNA attB_pSAM2 5594465 5594521 attB-pSAM2 attachment site for plasmid attP-pSAM2 attB/attP crossover seq.: G(5594498), attB: ACCTGGTGTTTCACTGTCGGGGTGGCGGGATTTGAACCCACGACCTCTTCGTCCCGA (5594465..5594521), inverted repeat copy A: TCAGGCCCGGTGCTGA (5594430..5594445), inverted repeat copy B: TCAGCACCGGGCCTGA (5594450..5594465) L DNA prophage 6673288 6711968 phiSAV prophage genome B DNA attB_phiK2 7130132 7130189 attB-phiK2 attachment site for actinophage attP-phiK2 attB/attP crossover seq.: AA(7130160..7130161), attB-L: GCTGTTCGCGTACATCTCCGCCTCGCCC (7130132..7130159), attB-R: CGTGATCCAGGAGATCTACGGCGCCTCC (7130162..7130189) F DNA ICE 4590544 4602112 ice putative integrative conjugative element (ICE) highly homologous to SLP1 DNA SAVERM_crisp1_01 8981275 8981247 CRISPR-1 repeat repeat: CGAACTACCCCCGCTCGCGCGGAGAGCAC; spacer: GCCCGCTTCCCGCCCTCGCTGATCGGGAAGCA D DNA SAVERM_crisp1_02 8981336 8981308 CRISPR-1 repeat repeat: CGACCAACTTCCGCTTGCGCGGAGAGCAC; spacer: GGCCGGCCGAACGAAGAAGCCACGGCGCGGCG D DNA SAVERM_crisp1_03 8981397 8981369 CRISPR-1 repeat repeat: CGATCCACCTCCGCTCGCGCGGAGAGCAC; spacer: ACCCTGAGTTCGGTGTCGACTGGCACGCACTA D DNA SAVERM_crisp1_04 8981458 8981430 CRISPR-1 repeat repeat: CGACCCACCTCTGCTCGCGCGGAGAGCAC; spacer: GCGGCTCAGGGCGGGGCCTGGAGGCGGGACTA D DNA SAVERM_crisp1_05 8981519 8981491 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGCAC; spacer: GAAGTGAGCTTCCGGTTCGTGGTGGTGACGGC D DNA SAVERM_crisp1_06 8981580 8981552 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGCAC; spacer: CATGGCGAAGTCGGCGCCTTCGGCTTCCTCGG D DNA SAVERM_crisp1_07 8981641 8981613 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: AACGGGTCGCGCCGCAACTGCTGGCCGACCGT D DNA SAVERM_crisp1_08 8981702 8981674 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TGGACCTCACCGCGCTGGATCCAGGGGAACGG D DNA SAVERM_crisp1_09 8981763 8981735 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CTCATCCTCGGCATCGACGAGAGCATCACCCA D DNA SAVERM_crisp1_10 8981824 8981796 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TTCGTCGCTGTCAGCTCTGCCCGCAGCTCCGT D DNA SAVERM_crisp1_11 8981885 8981857 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CTTCTCGTCTTGCAGGAACGCCAGCGCGCCGG D DNA SAVERM_crisp1_12 8981946 8981918 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TGCGGCACCGAGACCTCGAAGCCGTCGGCGAG D DNA SAVERM_crisp1_13 8982007 8981979 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TGGCCGTTGTCGTCCCTGGAGACGGAGCCCCA D DNA SAVERM_crisp1_14 8982068 8982040 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GACCGCTTCCTCGTCGAGCAAGCCGTCCTGCA D DNA SAVERM_crisp1_15 8982129 8982101 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GGGGTGTCCGGCCGCACGAGAAGCTGGTGCGT D DNA SAVERM_crisp1_16 8982190 8982162 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TACTGGCACCAGAGCCTCGGCCGGAACCCGAA D DNA SAVERM_crisp1_17 8982251 8982223 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CCCTGGCACCTCCAGCGCATGGCCGCCCTCGA D DNA SAVERM_crisp1_18 8982312 8982284 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TCCCGTTTCGGGCCCCGCCGTGTAGCTGCGAG D DNA SAVERM_crisp1_19 8982373 8982345 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: ACGAAGACCTCCGCACCGAAGCCGCCCGCCAA D DNA SAVERM_crisp1_20 8982434 8982406 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: AGCCAGTCCATGCCGAAGCCTCGCGGGTCGAC D DNA SAVERM_crisp1_21 8982495 8982467 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: ATGGGCCGCTGCTCCGTCGAGGGCTCGCAGAT D DNA SAVERM_crisp1_22 8982556 8982528 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GACAGTGAGGGCTGGCTAGACAAGAACGGGGA D DNA SAVERM_crisp1_23 8982617 8982589 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: AGCCAGTCCATGCCGAAGCCTCGCGGGTCGAC D DNA SAVERM_crisp1_24 8982678 8982650 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GTCTCGGTAACGGGCGGAACCAATTTCATCGA D DNA SAVERM_crisp1_25 8982739 8982711 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GCCAGCCGCCACGCAAAGAAGGTCCGTGACGA D DNA SAVERM_crisp1_26 8982800 8982772 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CCCGCTTCAGCTCGCGAGGGGCTCGGACAGTG D DNA SAVERM_crisp1_27 8982861 8982833 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: ACCGACAGTGTGGTCTGGCCGAGACCTGAAGC D DNA SAVERM_crisp1_28 8982922 8982894 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GGTCGACAGGCGGTAGGTGTCGACGCCGAAGC D DNA SAVERM_crisp1_29 8982983 8982955 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GCCAAGCTGGCCAGCGCCAAGGGCTTCGGTGG D DNA SAVERM_crisp1_30 8983044 8983016 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CCGACGACGGCCGAGCTCAACGCGGGCAGCGA D DNA SAVERM_crisp1_31 8983105 8983077 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CATCCATCCCGTGCACGGTCCTGCCGGTGGAC D DNA SAVERM_crisp1_32 8983166 8983138 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CTGTACCGGACCTAGAGCAGCAGATCGCCCAG D DNA SAVERM_crisp1_33 8983227 8983199 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: TCGATCTGCGACTGCCAGTTGGAGATGTTCAG D DNA SAVERM_crisp1_34 8983288 8983260 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GAGACGGTGACCCAGATCAGGGTGATGGCCGT D DNA SAVERM_crisp1_35 8983349 8983321 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GTTCGCGATGCCGTGGACGTTGGTGGTGTCCG D DNA SAVERM_crisp1_36 8983410 8983382 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: AGGTGCTAAAGCGGTAGCATTCACGGGAGCTC D DNA SAVERM_crisp1_37 8983471 8983443 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CGATGCCCGCATTCCAGCCTGCGTAGTACAGG D DNA SAVERM_crisp1_38 8983532 8983504 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: CACCGAGCAACGCTTCTGCCAGTTACGGACCG D DNA SAVERM_crisp1_39 8983593 8983565 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC; spacer: GCTCACGGCCCGCTCGGCTGCTGCTGCCGCCG D DNA SAVERM_crisp1_40 8983654 8983626 CRISPR-1 repeat repeat: CGACCCACCTCCGCTCGCGCGGAGAGAAC D DNA SAVERM_crisp2_01 8993378 8993350 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: ACACGGCTGTTGAGCCGGACGGCGCCGAGACC D DNA SAVERM_crisp2_02 8993439 8993411 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCCGATCGAGGGCGGTGTGAGCATGAGTATC D DNA SAVERM_crisp2_03 8993500 8993472 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: ACGTCGTGGGACTGGTTGGCCGCCGCGTTGAA D DNA SAVERM_crisp2_04 8993561 8993533 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CAGGTCGCCAGCCGCTGCCCGGTGTCGCAGTC D DNA SAVERM_crisp2_05 8993622 8993594 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCCCATGATGATTTGGCCAGGCACCCGAACCA D DNA SAVERM_crisp2_06 8993683 8993655 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCC; spacer: CACTAACTCAAGACGCAATGATCACAATCGGA D DNA SAVERM_crisp2_07 8993744 8993716 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCGATGATGCCGGCGTCGACGGCGATGGGGAA D DNA SAVERM_crisp2_08 8993805 8993777 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCGTTGAAGCTCATGCCGGTGCGCTTCTCCAG D DNA SAVERM_crisp2_09 8993866 8993838 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCGCCCGCGCCGCACTCATCCCCGACCAGGCG D DNA SAVERM_crisp2_10 8993927 8993899 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCCGTGAGCAGCCGACGTTCGGTGACCGGGGG D DNA SAVERM_crisp2_11 8993988 8993960 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCGTCGATGAGCGCCTAGCCTTGCTGGAACGA D DNA SAVERM_crisp2_12 8994049 8994021 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCCATGCAGCACCGCGGCGACCGCCACCCCCC D DNA SAVERM_crisp2_13 8994110 8994082 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TTGGGGCAGTAGGTCAGCGAGGATGCCGAGCC D DNA SAVERM_crisp2_14 8994171 8994143 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GAGAACTACGACGAGATGGCCAAGAAGACCGT D DNA SAVERM_crisp2_15 8994232 8994204 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: AACGACACGGCCGCCTTCAGCCCGCCCCAGAC D DNA SAVERM_crisp2_16 8994293 8994265 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCGCCCGCACCACTGACGTGCGACGAGTGCGG D DNA SAVERM_crisp2_17 8994354 8994326 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCGCGCGGGTCCAACGTCCAGGTCGTCCTCAC D DNA SAVERM_crisp2_18 8994415 8994387 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCCACCACGCGCTCCAGGAAGCTGGTCCCCTC D DNA SAVERM_crisp2_19 8994476 8994448 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCT; spacer: GGGTGTTCGTCGGCATCCCGGTGCTCGTCGTC D DNA SAVERM_crisp2_20 8994537 8994509 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CTCGGCAAGTCCGGCGCCGACGCCCTCTACGA D DNA SAVERM_crisp2_21 8994598 8994570 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CGCAGCGTCGGGTGCTGCCGCTTCATCAGGAC D DNA SAVERM_crisp2_22 8994659 8994631 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CAAGCGCGGTGTACACGATGTGGGGGTGGATC D DNA SAVERM_crisp2_23 8994720 8994692 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GTCCGCGCGGACCCGGGCGTCGGTGTCGACGC D DNA SAVERM_crisp2_24 8994781 8994753 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CAGTTCGGCAGCCTCCTCGGCGACATCTTCGG D DNA SAVERM_crisp2_25 8994842 8994814 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TGTGACGCCTGCCCCATCGCCAACGCGACGCC D DNA SAVERM_crisp2_26 8994903 8994875 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCT; spacer: TCTTCGCCCCGGCCGTCCCCGCCGCCGCCTTC D DNA SAVERM_crisp2_27 8994964 8994936 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCCGCACCTGCAGACGTACGTCCAGTCCAAC D DNA SAVERM_crisp2_28 8995025 8994997 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCCTGGGACGCCCTCAAGGTCCCGAACGTCTG D DNA SAVERM_crisp2_29 8995086 8995058 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GTGGGGGAGGCTGCGGAGGCGCAGACCACGTT D DNA SAVERM_crisp2_30 8995147 8995119 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TACGCGTGGGGCGGCATCCTGGTGCGCACCTC D DNA SAVERM_crisp2_31 8995208 8995180 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCTGCCATCGAGTCATCCCCTGCGACCCCGGG D DNA SAVERM_crisp2_32 8995269 8995241 CRISPR-2 repeat repeat: GTTCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GTTTCGTACCCGAGGGCCGGGCCGATGATGGT D DNA SAVERM_crisp2_33 8995330 8995302 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GACATGATCGCAGCCCGATTCCTGCGGCAGGA D DNA SAVERM_crisp2_34 8995391 8995363 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCCACGGACGGCAACTGATCCCCGGCATGAAC D DNA SAVERM_crisp2_35 8995452 8995424 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GTCAACCGCGCGTTCGGCCGCAGCCGGCTGGT D DNA SAVERM_crisp2_36 8995513 8995485 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCTGACCGGCTGGCGTTCCAGGCGACGTCGAC D DNA SAVERM_crisp2_37 8995574 8995546 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TACGCCATCGCCTGGCGTAACGCGCTCCTCAC D DNA SAVERM_crisp2_38 8995635 8995607 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: ACCGTCACGTTCGACACGCGGGTCGGGTTGTA D DNA SAVERM_crisp2_39 8995696 8995668 CRISPR-2 repeat repeat: GTGCTCTCCGCGTGAACGGAGGTGAACCG; spacer: GACATCCACGGCAACCCGCTGAAGCTGACCCG D DNA SAVERM_crisp2_40 8995757 8995729 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: AAAACCGGGCGCGCCGTGCAACCTGACGGCCC D DNA SAVERM_crisp2_41 8995818 8995790 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: ATCAGCAGCATCGCCAAGGCCATCGTGGCGGG D DNA SAVERM_crisp2_42 8995879 8995851 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GAGCCGGAGGCCCGGCAGACCGCCGTCGCCGA D DNA SAVERM_crisp2_43 8995940 8995912 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCCGCCCGAAGAAGGACCGCAGTACCGCCCCGTA D DNA SAVERM_crisp2_44 8996003 8995975 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCCTCAACAGGCCGTCAACCGAGCACGCCAA D DNA SAVERM_crisp2_45 8996064 8996036 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: ACGGACAAGGGCATCACCGTCCTTTTCACCTC D DNA SAVERM_crisp2_46 8996125 8996097 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GAGACCCTTGCGAAGACCAGGCGTGCCAGTGC D DNA SAVERM_crisp2_47 8996186 8996158 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCGCGGTGCCGCCACAGCGACGGTCGGGCGCC D DNA SAVERM_crisp2_48 8996247 8996219 CRISPR-2 repeat repeat: GTGCTCTCCGCGTGAGCGGAGGTGAACCG; spacer: CTGATGCTCGACATCGCGAAGGGCATGCAGGC D DNA SAVERM_crisp2_49 8996308 8996280 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCGAGAACGAGCGGCTGAAGGCGGCGAAGCC D DNA SAVERM_crisp2_50 8996369 8996341 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCATGGAGTAGCCCTGCTTGAAGGCGTCGTA D DNA SAVERM_crisp2_51 8996430 8996402 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TCGGACACCGAGGTCAGCGCGTGGCTGCTGTC D DNA SAVERM_crisp2_52 8996491 8996463 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: CCACCGGGGACGTAGCCGACGTCCGCCGCCCC D DNA SAVERM_crisp2_53 8996552 8996524 CRISPR-2 repeat repeat: GTGCTCTCCGCGTGAGCGGAGGTGAACCG; spacer: TCGGAGCTGGCCAGGGAGCTGACCACCCGGGT D DNA SAVERM_crisp2_54 8996613 8996585 CRISPR-2 repeat repeat: GTGCTCTCCGTGCGAGCGGAGGTGAACCG; spacer: CTTCCAGGTCAGCGGGAACTGGCCAAGGCTGA D DNA SAVERM_crisp2_55 8996674 8996646 CRISPR-2 repeat repeat: GTGCTCTCCGCACGAGCGGTGGTGAACCG; spacer: AAGCCGGAGACCGAGCAGCAGGACCAGCCTCA D DNA SAVERM_crisp2_56 8996735 8996707 CRISPR-2 repeat repeat: GTGCTCTCCGCGCCAGCGGAGGTGAACCG; spacer: TACTGGATCTTCCCCGTCCGTGACGAGCACGGG D DNA SAVERM_crisp2_57 8996797 8996769 CRISPR-2 repeat repeat: GTGCTCCCCGCGCGAGCGGAGGTGAACCG; spacer: CCATGGTGATCTACCACAGCGAACTTGCGGGC D DNA SAVERM_crisp2_58 8996858 8996830 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GTCCGCCTCGACGGTCTGCACCGGGCGAAGAT D DNA SAVERM_crisp2_59 8996919 8996891 CRISPR-2 repeat repeat: GTGTTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TACCCGGTTCAGTGAAGGTCAGCTGGGGCCGT D DNA SAVERM_crisp2_60 8996980 8996952 CRISPR-2 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGCGAACCG D DNA SAVERM_crisp3_01 9002748 9002720 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GACGCCGACCGAACCGTCATGCTGACCGTGGA D DNA SAVERM_crisp3_02 9002809 9002781 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCCACCGTGGATATCAAGCTGGCCGAGCGGAA D DNA SAVERM_crisp3_03 9002870 9002842 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: TGGCGCCAGCCGATGGCCGTGCGCTCACCGTC D DNA SAVERM_crisp3_04 9002931 9002903 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GACGGGGACACGCTTCGCGTGATGCTGGACCA D DNA SAVERM_crisp3_05 9002992 9002964 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGGTGAACCG; spacer: GCGGACAACGAGGTGCGGGACGGGATCCGGTC D DNA SAVERM_crisp3_06 9003053 9003025 CRISPR-3 repeat repeat: GTGCTCTCCGCGCGAGCGGAGATGAACCG D DNA LTR-R 9025608 9025440 tirR right terminal inverted repeat incompleted inverted repeat (perfect inverted repeat 9025560..9025608) D IS ISSAVERM9 23622 25034 ISSav9 Inverted repeat sequence (16/18 bp): Target sequence (CTAG) SAVERM_18..SAVERM_19 W IS5 family (IS427 group) IS ISSAVERM10 55644 56560 ISSav10 Inverted repeat sequence (12/14 bp) SAVERM_45..SAVERM_46 W IS5 family (IS427-group) IS ISSAVERM11 56610 57918 ISSav11 Inverted repeat sequence (12/15 bp): Target sequence (AT) SAVERM_47 W IS200/IS605 family (IS608 group) IS ISSAVERM12 87687 89851 ISSav12 Inverted repeat sequence (16/17 bp): Target sequence (CTAG) SAVERM_78..SAVERM_79 A IS607 family IS ISSAVERM13 119399 121219 ISSav13 Inverted repeat sequence (22/25 bp): Target sequence (CG) SAVERM_103..SAVERM_104 A IS256 family IS ISSAVERM14 131931 133947 ISSav14 Inverted repeat sequence (21/27 bp): Target sequence (GC) SAVERM_113..SAVERM_116 A IS701 family IS ISSAVERM15 136639 137502 ISSav15 Inverted repeat sequence (18/24 bp) SAVERM_118..SAVERM_119 A IS5 family (IS427 group) IS ISSAVERM3 137505 138900 ISSav3 Inverted repeat sequence (15/15 bp): Target sequence (TA) SAVERM_120 A IS701 family IS ISSAVERM16 139335 140688 ISSav16 Inverted repeat sequence (12/15 bp): Target sequence (GG) SAVERM_122 A IS110 family IS ISSAVERM17 242245 244816 ISSav17 Inverted repeat sequence (13/17 bp): Target sequence (GG) SAVERM_208..SAVERM_209 A IS110 family (IS900 group) IS ISSAVERM18 263224 264596 ISSav18 Inverted repeat sequence (10/16 bp) SAVERM_225 A IS256 family IS ISSAVERM19 266715 268155 ISSav19 Inverted repeat sequence (16/18 bp): Target sequence (CTAG) SAVERM_227 A IS701 family IS ISSAVERM20 298511 299908 ISSav20 Inverted repeat sequence (30/37 bp): Target sequence (GG) SAVERM_256 A ISL3 family IS ISSAVERM5A 305283 307013 ISSav5A Inverted repeat sequence (30/30 bp): Target sequence (AGAATTCA) SAVERM_263; same as ISSAVERM5B and ISSAVERM5C A ISL3 family IS ISSAVERM21 336641 337854 ISSav21 Inverted repeat sequence (13/13 bp): Target sequence (CTAG) SAVERM_287..SAVERM_288 A IS630 family IS ISSAVERM4A 337859 339284 ISSav4A Inverted repeat sequence (16/16 bp): Target sequence (CTAG) SAVERM_289; same as ISSAVERM4B and ISSAVERM4C A IS701 family IS ISSAVERM22 339207 342900 ISSav22 Inverted repeat sequence (13/17 bp) SAVERM_290..SAVERM_291 A IS30 family IS ISSAVERM6A 350972 352397 ISSav6A Inverted repeat sequence (17/23 bp): Target sequence (CG) SAVERM_300; same as ISSAVERM6B (with 1bp mismatch) A IS256 family IS ISSAVERM23 366773 368534 ISSav23 Inverted repeat sequence (11/11 bp) SAVERM_309..SAVERM_310 A IS3 family IS ISSAVERM24 368537 370300 ISSav24 Inverted repeat sequence (21/22 bp): Target sequence (TA) SAVERM_311..SAVERM_312 A IS4 family IS ISSAVERM1A 370996 372771 ISSav1A Inverted repeat sequence (36/37 bp): Target sequence (GAGTACTTT) SAVERM_313; same as ISSAVERM1B A IS4 family (IS4 group) IS ISSAVERM25 372707 374011 ISSav25 Inverted repeat sequence (10/11 bp): Target sequence (CC) SAVERM_314..SAVERM_315 A IS3 family (IS3 group) IS ISSAVERM26 374645 376826 ISSav26 Inverted repeat sequence (16/17 bp): Target sequence (CTAG) SAVERM_317..SAVERM_318 A IS607 family IS ISSAVERM4B 376831 378256 ISSav4B Inverted repeat sequence (16/16 bp): Target sequence (CTAG) SAVERM_319; same as ISSAVERM4A and ISSAVERM4C A IS701 family IS ISSAVERM6B 404538 405963 ISSav6B Inverted repeat sequence (17/23 bp): Target sequence (NG) SAVERM_347; same as ISSAVERM6A (with 1bp mismatch) A IS256 family IS ISSAVERM1B 429919 431694 ISSav1B Inverted repeat sequence (36/37 bp): Target sequence (GNGTACNTC) SAVERM_365; same as ISSAVERM1A A IS4 family (IS4 group) IS ISSAVERM27 629809 630954 ISSav27 Inverted repeat sequence (25/26 bp): Target sequence (TA) SAVERM_479..SAVERM_480 A IS3 family (IS3 group) IS ISSAVERM2 828223 830160 ISSav2 Inverted repeat sequence (22/24 bp) SAVERM_670..SAVERM_671 A IS701 family IS ISSAVERM7A 893349 894501 ISSav7A Inverted repeat sequence (23/25 bp): Target sequence (TA) SAVERM_744..SAVERM_745; same as ISSAVERM7B (with 1bp mismatch) A IS630 family IS ISSAVERM4C 1240258 1241683 ISSav4C Inverted repeat sequence (16/16 bp): Target sequence (CTAG) SAVERM_977; same as ISSAVERM4A and ISSAVERM4B A IS701 family IS ISSAVERM28 1493942 1495177 ISSav28 Inverted repeat sequence (27/29 bp): Target sequence (CTAG) SAVERM_1204 U IS3 family (IS407 group) IS ISSAVERM29 4605752 4607177 ISSav29 Inverted repeat sequence (19/21 bp): Target sequence (CTAG) SAVERM_3722 G1 IS701 family IS ISSAVERM30 4623409 4625361 ISSav30 Inverted repeat sequence (22/26 bp) SAVERM_3741 G1 IS481 family IS ISSAVERM8A 4875165 4876348 ISSav8A Inverted repeat sequence (10/10 bp): Target sequence (CTAG) SAVERM_3951; extremely similar to ISSAVERM8B G1 IS630 family IS ISSAVERM31 5172525 5173387 ISSav31 Inverted repeat sequence (18/19 bp): Target sequence (CTTAN) SAVERM_4215..SAVERM_4216; similar to ISSAVERM36 H IS5 family (IS427 group) IS ISSAVERM8B 5429184 5430367 ISSav8B Inverted repeat sequence (10/10 bp): Target sequence (CTAG) SAVERM_4443; extremely similar to ISSAVERM8A H IS630 family IS ISSAVERM32 5455552 5456486 ISSav32 Inverted repeat sequence (10/12 bp) SAVERM_4466 H IS5 family IS ISSAVERM34 8954891 8957414 ISSav34 Inverted repeat sequence (10/10 bp): Target sequence (CTAG) SAVERM_7511..SAVERM_7513; similar to ISSAVERM8A and ISSAVERM8B D IS630 family IS ISSAVERM33 8955165 8956396 ISSav33 Inverted repeat sequence (10/17 bp) SAVERM_7512; inserts between SAVERM_7511 and SAVERM_7513 D IS110 family IS ISSAVERM5B 8997013 8998743 ISSav5B Inverted repeat sequence (30/30 bp): Target sequence (TGAAATGT) SAVERM_7545; same as ISSAVERM5A and ISSAVERM5C D ISL3 family IS ISSAVERM35 8998764 9000920 ISSav35 Inverted repeat sequence (16/20 bp): Target sequence (CG) SAVERM_7546..SAVERM_7547 D IS21 family IS ISSAVERM5C 9000941 9002671 ISSav5C Inverted repeat sequence (30/30 bp): Target sequence (TGAAAAGT) SAVERM_7548; same as ISSAVERM5A and ISSAVERM5B D ISL3 family IS ISSAVERM36 9004202 9005064 ISSav36 Inverted repeat sequence (19/19 bp): Target sequence (CTAAG) SAVERM_7553..SAVERM_7554; similar to ISSAVERM31 D IS5 family (IS427 group) IS ISSAVERM38 9006176 9007184 ISSav38 Inverted repeat sequence (9/12 bp) SAVERM_7556..SAVERM_7557 D IS5 family (IS1031 group) IS ISSAVERM37 9007161 9008416 ISSav37 Inverted repeat sequence (19/25 bp): Target sequence (TGAC) SAVERM_7558 D IS5 family (ISL2 group) IS ISSAVERM7B 9019857 9021009 ISSav7B Inverted repeat sequence (23/25 bp): Target sequence (TA) SAVERM_7569..SAVERM_7570; similar to ISSAVERM7A D IS630 family RNA SAVERM_t1 357776 357847 trn1 codon recognized: GUG (pos:357808..357810, aa: Val) A tRNA-Val RNA SAVERM_t2 1675869 1675942 trn2 codon recognized: AUG (pos:1675903..1675905, aa: Met) P tRNA-Met RNA SAVERM_t68 1965423 1965347 trn68 codon recognized: CCC (pos:1965387..1965389, aa: Pro) C tRNA-Pro RNA SAVERM_t67 1992088 1992012 trn67 codon recognized: CCC (pos:1992052..1992054, aa: Pro) C tRNA-Pro RNA SAVERM_t66 2222686 2222599 trn66 codon recognized: CUC (pos:2222651..2222653, aa: Leu) C tRNA-Leu RNA SAVERM_t65 3072707 3072632 trn65 codon recognized: ACC (pos:3072672..3072674, aa: Thr) Q tRNA-Thr RNA SAVERM_r1 3073684 3073559 rrnA3 5S ribosomal RNA rrnA_5S Q RNA SAVERM_r2 3076895 3073772 rrnA2 23S ribosomal RNA rrnA_23S V/Q RNA SAVERM_r3 3078735 3077206 rrnA1 16S ribosomal RNA rrnA_16S V RNA SAVERM_t64 3295324 3295252 trn64 codon recognized: GAG (pos:3295288..3295290, aa: Glu) J tRNA-Glu RNA SAVERM_t63 3295416 3295345 trn63 codon recognized: CAG (pos:3295381..3295383, aa: Gln) J tRNA-Gln RNA SAVERM_t62 3295510 3295438 trn62 codon recognized: GAG (pos:3295474..3295476, aa: Glu) J tRNA-Glu RNA SAVERM_t61 3295645 3295573 trn61 codon recognized: GAG (pos:3295609..3295611, aa: Glu) J tRNA-Glu RNA SAVERM_t60 3295759 3295688 trn60 codon recognized: CAG (pos:3295724..3295726, aa: Gln) J tRNA-Gln RNA SAVERM_t3 3655871 3655942 trn3 codon recognized: CGG (pos:3655904..3655906, aa: Arg) K tRNA-Arg RNA SAVERM_t59 3813166 3813093 trn59 codon recognized: AUG (pos:3813130..3813132, aa: Met) N tRNA-Met RNA SAVERM_t58 3815530 3815456 trn58 codon recognized: AUG (pos:3815494..3815496, aa: Met) N tRNA-Met RNA SAVERM_t57 4362695 4362610 trn57 codon recognized: UUA (pos:4362661..4362663, aa: Leu) E tRNA-Leu RNA SAVERM_t4 4410534 4410608 trn4 codon recognized: CAA (pos:4410567..4410569, aa: Gln) E tRNA-Gln RNA SAVERM_t56 4542542 4542466 trn56 codon recognized: GCG (pos:4542506..4542508, aa: Ala) E tRNA-Ala RNA SAVERM_t5 4589760 4589835 trn5 codon recognized: UGG (pos:4589793..4589795, aa: Arg) G1 tRNA-Arg RNA SAVERM_t55 4886906 4886830 trn55 codon recognized: ACA (pos:4886870..4886872, aa: Thr) G1 tRNA-Thr RNA SAVERM_r4 5024225 5024100 rrnB3 5S ribosomal RNA rrnB_5S G1 RNA SAVERM_r5 5027435 5024313 rrnB2 23S ribosomal RNA rrnB_23S H/G1 RNA SAVERM_r6 5029275 5027746 rrnB1 16S ribosomal RNA rrnB_16S H RNA SAVERM_t54 5052043 5051970 trn54 codon recognized: AUG (pos:5052007..5052009, aa: Met) H tRNA-Met RNA SAVERM_t53 5055561 5055486 trn53 codon recognized: AAA (pos:5055526..5055528, aa: Lys) H tRNA-Lys RNA SAVERM_t6 5063087 5063159 trn6 codon recognized: GAA (pos:5063121..5063123, aa: Glu) H tRNA-Glu RNA SAVERM_t7 5063207 5063281 trn7 codon recognized: GAC (pos:5063242..5063244, aa: Asp) H tRNA-Asp RNA SAVERM_t8 5063306 5063382 trn8 codon recognized: UUC (pos:5063340..5063342, aa: Phe) H tRNA-Phe RNA SAVERM_t9 5068123 5068197 trn9 codon recognized: GAC (pos:5068158..5068160, aa: Asp) H tRNA-Asp RNA SAVERM_t10 5081791 5081866 trn10 codon recognized: GGC (pos:5081824..5081826, aa: Gly) H tRNA-Gly RNA SAVERM_t11 5085779 5085854 trn11 codon recognized: GGC (pos:5085812..5085814, aa: Gly) H tRNA-Gly RNA SAVERM_m1 5095146 5095065 crn small cytoplasmic 4.5S RNA 4.5S RNA, Ffh(SAV2648) and FtsY(SAV2654) will form SRP(signal recognition particle) H RNA SAVERM_t12 5095224 5095311 trn12 codon recognized: UCC (pos:5095258..5095260, aa: Ser) H tRNA-Ser RNA SAVERM_t13 5129698 5129782 trn13 codon recognized: UCG (pos:5129732..5129734, aa: Ser) H tRNA-Ser RNA SAVERM_t52 5155009 5154937 trn52 codon recognized: CGU (pos:5154974..5154976, aa: Arg) H tRNA-Arg RNA SAVERM_t51 5155305 5155215 trn51 codon recognized: AGC (pos:5155267..5155269, aa: Ser) H tRNA-Ser RNA SAVERM_t50 5177777 5177691 trn50 codon recognized: UCA (pos:5177741..5177743, aa: Ser) H tRNA-Ser RNA SAVERM_t49 5207028 5206939 trn49 codon recognized: AGC (pos:5206994..5206996, aa: Ser) H tRNA-Ser RNA SAVERM_t14 5299302 5299378 trn14 codon recognized: AUC (pos:5299336..5299338, aa: Ile) H tRNA-Ile RNA SAVERM_t15 5304905 5304977 trn15 codon recognized: GCA (pos:5304938..5304940, aa: Ala) H tRNA-Ala RNA SAVERM_t16 5322106 5322192 trn16 codon recognized: CUG (pos:5322140..5322142, aa: Leu) H tRNA-Leu RNA SAVERM_t48 5452842 5452769 trn48 codon recognized: GGG (pos:5452808..5452810, aa: Gly) H tRNA-Gly RNA SAVERM_t47 5594554 5594481 trn47 codon recognized: CCG (pos:5594518..5594520, aa: Pro) L tRNA-Pro RNA SAVERM_t17 5650316 5650389 trn17 codon recognized: ACG (pos:5650350..5650352, aa: Thr) L tRNA-Thr RNA SAVERM_r7 5759344 5760873 rrnC1 16S ribosomal RNA rrnC_16S R RNA SAVERM_r8 5761184 5764306 rrnC2 23S ribosomal RNA rrnC_23S R/I RNA SAVERM_r9 5764394 5764519 rrnC3 5S ribosomal RNA rrnC_5S I RNA SAVERM_t18 5950170 5950251 trn18 codon recognized: UAC (pos:5950204..5950206, aa: Tyr) I tRNA-Tyr RNA SAVERM_t19 5956602 5956674 trn19 codon recognized: ACC (pos:5956635..5956637, aa: Thr) I tRNA-Thr RNA SAVERM_t20 5956721 5956793 trn20 codon recognized: AUG (pos:5956754..5956756, aa: Met) I tRNA-Met RNA SAVERM_t21 5964532 5964607 trn21 codon recognized: UGG (pos:5964565..5964567, aa: Trp) I tRNA-Trp RNA SAVERM_r10 6124388 6125917 rrnD1 16S ribosomal RNA rrnD_16S I RNA SAVERM_r11 6126228 6129350 rrnD2 23S ribosomal RNA rrnD_23S I/B RNA SAVERM_r12 6129438 6129563 rrnD3 5S ribosomal RNA rrnD_5S B RNA SAVERM_m2 6202758 6203146 srn1 stable RNA mature tmRNA has 3-prime CCA tail B RNA SAVERM_t46 6242335 6242261 trn46 codon recognized: UGC (pos:6242300..6242302, aa: Cys) B tRNA-Cys RNA SAVERM_t45 6279112 6279029 trn45 codon recognized: CUA (pos:6279077..6279079, aa: Leu) B tRNA-Leu RNA SAVERM_t44 6329278 6329202 trn44 codon recognized: AAG (pos:6329242..6329244, aa: Lys) B tRNA-Lys RNA SAVERM_t43 6335141 6335068 trn43 codon recognized: AAG (pos:6335105..6335107, aa: Lys) B tRNA-Lys RNA SAVERM_t42 6349385 6349312 trn42 codon recognized: AAG (pos:6349349..6349351, aa: Lys) B tRNA-Lys RNA SAVERM_t41 6372777 6372705 trn41 codon recognized: CAC (pos:6372742..6372744, aa: His) B tRNA-His RNA SAVERM_t40 6501584 6501509 trn40 codon recognized: AGA (pos:6501549..6501551, aa: Arg) B tRNA-Arg RNA SAVERM_t39 6604508 6604435 trn39 codon recognized: GGA (pos:6604474..6604476, aa: Gly) B tRNA-Gly RNA SAVERM_t22 6604662 6604738 trn22 codon recognized: CCA (pos:6604696..6604698, aa: Pro) B tRNA-Pro RNA SAVERM_t23 6653846 6653918 trn23 codon recognized: GCC (pos:6653879..6653881, aa: Ala) B tRNA-Ala RNA SAVERM_t24 6658303 6658375 trn24 codon recognized: GCC (pos:6658336..6658338, aa: Ala) B tRNA-Ala RNA SAVERM_t25 6875603 6875675 trn25 codon recognized: AAC (pos:6875636..6875638, aa: Asn) B tRNA-Asn RNA SAVERM_t26 6875681 6875753 trn26 codon recognized: AAC (pos:6875714..6875716, aa: Asn) B tRNA-Asn RNA SAVERM_t27 6875920 6875996 trn27 codon recognized: AUG (pos:6875954..6875956, aa: Met) B tRNA-Met RNA SAVERM_t28 7021984 7022058 trn28 codon recognized: GUA (pos:7022016..7022018, aa: Val) B tRNA-Val RNA SAVERM_m3 7093710 7094056 rnpB putative RNase P RNA component Protein component (SAV4314: RnpA) F RNA SAVERM_t38 7471342 7471270 trn38 codon recognized: UUG (pos:7471307..7471309, aa: Leu) F tRNA-Leu RNA SAVERM_r13 7765515 7767044 rrnE1 16S ribosomal RNA rrnE_16S S RNA SAVERM_r14 7767351 7770474 rrnE2 23S ribosomal RNA rrnE_23S S/G2 RNA SAVERM_r15 7770611 7770736 rrnE3 5S ribosomal RNA rrnE_5S G2 RNA SAVERM_t37 7937550 7937463 trn37 codon recognized: CUC (pos:7937515..7937517, aa: Leu) G2 tRNA-Leu RNA SAVERM_t36 8122426 8122352 trn36 codon recognized: GUC (pos:8122392..8122394, aa: Val) G2 tRNA-Val RNA SAVERM_t35 8122538 8122467 trn35 codon recognized: GUC (pos:8122504..8122506, aa: Val) G2 tRNA-Val RNA SAVERM_t34 8122629 8122558 trn34 codon recognized: GUC (pos:8122595..8122597, aa: Val) G2 tRNA-Val RNA SAVERM_t33 8122704 8122631 trn33 codon recognized: UGC (pos:8122670..8122672, aa: Cys) G2 tRNA-Cys RNA SAVERM_t32 8122815 8122743 trn32 codon recognized: GGC (pos:8122780..8122782, aa: Gly) G2 tRNA-Gly RNA SAVERM_t29 8129564 8129635 trn29 codon recognized: GUG (pos:8129596..8129598, aa: Val) G2 tRNA-Val RNA SAVERM_t30 8139938 8140012 trn30 codon recognized: GUG (pos:8139970..8139972, aa: Val) G2 tRNA-Val RNA SAVERM_r16 8328598 8330127 rrnF1 16S ribosomal RNA rrnF_16S T RNA SAVERM_r17 8330438 8333560 rrnF2 23S ribosomal RNA rrnF_23S T/D RNA SAVERM_r18 8333648 8333773 rrnF3 5S ribosomal RNA rrnF_5S D RNA SAVERM_t31 8576989 8577062 trn31 codon recognized: CCC (pos:8577023..8577025, aa: Pro) D tRNA-Pro